Basic Information | |
---|---|
Family ID | F097274 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 104 |
Average Sequence Length | 40 residues |
Representative Sequence | MGRDIMVRAVAEEALALASVTLFLAMVAVWVQVLGVV |
Number of Associated Samples | 86 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 11.88 % |
% of genes near scaffold ends (potentially truncated) | 53.85 % |
% of genes from short scaffolds (< 2000 bps) | 90.38 % |
Associated GOLD sequencing projects | 82 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.56 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (66.346 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.385 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.731 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (64.423 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.85% β-sheet: 0.00% Coil/Unstructured: 46.15% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF02811 | PHP | 61.54 |
PF07733 | DNA_pol3_alpha | 8.65 |
PF12760 | Zn_Tnp_IS1595 | 1.92 |
PF09926 | DUF2158 | 0.96 |
PF00171 | Aldedh | 0.96 |
PF14579 | HHH_6 | 0.96 |
PF00166 | Cpn10 | 0.96 |
PF12833 | HTH_18 | 0.96 |
PF06568 | DUF1127 | 0.96 |
COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
---|---|---|---|
COG0587 | DNA polymerase III, alpha subunit | Replication, recombination and repair [L] | 8.65 |
COG2176 | DNA polymerase III, alpha subunit (gram-positive type) | Replication, recombination and repair [L] | 8.65 |
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.96 |
COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.96 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.96 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.96 |
COG5457 | Uncharacterized conserved protein YjiS, DUF1127 family | Function unknown [S] | 0.96 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 66.35 % |
All Organisms | root | All Organisms | 33.65 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001471|JGI12712J15308_10079373 | Not Available | 831 | Open in IMG/M |
3300004092|Ga0062389_103591897 | Not Available | 582 | Open in IMG/M |
3300005332|Ga0066388_103248197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 831 | Open in IMG/M |
3300005531|Ga0070738_10379434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 564 | Open in IMG/M |
3300005538|Ga0070731_10759235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 644 | Open in IMG/M |
3300005543|Ga0070672_100600963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 958 | Open in IMG/M |
3300005764|Ga0066903_106036925 | Not Available | 634 | Open in IMG/M |
3300006606|Ga0074062_12546657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 635 | Open in IMG/M |
3300006806|Ga0079220_10311220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 979 | Open in IMG/M |
3300009519|Ga0116108_1006666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4732 | Open in IMG/M |
3300009519|Ga0116108_1041277 | Not Available | 1489 | Open in IMG/M |
3300009522|Ga0116218_1334856 | Not Available | 677 | Open in IMG/M |
3300009523|Ga0116221_1129357 | Not Available | 1105 | Open in IMG/M |
