NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F097206

Metagenome Family F097206

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097206
Family Type Metagenome
Number of Sequences 104
Average Sequence Length 39 residues
Representative Sequence MIHKANRPPSPEELKQLLIAAFAMGVVVASAYFILFVVK
Number of Associated Samples 92
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 74.04 %
% of genes near scaffold ends (potentially truncated) 13.46 %
% of genes from short scaffolds (< 2000 bps) 59.62 %
Associated GOLD sequencing projects 84
AlphaFold2 3D model prediction Yes
3D model pTM-score0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.115 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake
(17.308 % of family members)
Environment Ontology (ENVO) Unclassified
(55.769 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(56.731 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 41.79%    β-sheet: 0.00%    Coil/Unstructured: 58.21%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF00436SSB 13.46
PF13481AAA_25 7.69
PF13604AAA_30 5.77
PF04851ResIII 4.81
PF00271Helicase_C 4.81
PF01755Glyco_transf_25 1.92
PF02511Thy1 1.92
PF04041Glyco_hydro_130 0.96
PF13578Methyltransf_24 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG0629Single-stranded DNA-binding proteinReplication, recombination and repair [L] 13.46
COG2965Primosomal replication protein NReplication, recombination and repair [L] 13.46
COG1351Thymidylate synthase ThyX, FAD-dependent familyNucleotide transport and metabolism [F] 1.92
COG3306Glycosyltransferase involved in LPS biosynthesis, GR25 familyCell wall/membrane/envelope biogenesis [M] 1.92
COG2152Predicted glycosyl hydrolase, GH43/DUF377 familyCarbohydrate transport and metabolism [G] 0.96

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.12 %
UnclassifiedrootN/A2.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000882|FwDRAFT_10063428All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31378Open in IMG/M
3300002401|B570J29611_1000161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar36619Open in IMG/M
3300002835|B570J40625_100073171All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar34519Open in IMG/M
3300003277|JGI25908J49247_10032014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31481Open in IMG/M
3300003388|JGI25910J50241_10156105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3592Open in IMG/M
3300003394|JGI25907J50239_1017899All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31601Open in IMG/M
3300003413|JGI25922J50271_10008734All Organisms → cellular organisms → Bacteria2772Open in IMG/M
3300003491|JGI25924J51412_1046134All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3691Open in IMG/M
3300003497|JGI25925J51416_10016600All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar32198Open in IMG/M
3300003860|Ga0031658_1083423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3570Open in IMG/M
3300004240|Ga0007787_10312389All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3778Open in IMG/M
3300004481|Ga0069718_16033680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31482Open in IMG/M
3300005527|Ga0068876_10249823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31017Open in IMG/M
3300005582|Ga0049080_10199904Not Available661Open in IMG/M
3300005805|Ga0079957_1000316All Organisms → cellular organisms → Bacteria41661Open in IMG/M
3300005805|Ga0079957_1013070All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar36151Open in IMG/M
3300005992|Ga0073924_1008250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31548Open in IMG/M
3300006030|Ga0075470_10001086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar38490Open in IMG/M
3300006641|Ga0075471_10004954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar38522Open in IMG/M
3300006802|Ga0070749_10065991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar32177Open in IMG/M
3300006863|Ga0075459_1000937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar34643Open in IMG/M
3300007200|Ga0103273_1051721All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31690Open in IMG/M
3300007622|Ga0102863_1128727All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3745Open in IMG/M