3300009545|Ga0105237_11961421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia felis | 594 | Open in IMG/M |
3300009643|Ga0116110_1293086 | Not Available | 517 | Open in IMG/M |
3300009683|Ga0116224_10102667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 1385 | Open in IMG/M |
3300009698|Ga0116216_10057503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 2396 | Open in IMG/M |
3300009700|Ga0116217_10550647 | Not Available | 721 | Open in IMG/M |
3300009764|Ga0116134_1264706 | Not Available | 592 | Open in IMG/M |
3300009826|Ga0123355_11331454 | Not Available | 717 | Open in IMG/M |
3300009839|Ga0116223_10878209 | Not Available | 512 | Open in IMG/M |
3300010049|Ga0123356_13711170 | Not Available | 528 | Open in IMG/M |
3300010376|Ga0126381_104470628 | Not Available | 540 | Open in IMG/M |
3300010376|Ga0126381_104473531 | Not Available | 540 | Open in IMG/M |
3300010379|Ga0136449_100313117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 2851 | Open in IMG/M |
3300010379|Ga0136449_100788710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1573 | Open in IMG/M |
3300010379|Ga0136449_100912599 | Not Available | 1429 | Open in IMG/M |
3300010379|Ga0136449_101684873 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 957 | Open in IMG/M |
3300010379|Ga0136449_102530570 | Not Available | 735 | Open in IMG/M |
3300010379|Ga0136449_102783211 | Not Available | 691 | Open in IMG/M |
3300010398|Ga0126383_12290927 | Not Available | 626 | Open in IMG/M |
3300011067|Ga0138594_1019341 | Not Available | 634 | Open in IMG/M |
3300012089|Ga0153924_1130338 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 520 | Open in IMG/M |
3300013296|Ga0157374_11535588 | Not Available | 689 | Open in IMG/M |
3300014156|Ga0181518_10308959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 785 | Open in IMG/M |
3300014164|Ga0181532_10318502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 877 | Open in IMG/M |
3300014164|Ga0181532_10355474 | Not Available | 820 | Open in IMG/M |
3300015373|Ga0132257_104178677 | Not Available | 525 | Open in IMG/M |
3300016270|Ga0182036_10464270 | Not Available | 997 | Open in IMG/M |
3300016319|Ga0182033_10607913 | Not Available | 950 | Open in IMG/M |
3300016319|Ga0182033_11083620 | Not Available | 715 | Open in IMG/M |
3300016341|Ga0182035_11205935 | Not Available | 676 | Open in IMG/M |
3300016341|Ga0182035_12180014 | Not Available | 502 | Open in IMG/M |
3300016404|Ga0182037_10679340 | Not Available | 880 | Open in IMG/M |
3300016422|Ga0182039_12265450 | Not Available | 501 | Open in IMG/M |
3300016445|Ga0182038_11157272 | Not Available | 689 | Open in IMG/M |
3300017823|Ga0187818_10544198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 523 | Open in IMG/M |
3300017931|Ga0187877_1193303 | Not Available | 801 | Open in IMG/M |
3300017943|Ga0187819_10488130 | Not Available | 703 | Open in IMG/M |
3300017970|Ga0187783_10598923 | Not Available | 797 | Open in IMG/M |
3300017970|Ga0187783_10600082 | Not Available | 796 | Open in IMG/M |
3300017970|Ga0187783_10620070 | Not Available | 782 | Open in IMG/M |
3300017972|Ga0187781_10030035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3756 | Open in IMG/M |
3300017972|Ga0187781_10370246 | Not Available | 1021 | Open in IMG/M |
3300017972|Ga0187781_11132035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 575 | Open in IMG/M |
3300017973|Ga0187780_10399101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Pinirhizobacter → Pinirhizobacter soli | 975 | Open in IMG/M |
3300017975|Ga0187782_10363737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1096 | Open in IMG/M |
3300017975|Ga0187782_10414139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1025 | Open in IMG/M |
3300017975|Ga0187782_10678600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 794 | Open in IMG/M |
3300018003|Ga0187876_1189892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 695 | Open in IMG/M |
3300018006|Ga0187804_10482928 | Not Available | 555 | Open in IMG/M |
3300018033|Ga0187867_10339782 | Not Available | 837 | Open in IMG/M |
3300018062|Ga0187784_11200582 | Not Available | 602 | Open in IMG/M |
3300019284|Ga0187797_1207768 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 506 | Open in IMG/M |
3300020579|Ga0210407_10043353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 3349 | Open in IMG/M |
3300020582|Ga0210395_10256963 | Not Available | 1313 | Open in IMG/M |
3300020583|Ga0210401_10183238 | Not Available | 1950 | Open in IMG/M |
3300021171|Ga0210405_10153964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1820 | Open in IMG/M |
3300021180|Ga0210396_10256200 | Not Available | 1555 | Open in IMG/M |
3300021403|Ga0210397_10035040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3154 | Open in IMG/M |
3300021403|Ga0210397_11418587 | Not Available | 539 | Open in IMG/M |
3300021420|Ga0210394_11031652 | Not Available | 711 | Open in IMG/M |
3300025453|Ga0208455_1059639 | Not Available | 791 | Open in IMG/M |
3300025460|Ga0208562_1105303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 544 | Open in IMG/M |
3300025920|Ga0207649_10722714 | Not Available | 773 | Open in IMG/M |
3300027625|Ga0208044_1144024 | Not Available | 665 | Open in IMG/M |
3300027667|Ga0209009_1201935 | Not Available | 502 | Open in IMG/M |
3300027853|Ga0209274_10520431 | Not Available | 616 | Open in IMG/M |
3300028906|Ga0308309_10284982 | Not Available | 1393 | Open in IMG/M |
3300029636|Ga0222749_10582068 | Not Available | 611 | Open in IMG/M |
3300029993|Ga0302304_10265317 | Not Available | 631 | Open in IMG/M |
3300030617|Ga0311356_12057106 | Not Available | 503 | Open in IMG/M |
3300030618|Ga0311354_10238749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1916 | Open in IMG/M |
3300030707|Ga0310038_10378193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 621 | Open in IMG/M |
3300030760|Ga0265762_1175758 | Not Available | 524 | Open in IMG/M |
3300031525|Ga0302326_13556488 | Not Available | 516 | Open in IMG/M |
3300031543|Ga0318516_10328020 | Not Available | 884 | Open in IMG/M |
3300031573|Ga0310915_10742877 | Not Available | 692 | Open in IMG/M |