3300007734|Ga0104986_1911All Organisms → cellular organisms → Bacteria44980Open in IMG/M
3300007972|Ga0105745_1301490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3524Open in IMG/M
3300007973|Ga0105746_1340974All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3522Open in IMG/M
3300007974|Ga0105747_1277549All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3564Open in IMG/M
3300008055|Ga0108970_10698437All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar312325Open in IMG/M
3300008110|Ga0114343_1214298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3544Open in IMG/M
3300008117|Ga0114351_1046968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar32720Open in IMG/M
3300008120|Ga0114355_1073666All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31437Open in IMG/M
3300008267|Ga0114364_1016747All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar33154Open in IMG/M
3300008267|Ga0114364_1043568Not Available1655Open in IMG/M
3300008450|Ga0114880_1003280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar38927Open in IMG/M
3300009068|Ga0114973_10021952All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar33950Open in IMG/M
3300009158|Ga0114977_10077995All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar32025Open in IMG/M
3300009158|Ga0114977_10357501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3821Open in IMG/M
3300009158|Ga0114977_10627916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3577Open in IMG/M
3300009163|Ga0114970_10714694All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3531Open in IMG/M
3300009168|Ga0105104_10233708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31002Open in IMG/M
3300009180|Ga0114979_10122758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31598Open in IMG/M
3300009183|Ga0114974_10584560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3617Open in IMG/M
3300011268|Ga0151620_1018487All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar32440Open in IMG/M
3300011336|Ga0153703_1633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar311245Open in IMG/M
3300013014|Ga0164295_10032190All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar33998Open in IMG/M
(restricted) 3300013122|Ga0172374_1205704All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3712Open in IMG/M
(restricted) 3300013130|Ga0172363_10748374All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3610Open in IMG/M
3300013372|Ga0177922_10206636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3605Open in IMG/M
3300014962|Ga0134315_1019026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31066Open in IMG/M
3300017707|Ga0181363_1005552All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar32723Open in IMG/M
3300017707|Ga0181363_1034491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3945Open in IMG/M
3300017754|Ga0181344_1086939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3915Open in IMG/M
3300019781|Ga0181360_117773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3579Open in IMG/M
3300019783|Ga0181361_100015All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar37391Open in IMG/M
3300019783|Ga0181361_111331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3694Open in IMG/M
3300019784|Ga0181359_1138035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3852Open in IMG/M
3300019784|Ga0181359_1238229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3560Open in IMG/M
3300020141|Ga0211732_1047738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31365Open in IMG/M
3300020151|Ga0211736_10361556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31231Open in IMG/M
3300020158|Ga0194038_1210709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3552Open in IMG/M
3300020183|Ga0194115_10029030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar33974Open in IMG/M
3300020518|Ga0208721_1043633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3532Open in IMG/M
3300020539|Ga0207941_1017543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31088Open in IMG/M
3300020553|Ga0208855_1037868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3654Open in IMG/M
3300020570|Ga0208465_1001714All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar34516Open in IMG/M