3300031708|Ga0310686_103554807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium japonicum | 577 | Open in IMG/M |
3300031718|Ga0307474_11383612 | Not Available | 555 | Open in IMG/M |
3300031768|Ga0318509_10171266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1203 | Open in IMG/M |
3300031912|Ga0306921_12437875 | Not Available | 545 | Open in IMG/M |
3300031941|Ga0310912_10864749 | Not Available | 697 | Open in IMG/M |
3300032059|Ga0318533_11117490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 577 | Open in IMG/M |
3300032160|Ga0311301_10786444 | Not Available | 1311 | Open in IMG/M |
3300032180|Ga0307471_103193929 | Not Available | 581 | Open in IMG/M |
3300032261|Ga0306920_102117020 | Not Available | 785 | Open in IMG/M |
3300032515|Ga0348332_11034294 | Not Available | 587 | Open in IMG/M |
3300032898|Ga0335072_10247357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 2054 | Open in IMG/M |
3300032955|Ga0335076_10481956 | Not Available | 1124 | Open in IMG/M |
3300033158|Ga0335077_11740480 | Not Available | 588 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 15.38% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.38% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 10.58% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.62% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 5.77% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.85% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.88% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.88% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.88% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.88% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.92% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.92% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.92% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.92% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.92% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.92% |
Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 1.92% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.96% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.96% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.96% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.96% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011067 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 41 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012089 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ008 MetaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025453 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes) | Environmental | Open in IMG/M |
3300025460 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029993 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2 | Environmental | Open in IMG/M |
3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12712J15308_100793732 | 3300001471 | Forest Soil | MFMRTQRDVMVRALAEEALALASVALFLAMVAIWVQVLGVV* |
Ga0062389_1035918971 | 3300004092 | Bog Forest Soil | MTQGRNLMVRAVAEEALALASMALFLGMVAVWVQVLGVV* |
Ga0066388_1032481971 | 3300005332 | Tropical Forest Soil | MFLIKRRGIMVRAVAEEALALASVSLFLAMVAVWVQVLGVI* |
Ga0070738_103794342 | 3300005531 | Surface Soil | TLFPLCTKDSRVMFRTMFEEATALASISLFLATVAVWVRVLGGI* |
Ga0070731_107592352 | 3300005538 | Surface Soil | CSMTQGRNIMVRAVAEEALALASMALFLGMVAVWVQVLGVV* |
Ga0070672_1006009632 | 3300005543 | Miscanthus Rhizosphere | MGSTMVRSVVEEACALTSIALFLAMVAVWAQVLGVI* |
Ga0066903_1060369252 | 3300005764 | Tropical Forest Soil | MLTGRDIMVRAVAEEALALASVTLFLAMVAVWVQVLGVV* |
Ga0074062_125466571 | 3300006606 | Soil | SVPCMGRGTMVRAVAEEALALASVTLFLAMVAVWVQVLVVI* |
Ga0079220_103112202 | 3300006806 | Agricultural Soil | SKVMVRRVFEEAAALASITLFLATVAVWVQVLGVI* |
Ga0116108_100666610 | 3300009519 | Peatland | MFVLHEGEKHMVRVVAEEALALASVTLFLAMVAIWAQVLGVV* |
Ga0116108_10412772 | 3300009519 | Peatland | EGKKTMVRTVAEEALALASVTLFLAMVAIWAQVLGVV* |
Ga0116218_13348562 | 3300009522 | Peatlands Soil | MFPFRSLKGRKTMVRVVAEEALALASVTLFLAMVAVWAQVLGVI* |
Ga0116221_11293572 | 3300009523 | Peatlands Soil | RSLKGRKTMVRVVAEEALALASVTLFLAMVAIWAQVLGVV* |
Ga0105237_119614212 | 3300009545 | Corn Rhizosphere | LCSEVKGRHIMVRAVVEEALALTSVSLFLAMVAVWVQVLGVI* |
Ga0116110_12930862 | 3300009643 | Peatland | METIMVRAVAEEALALASITLFLAMVAVWAQVLGVV* |
Ga0116224_101026672 | 3300009683 | Peatlands Soil | YKREGLMVRAVAEEALALASISLFLAMVAVWAQVLGVV* |
Ga0116216_100575032 | 3300009698 | Peatlands Soil | PYSFYYTKGRGNMVRAVAEEALALTSITLFLAMVAVWVQVLGVA* |
Ga0116217_105506471 | 3300009700 | Peatlands Soil | HERRERAMVRAVAEEALALASITLFLAMVAVWAQVLGVV* |
Ga0116134_12647062 | 3300009764 | Peatland | RKTMVRTVAEEALALASVTLFLAMVAIWAQVLGVV* |
Ga0123355_113314542 | 3300009826 | Termite Gut | MFEREADMVRIVLEEAFALASLTLFLASVAVWVQVLGLAM* |
Ga0116223_108782091 | 3300009839 | Peatlands Soil | FYTKGRKTMVRAVAEEALALASVTLFLAMVAIWAQVLGVV* |
Ga0123356_137111701 | 3300010049 | Termite Gut | MFKNGRLGMVRIVLEEAFALASLTLFLASVAVWVQVLGLAM* |
Ga0126381_1044706281 | 3300010376 | Tropical Forest Soil | MFRVKGRQIMVRAVVEEALALTSVLLFLAMVAVWVQVLGVI* |
Ga0126381_1044735311 | 3300010376 | Tropical Forest Soil | MFLVKRRGIMVRAVAEEALALASVSLFLAMVAVWVQVLGVI* |
Ga0136449_1003131172 | 3300010379 | Peatlands Soil | LFHAMGRDIMVRAVAEEALALASVTLFLAMVAVWVQVLGVV* |
Ga0136449_1007887101 | 3300010379 | Peatlands Soil | MFPFRSLKGRKTMVRVVAEEALALASVTLFLAMVAIWAQVLGVV* |
Ga0136449_1009125992 | 3300010379 | Peatlands Soil | MGRSTMVCAVAEEAVALASVTLFLAMVAIWAQVLGVV* |
Ga0136449_1016848731 | 3300010379 | Peatlands Soil | MFVLHEGEKHMVRVVAEEALALASVTLFLAMVAIWAQ |
Ga0136449_1025305702 | 3300010379 | Peatlands Soil | MKGERVMVRAVAEEALALASITLFLAMVAVWAQVLGVV* |
Ga0136449_1027832112 | 3300010379 | Peatlands Soil | EKHMVRAVAEEALALASVTLFLAMVAVWAQVLGVI* |
Ga0126383_122909272 | 3300010398 | Tropical Forest Soil | MFLKRRGIMVRAVAEEALAIASVSLFLAMVAVWVQVLGVI* |
Ga0138594_10193411 | 3300011067 | Peatlands Soil | EGEKHMVRAVAEEALALASVTLFLAMVAIWAQVLGVV* |
Ga0105246_121350501 | 3300011119 | Miscanthus Rhizosphere | IGESIMVRAVVEEAGALASIALFMAMVAVWAQVLGVI* |
Ga0153924_11303382 | 3300012089 | Attine Ant Fungus Gardens | MGSIMVRAVVVEACALTSITLFLAMVAVWAQVLGVI* |
Ga0157374_115355883 | 3300013296 | Miscanthus Rhizosphere | IRSSRRRVMVRAVAVEVLALASVSLFVAMIAVWTQVLSVV* |