3300021516|Ga0194045_1000020All Organisms → cellular organisms → Bacteria44921Open in IMG/M
3300021962|Ga0222713_10207349All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31306Open in IMG/M
3300023174|Ga0214921_10071118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar32837Open in IMG/M
3300025445|Ga0208424_1000117All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar39484Open in IMG/M
3300025585|Ga0208546_1001163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar38323Open in IMG/M
3300025889|Ga0208644_1013864All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar35340Open in IMG/M
3300027126|Ga0255098_1002715All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar33833Open in IMG/M
3300027563|Ga0209552_1017366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar32175Open in IMG/M
3300027733|Ga0209297_1007973All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar35282Open in IMG/M
3300027734|Ga0209087_1013231All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar34171Open in IMG/M
3300027736|Ga0209190_1119197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31188Open in IMG/M
3300027769|Ga0209770_10009670All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar34401Open in IMG/M
3300027797|Ga0209107_10000308All Organisms → cellular organisms → Bacteria29009Open in IMG/M
3300027870|Ga0209023_10820225All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3522Open in IMG/M
3300027899|Ga0209668_10000057All Organisms → cellular organisms → Bacteria43215Open in IMG/M
3300027899|Ga0209668_10007552All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar34989Open in IMG/M
3300027956|Ga0209820_1001006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar36914Open in IMG/M
3300031758|Ga0315907_10168680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31847Open in IMG/M
3300031758|Ga0315907_10251507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31466Open in IMG/M
3300031787|Ga0315900_10049817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar34429Open in IMG/M
3300031857|Ga0315909_10002770All Organisms → cellular organisms → Bacteria22110Open in IMG/M
3300031963|Ga0315901_10939307All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3611Open in IMG/M
3300032070|Ga0315279_10714693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3606Open in IMG/M
3300032116|Ga0315903_10221907All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31659Open in IMG/M
3300032116|Ga0315903_10606236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3839Open in IMG/M
3300033418|Ga0316625_102172568All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3552Open in IMG/M
3300033816|Ga0334980_0130209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31036Open in IMG/M
3300033816|Ga0334980_0307438Not Available614Open in IMG/M
3300033816|Ga0334980_0340330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3576Open in IMG/M
3300033978|Ga0334977_0257941All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Erwiniaceae → Pantoea → Pantoea agglomerans group → Pantoea agglomerans853Open in IMG/M
3300034012|Ga0334986_0067439All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar32217Open in IMG/M
3300034060|Ga0334983_0134315All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31575Open in IMG/M
3300034082|Ga0335020_0015126All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar34509Open in IMG/M
3300034096|Ga0335025_0397129All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3713Open in IMG/M
3300034106|Ga0335036_0850472All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3523Open in IMG/M
3300034108|Ga0335050_0111611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31560Open in IMG/M
3300034111|Ga0335063_0124390All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Erwiniaceae → Pantoea → Pantoea agglomerans group → Pantoea agglomerans1530Open in IMG/M
3300034120|Ga0335056_0403413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3736Open in IMG/M