Ga0181518_103089591 | 3300014156 | Bog | EGEKHMVRAVAEEALALASVTLFLAMVAVWAQVLGVI* |
Ga0181532_103185022 | 3300014164 | Bog | MGRKTMVRAVAEEALALASVTLFLAMVAIWAQVLGVV* |
Ga0181532_103554741 | 3300014164 | Bog | KTMVRTVAEEALALASVTLFLAMVAIWAQVLGVV* |
Ga0132257_1041786772 | 3300015373 | Arabidopsis Rhizosphere | VLFMFGVKGRRIMVRAVVEEALALTSVSLFLAMVAVWVQLLGVI* |
Ga0182036_104642702 | 3300016270 | Soil | SMLTGRDIMVRAIAEEALALASVTLFLAMVAVWVQVLGVV |
Ga0182033_106079132 | 3300016319 | Soil | MFLVKRRGIMVRAVAEEALALASVSLFLAMVAVWAQVFGVI |
Ga0182033_110836202 | 3300016319 | Soil | MFQAMGRNTMVRALAKEALALTSVSLFLAIVAVWVQVLGVVV |
Ga0182035_112059352 | 3300016341 | Soil | MLTGRDIMVRAVAEEALAIASVTLFLAMVTVWVQVLGVV |
Ga0182035_121800142 | 3300016341 | Soil | MFLFCSARGIMVRAVAEEALALASISLFLAMVAVWAQVLGVV |
Ga0182037_106793401 | 3300016404 | Soil | YVLSLFHATGRDIMVRAVAEEALALASVTLFLAMVAVWVQVLVVV |
Ga0182039_122654501 | 3300016422 | Soil | LEKRRGIMVRAVAEEALALASVSLFLAMVAVWAQVLGVI |
Ga0182038_111572721 | 3300016445 | Soil | MFPIRSSRRRVMVRAVAVEVLALASVSLFVAMIAVWTQVLIAV |
Ga0187818_105441981 | 3300017823 | Freshwater Sediment | MGRDIMVRAVAEEALALASVTLFLAMVAVWVQVLGVV |
Ga0187877_11933032 | 3300017931 | Peatland | MFVLHEGEKHMVRVVAEEALALASVTLFLAMVAIWAQVLGVV |
Ga0187819_104881301 | 3300017943 | Freshwater Sediment | SRRVGRETMVRAVAEEALALASVTLFLAMVAVWVQILGVV |
Ga0187783_105989231 | 3300017970 | Tropical Peatland | MFRVKGRGIMVRAVAEEALALASVSLFLAMVAIWVQVLGVI |
Ga0187783_106000823 | 3300017970 | Tropical Peatland | MFHAIGRHIMVRAVAEEALALASVSLFLAMVAVWVQVLGVV |
Ga0187783_106200701 | 3300017970 | Tropical Peatland | MFQAMGRNIMVRAVAEEALALTSVSLFLAMVAIWVQVLGVVV |
Ga0187781_100300353 | 3300017972 | Tropical Peatland | MFFFRSGKGRDIMVRAVAEEALALTSITLFLAMVVVWAQVLGVI |
Ga0187781_103702461 | 3300017972 | Tropical Peatland | MGRNIMVRAVAEEALALTSVSLFLAMVAIWVQVLGVVV |
Ga0187781_111320351 | 3300017972 | Tropical Peatland | GREVMVRAVTEEALALASITLFLAMVAVWAQVLGVI |
Ga0187780_103991011 | 3300017973 | Tropical Peatland | MFQAMGRNIMVRAVAEEALALTSVSLFLAMVAVWVQVLGVVV |
Ga0187782_103637372 | 3300017975 | Tropical Peatland | MKGEIVMVRAVVEEALALASITLFLGMIAVWAQVLGVV |
Ga0187782_104141392 | 3300017975 | Tropical Peatland | MIGPTTQGRGFMVRALAAEALALASMTLFLAMVAVWVQVLGVV |
Ga0187782_106786002 | 3300017975 | Tropical Peatland | MNPLPKGGVMVRAVVEEALALASITLFLGTIAVWVQVLGVM |
Ga0187876_11898922 | 3300018003 | Peatland | MFVLHEGEKHMVRAVAEEALALASVTLFLAMVAIWAQVLGVV |
Ga0187804_104829282 | 3300018006 | Freshwater Sediment | LEMGSIMVRAVVEEACALASIALFLAMVAVWVQVLGVI |
Ga0187867_103397822 | 3300018033 | Peatland | RKTMVRTVAEEALALASVTLFLAMVAIWAQVLGVV |
Ga0187784_112005822 | 3300018062 | Tropical Peatland | FLRSWEGQMVRALVQEALALASLSLFLAMVAVWVQVLGVI |
Ga0187797_12077682 | 3300019284 | Peatland | GAGEQVMVRAVAEEALAITSVSLFLAMVAVWVQVLGVV |
Ga0210407_100433531 | 3300020579 | Soil | PFMGRGTMVRAVAEEALALASVTLFLAMVAVWVQVLVVI |
Ga0210395_102569631 | 3300020582 | Soil | MFMRTQRDVMVRALAEEALALASVALFLAMVAIWVQVLGVV |
Ga0210401_101832382 | 3300020583 | Soil | MFMRTERDVMVRALAEEALALASVALFLAMVAIWVQVLGVV |
Ga0210405_101539642 | 3300021171 | Soil | CMGRGTMVRAVAEEALALASVTLFLAMVAVWVQVLVVI |
Ga0210396_102562002 | 3300021180 | Soil | MFHADGRDIMVRAVAEEALALASVTLFLAMVAVWVQVLGVV |
Ga0210397_100350401 | 3300021403 | Soil | SSRRRAMVRVVAVEVLALASVSLFVAMVAVWTQVLSVG |
Ga0210397_114185871 | 3300021403 | Soil | EGLVMVRAVTEEALALASLTLFLAMVAVWAEVLGVL |
Ga0210394_103219652 | 3300021420 | Soil | RSVRIRGQIMVRSVVEEALALASISLFLATLAVWAQVLGVI |
Ga0210394_110316522 | 3300021420 | Soil | MTQGRNLMVRAVAEEALALASMALFLGMVAVWVQVLGVV |
Ga0242659_11239821 | 3300022522 | Soil | RTRGQIMVRSVVEEALALASISLFLATLAVWAQVLGVI |
Ga0208455_10596392 | 3300025453 | Peatland | FVLDEGKKTMVRTVAEEALALASVTLFLAMVAIWAQVLGVV |
Ga0208562_11053032 | 3300025460 | Peatland | LFVLHEGRSTMVRAVAEEALALASVTLFLAMVAIWAQVLGVV |
Ga0207649_107227142 | 3300025920 | Corn Rhizosphere | RGAEANGSTMVRSVVEEACALTSIALFLAMVAVWAQVLGVI |
Ga0208044_11440242 | 3300027625 | Peatlands Soil | TKGRGNMVRAVAEEALALTSITLFLAMVAVWVQVLGVA |
Ga0209009_12019351 | 3300027667 | Forest Soil | KRKGRDIMVRAVAEEALALTSITLFLAMVAVWAQVLGVV |
Ga0209274_105204312 | 3300027853 | Soil | KEQVMVRAVAEEALALASVTLFLAMVAVWAQVLGVV |
Ga0308309_102849821 | 3300028906 | Soil | PLCSCIGRGTMVRAVAEEALALASVTLFLAMVAVWVQVLVVI |
Ga0222749_105820683 | 3300029636 | Soil | MFPICSSRRRAMVRVVAVEVLALASVSLFVAMVAVWAQVFSVV |
Ga0302304_102653171 | 3300029993 | Palsa | EGRTVMVKSVVEEAVALASITLFLAMVAVWTQVLGVL |
Ga0311356_120571062 | 3300030617 | Palsa | GRTVMVKSVVEEAVALASITLFLAMVAVWTQVLGVL |
Ga0311354_102387491 | 3300030618 | Palsa | CSRLEGRIVMVKSVVEEAVALASITLFLAMVAVWTQVLGVL |
Ga0310038_103781931 | 3300030707 | Peatlands Soil | SKRGERLMVRAVAEEALALASISLFLAMVAVWAQVLGVV |
Ga0265762_11757581 | 3300030760 | Soil | HKTKGRTVMMKSFVEEAMALASITLFLAMVAVWTQVLGVL |
Ga0302326_135564881 | 3300031525 | Palsa | FWRYVMFRAVAEEALALASITLFLAMVAVWAQLLAVV |
Ga0318516_103280201 | 3300031543 | Soil | MFSLCSMLTGRDIMVRAVAEEALALASVTLFLAMVAVWVQVLVVV |
Ga0310915_107428771 | 3300031573 | Soil | FLVTGRDIMVRAVAEEALALASVTLFLAMVAVWVQVLGVV |
Ga0310686_1035548072 | 3300031708 | Soil | MNAGENLMVRAVAEEALALASMALFLGMVAVWVQVLGVV |
Ga0307474_113836121 | 3300031718 | Hardwood Forest Soil | MFTLRSEAEGRDIMVRAVAEEALALASIALFLGMVAVWVQVLGVV |
Ga0318509_101712662 | 3300031768 | Soil | VLRSFRERVMVRAVAEEAMALASLSLFLAMVAVWAQVLGVL |
Ga0306921_124378752 | 3300031912 | Soil | MFPLCSMLTGRDIMVRAVAEEALALASVTLFLAMVAVWVQVLGVV |
Ga0310912_108647492 | 3300031941 | Soil | MLTGRDIMVRAVAEEALALASVTLFLAMVAVWVQVLGVV |
Ga0318533_111174901 | 3300032059 | Soil | GRVMVRAVAEEAMALASLSLFLAMVAVWAQVLGVL |
Ga0311301_107864442 | 3300032160 | Peatlands Soil | FHAMGRDTMVRAVAEEALALASITLFLAMVAVWVQVLVVI |
Ga0307471_1031939292 | 3300032180 | Hardwood Forest Soil | GLKIMVRAVAEEALALASLTLFLAMVAVWAEVLGVL |
Ga0306920_1021170201 | 3300032261 | Soil | LSVRVGRRVMVRAVAVEVLALASVSLFVAMVAVWTQLLV |
Ga0348332_110342942 | 3300032515 | Plant Litter | GIVMVRNVAEEALALASLTLFLAMVAVWAQVLGVL |
Ga0335072_102473571 | 3300032898 | Soil | MFMRTQGDVMVRALAEEALALASVALFLAMVAIWVQVLGVV |
Ga0335076_104819562 | 3300032955 | Soil | MFRVKGRRIMVRAVVEEALALTSVSLFLAMVAVWVQVLGVI |
Ga0335077_117404801 | 3300033158 | Soil | RSAMGSKMVRAVIEEALALTSLTLFLAMVAVWAQVFGVI |
⦗Top⦘ |