3300034283|Ga0335007_0307929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar31034Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake17.31%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater15.38%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake9.62%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater6.73%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous6.73%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton4.81%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater3.85%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater3.85%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment2.88%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.88%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water2.88%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.92%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater1.92%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater1.92%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake1.92%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.92%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.96%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic0.96%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.96%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment0.96%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.96%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.96%
Freshwater And MarineEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine0.96%
Surface WaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water0.96%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.96%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.96%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.96%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.96%
SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sand0.96%
EstuaryHost-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary0.96%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000882Freshwater microbial communities from the Columbia RiverEnvironmentalOpen in IMG/M
3300002401Freshwater microbial communities from Lake Mendota, WI - 26JUN2009 deep hole epilimnionEnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003277Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SDEnvironmentalOpen in IMG/M
3300003388Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SNEnvironmentalOpen in IMG/M
3300003394Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SNEnvironmentalOpen in IMG/M
3300003413Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DDEnvironmentalOpen in IMG/M
3300003491Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SDEnvironmentalOpen in IMG/M
3300003497Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DNEnvironmentalOpen in IMG/M
3300003860Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PLEnvironmentalOpen in IMG/M
3300004240Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SNEnvironmentalOpen in IMG/M
3300004481Combined Assembly of Gp0112041, Gp0112042, Gp0112043EnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005582Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRFEnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300005992Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_14-Oct-14EnvironmentalOpen in IMG/M
3300006030Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006863Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNAEnvironmentalOpen in IMG/M
3300007200Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Monthly Sampling-Site B) 9 sequencing projectsEnvironmentalOpen in IMG/M
3300007622Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02EnvironmentalOpen in IMG/M
3300007734Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015JanEnvironmentalOpen in IMG/M
3300007972Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0umEnvironmentalOpen in IMG/M
3300007973Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2umEnvironmentalOpen in IMG/M
3300007974Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2umEnvironmentalOpen in IMG/M
3300008055Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393Host-AssociatedOpen in IMG/M
3300008110Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NAEnvironmentalOpen in IMG/M
3300008117Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008120Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NAEnvironmentalOpen in IMG/M
3300008267Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTREnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300009068Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaGEnvironmentalOpen in IMG/M
3300009158Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaGEnvironmentalOpen in IMG/M
3300009163Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaGEnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009180Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300011268Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555EnvironmentalOpen in IMG/M
3300011336Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - PaldangEnvironmentalOpen in IMG/M
3300013014Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaGEnvironmentalOpen in IMG/M
3300013122 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3mEnvironmentalOpen in IMG/M
3300013130 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2EnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300014962Surface water microbial communities from Bangladesh - BaraHaldiaSW0309EnvironmentalOpen in IMG/M
3300017707Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.NEnvironmentalOpen in IMG/M
3300017754Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.DEnvironmentalOpen in IMG/M
3300019781Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM15.S.DEnvironmentalOpen in IMG/M
3300019783Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020141Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1EnvironmentalOpen in IMG/M
3300020151Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1EnvironmentalOpen in IMG/M
3300020158Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L227-6mEnvironmentalOpen in IMG/M
3300020183Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surfaceEnvironmentalOpen in IMG/M
3300020518Freshwater microbial communities from Lake Mendota, WI - 17AUG2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020539Freshwater microbial communities from Lake Mendota, WI - 13SEP2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020553Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020570Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021516Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L626-11mEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300023174Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505EnvironmentalOpen in IMG/M
3300025445Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025585Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300027126Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8dEnvironmentalOpen in IMG/M
3300027563Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027733Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027734Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027736Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027769Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027797Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027870Freshwater and sediment microbial communities from Lake Erie, Canada (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300027956Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300032070Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_20EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033816Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005EnvironmentalOpen in IMG/M
3300033978Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002EnvironmentalOpen in IMG/M
3300034012Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027EnvironmentalOpen in IMG/M
3300034060Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016EnvironmentalOpen in IMG/M
3300034082Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088EnvironmentalOpen in IMG/M
3300034096Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034108Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157EnvironmentalOpen in IMG/M
3300034111Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186EnvironmentalOpen in IMG/M
3300034120Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172EnvironmentalOpen in IMG/M
3300034283Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
FwDRAFT_1006342843300000882Freshwater And MarineMIHKANRPPSPEELKQLLIMAFGMGMVVASAYFLLFVVK*
B570J29611_100016153300002401FreshwaterVIHKANRPPSPEELKQLLIMAFGMGMVVASAYFILFVVK*
B570J40625_10007317133300002835FreshwaterMIRRSNRPPTESEIKQMLIAAFCMGMIITSAYFILFILK*
JGI25908J49247_1003201423300003277Freshwater LakeVIHKANRPPSPEELKQLLIMAFGMGMVVASAYFLLFVVK*
JGI25910J50241_1015610513300003388Freshwater LakeMIHKANRPPSPEELKHLLIMAFCMGMVITAAYFVLFVVK*
JGI25907J50239_101789913300003394Freshwater LakeMIHKANRPPSPEELKQLLIMAFGMGMVITAAYFLLFVVK*
JGI25922J50271_1000873463300003413Freshwater LakeMIHRANRPPSPEEIKQLLIAAFAAGVVITSAYFILFVLK*
JGI25924J51412_104613423300003491Freshwater LakeMIQKMHRPPSPEELKQLLIAAFAMGVVVASAYFILFVVK*
JGI25925J51416_1001660023300003497Freshwater LakeMIQNMHRPPSPEELKQLLIAAFAMGVVVASAYFILFVVK*
Ga0031658_108342333300003860Freshwater Lake SedimentMIHKMHRPPSPEEIKQLLIAAFAAGVVITSAYFMLFVIKP*
Ga0007787_1031238923300004240Freshwater LakeVIHRMNRPPSPEEIKQLLIAAFAAGVVITSAYFILFVLK*
Ga0069718_1603368063300004481SedimentMIRRSSRPPSPDELKQLLIATFCAGMVITAAYFILFVVK*
Ga0068876_1024982333300005527Freshwater LakeMIRRSSRPPSPDELKQLLIAAFCAGMVITAAYFILFVLK*
Ga0049080_1019990423300005582Freshwater LenticMIHKSNRPPSPEELKHLLIMAFCMGMVITAAYFVLFVVK*
Ga0079957_100031643300005805LakeMRRANRPPSKDELKELLVAAFAAGVVITAAYFMLFIVK*
Ga0079957_101307053300005805LakeMNHKMYRPPSPDELKQLLIAAFCAGMVITAAYFILFVVK*
Ga0073924_100825043300005992SandMIQKMHRPPSPEELKQLLIMAFGMGMVVASAYFLLFVVK*
Ga0075470_10001086133300006030AqueousMIRRANRPPSPEDIKQLLIAAFAAGVVITSAYFMLFVVKP*
Ga0075471_10004954183300006641AqueousMIHRMQRPPSPEELKHLLIAAFCMGMIITACYFLMFVL*
Ga0070749_1006599153300006802AqueousMIHKMHRPPSPEEIKQLLIAAFAAGVVITSAYFMLFVVKP*
Ga0075459_1000937123300006863AqueousVIHKMHRPPSPEEIKQLLIAAFAAGVVITSAYFMLFVVKP*
Ga0103273_105172133300007200Freshwater LakeMIRMNRPPSPDELKQMLIASFAMGVVITSAYFILFVL*
Ga0102863_112872713300007622EstuarineKANRPPSPEELRQLLIAAFAMGVVVASAYFILFVLK*
Ga0104986_191183300007734FreshwaterMIHKSNRPPSPEELKQLLIAAFAMGVVVASAYFILFVVK*
Ga0105745_130149023300007972Estuary WaterMNRPPSPEELKQMLIAAFAMGVVITSAYFILFVIK*
Ga0105746_134097413300007973Estuary WaterMIRRMNRPPSPEELKQMLIAAFAMGVVITSAYFILFVLK*
Ga0105747_127754923300007974Estuary WaterMIRRMNRPPSPEELKQMLIAAFAMGVVITSAYFILFVIK*
Ga0108970_10698437123300008055EstuaryMYRPPSPDELKQLLIAAFCAGMVITAAYFILFVVK*
Ga0114343_121429823300008110Freshwater, PlanktonMIRRSSRPPSPDELKQLLIAAFCAGMVITAAYFIL
Ga0114351_104696863300008117Freshwater, PlanktonMYRPPSPDELKQLLIATFCAGMVITAAYFILFVVK*
Ga0114355_107366633300008120Freshwater, PlanktonMNHKMYRPPSPDELKQLLIATFCAGMVITAAYFILFVVK*
Ga0114364_101674753300008267Freshwater, PlanktonVIHKANRPPSKDELKELLVAAFAAGVVITAAYFMLFIVK*
Ga0114364_104356843300008267Freshwater, PlanktonMIHRANRPPSPDELKQLLIATFCAGMVITAAYFILFVVK*
Ga0114880_1003280133300008450Freshwater LakeMIHKANRPPSPEELKHLLIMAFCMGMVITAAYFILFVIK*
Ga0114973_1002195263300009068Freshwater LakeVIHKANRPPSPEELKQLLIMAFGMGMVVASAYFILFVLK*
Ga0114977_1007799523300009158Freshwater LakeVIHKANRPPSPEELKQLLIMAFGMGMVVASAYFILFVIK*
Ga0114977_1035750133300009158Freshwater LakeMIQKMHRPPSPEELKQLLIAAFAMGIVVASAYFILFVVK*
Ga0114977_1062791613300009158Freshwater LakeVIHKASRPPSPEELKQLLIAAFAMGVVVASAYFILFVIK*
Ga0114970_1071469423300009163Freshwater LakeMIQKMHRPPSPEELKQLLIAAFAMGVVVASAYFILFVIK*
Ga0105104_1023370843300009168Freshwater SedimentMYRPPSPDELKQLLIATFCAGMVVTAAYFILFVVK*
Ga0114979_1012275813300009180Freshwater LakeMIQKMHRPPSPEELKQLLIAAFAMGIVVASAYFILF
Ga0114974_1058456023300009183Freshwater LakeVIHKASRPPSPEELKQLLIAAFAMGVVVASAYFILFVVK*
Ga0151620_101848723300011268FreshwaterMNHRMYRPPSPEELKQLLIAAFAMGVVITSAYFILFVIK*
Ga0153703_1633103300011336FreshwaterMIHKANRPPSPEELKQLLIMAFGMGMVVASAYFILFVVK*
Ga0164295_1003219043300013014FreshwaterMIHKMHRPPSPEELKQLLIAAFAMGVVVASSYFILFVIK*
(restricted) Ga0172374_120570433300013122FreshwaterMMIHGNRPPSPDELKSLLIAAFCMGMIITAFYFLMFVL*
(restricted) Ga0172363_1074837423300013130SedimentMMIHGNRPPSPDELKSLLIAAFCMGMIITAFYFLMFV
Ga0177922_1020663623300013372FreshwaterMIQKMHRPPSPEELKQLLIMAFGMGVVVASAYFLLFVVK*
Ga0134315_101902633300014962Surface WaterMIMRGSRPPSPEELKNLLIAAFAMGVVITSAYFLLFVL*
Ga0181363_100555233300017707Freshwater LakeMIHRANRPPSPDELKQLLIATFCAGMVITAAYFILFVVK
Ga0181363_103449153300017707Freshwater LakeLRPRRYTVIHRMNRPPSPEEIKQLLIAAFAAGVVITSAYFMLFVVKP
Ga0181344_108693933300017754Freshwater LakeVIHKANRPPSPEELKQLLIMAFGMGMVVASAYFVLFVVK
Ga0181360_11777313300019781Freshwater LakeMIHKANRPPSPEELKHLLIMAFCMGMVITAAYFVLFVVK
Ga0181361_10001523300019783Freshwater LakeMIHKANRPPSPEELKQLLIMAFGMGMVVASAYFLLFVVK
Ga0181361_11133123300019783Freshwater LakeVIHKANRPPSPEELKQLLIMAFGMGMVVASAYFLLFVVK
Ga0181359_113803543300019784Freshwater LakeMNRPPSPEEIKQLLIAAFAAGVVITSAYFMLFVVKP
Ga0181359_123822913300019784Freshwater LakeMIQNMHRPPSPEELKQLLIAAFAMGVVVASAYFILFVVK
Ga0211732_104773823300020141FreshwaterMIHKANRPPSPEELKQLLIMAFGMGMVVASAYFILFVVK
Ga0211736_1036155623300020151FreshwaterMIHKANRPPSPEELKQLLIAAFAMGVVVASAYFILFVVK
Ga0194038_121070923300020158Anoxic Zone FreshwaterGRWPVIHKANRPPSPEELKQLLIMAFGMGMVVASAYFILFVLK
Ga0194115_1002903093300020183Freshwater LakeMMIHGNRPPSPDELKSLLIAAFCMGMIITAFYFLIFIL
Ga0208721_104363323300020518FreshwaterMIRRSNRPPTESEIKQMLIAAFCMGMIITSAYFILFILK
Ga0207941_101754343300020539FreshwaterRMNRPPSPEELKQMLIAAFAMGVVITSAYFILFVLK
Ga0208855_103786833300020553FreshwaterMNRPPSPEELKQMLIAAFAMGVVITSAYFILFVLK
Ga0208465_100171463300020570FreshwaterMIRRSSRPPSSDEIRQLLIAAFCAGMVITAAYFILFVVK
Ga0194045_1000020153300021516Anoxic Zone FreshwaterVIHKANRPPSPEELKQLLIMAFGMGMVVASAYFILFVLK
Ga0222713_1020734923300021962Estuarine WaterMNHRMYRPPSPEELKQLLIAAFAMGVVITSAYFILFVIK
Ga0214921_1007111863300023174FreshwaterMIHKANRPPSPEELKHLLIMAFCMGMVITAAYFILFVIK
Ga0208424_1000117173300025445AqueousVIHKMHRPPSPEEIKQLLIAAFAAGVVITSAYFMLFVVKP
Ga0208546_1001163123300025585AqueousMIRRANRPPSPEDIKQLLIAAFAAGVVITSAYFMLFVVKP
Ga0208644_1013864113300025889AqueousMIHKMHRPPSPEEIKQLLIAAFAAGVVITSAYFMLFVIKP
Ga0255098_100271573300027126FreshwaterMNRPPSPEELKQMLIAAFAMGVVITSAYFILFVIK
Ga0209552_101736623300027563Freshwater LakeMIQKMHRPPSPEELKQLLIAAFAMGVVVASAYFILFVVK
Ga0209297_100797323300027733Freshwater LakeVIHKASRPPSPEELKQLLIAAFAMGVVVASAYFILFVIK
Ga0209087_101323173300027734Freshwater LakeMIQKMHRPPSPEELKQLLIAAFAMGIVVASAYFILFVVK
Ga0209190_111919733300027736Freshwater LakeMIQKMHRPPSPEELKQLLIAAFAMGVVVASAYFILFVIK
Ga0209770_1000967083300027769Freshwater LakeMIHRANRPPSPEEIKQLLIAAFAAGVVITSAYFILFVLK
Ga0209107_1000030843300027797Freshwater And SedimentMIHKSNRPPSPEELKHLLIMAFCMGMVITAAYFVLFVVK
Ga0209023_1082022533300027870Freshwater And SedimentQMIHKANRPPSPEELKQLLIAAFAMGVVVASAYFILFVIK
Ga0209668_10000057593300027899Freshwater Lake SedimentMRRANRPPSKDELKELLVAAFAAGVVITAAYFMLFIVK
Ga0209668_10007552103300027899Freshwater Lake SedimentMNHRMYRPPSPEELKQMLIAAFAMGVVITSAYFILFVIK
Ga0209820_100100663300027956Freshwater SedimentMIRRSSRPPTESEIKQMLIAAFCMGMIITSAYFILFILK
Ga0315907_1016868023300031758FreshwaterMIRRMNRPPSPEELKQMLIAAFAMGVVITSAYFILFVLK
Ga0315907_1025150773300031758FreshwaterPLRSRRRQMIRRMNRPPSPEELKQMLIAAFAMGVVITSAYFILFVLK
Ga0315900_1004981753300031787FreshwaterMMRMQRPPSHEEIKHMLIAAFCMGMIITACYFLMFVL
Ga0315909_1000277023300031857FreshwaterMIRRSSRPPSPDELKQLLIAAFCAGMVITAAYFILFVVK
Ga0315901_1093930723300031963FreshwaterMIRRANRPPSPEQLREMLIAAFAMGVVITSAYFILFVLKP
Ga0315279_1071469323300032070SedimentMIHKANRPPSPEELKHLLIMAFCIGMVITAAYFVLFVVK
Ga0315903_1022190713300032116FreshwaterMIRRSSRPPSPDELKQLLIAAFCAGMVITAAYFILFVLK
Ga0315903_1060623643300032116FreshwaterSPLRSRRRQMIRRMNRPPSPEELKQMLIAAFAMGVVITSAYFILFVLK
Ga0316625_10217256823300033418SoilMIHRMQRPPSPEELKHLLIAAFCMGMIITACYFLM
Ga0334980_0130209_686_8053300033816FreshwaterMNRKINRPPSKDELKELMIAAFAAGVVITAAYFILFILK
Ga0334980_0307438_124_2433300033816FreshwaterMIQKMHRPPSPEELKHLLIMAFGMGMVVASAYFILFVVK
Ga0334980_0340330_152_2713300033816FreshwaterVIHKANRPPSPEELKQLLIMAFGMGMVVASAYFILFVVK
Ga0334977_0257941_715_8223300033978FreshwaterMYRPPSPDELKQLLIAAFCAGMVITAAYFILFVVK
Ga0334986_0067439_950_10693300034012FreshwaterVIHKANRPPSPEELNQLLIAAFAMGVVVASAYFILFVVK
Ga0334983_0134315_3_1193300034060FreshwaterIHKANRPPSPEELKQLLIMAFGMGMVVASAYFLLFVVK
Ga0335020_0015126_1256_13753300034082FreshwaterVIHKANRPPSPEELKQLLIAAFAMGVVVASAYFLLFVVK
Ga0335025_0397129_420_5393300034096FreshwaterMIRRSSRPPSPDEIRQLLIAAFCAGMVITAAYFILFVVK
Ga0335036_0850472_111_2333300034106FreshwaterMIHKMHRPPSPEEIKQLLIAAFAAGVVITSAYFMLFVVKP
Ga0335050_0111611_576_6953300034108FreshwaterMIQKMHRPPSPEELKQLLIMAFGMGMVVASAYFLLFVVK
Ga0335063_0124390_833_9403300034111FreshwaterMYRPPSSDEIRQLLIAAFCAGMVITAAYFILFVVK
Ga0335056_0403413_627_7343300034120FreshwaterMIQKMHRPPSPEELKQLLIMAFGMGMVVASAYFLLF
Ga0335007_0307929_212_3313300034283FreshwaterVIHKANRPPSPEELKQLLIMAFGMGMVVASAYFLLFVIK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.