| Basic Information | |
|---|---|
| Family ID | F097206 |
| Family Type | Metagenome |
| Number of Sequences | 104 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MIHKANRPPSPEELKQLLIAAFAMGVVVASAYFILFVVK |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 74.04 % |
| % of genes near scaffold ends (potentially truncated) | 13.46 % |
| % of genes from short scaffolds (< 2000 bps) | 59.62 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.115 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (17.308 % of family members) |
| Environment Ontology (ENVO) | Unclassified (55.769 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (56.731 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.79% β-sheet: 0.00% Coil/Unstructured: 58.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF00436 | SSB | 13.46 |
| PF13481 | AAA_25 | 7.69 |
| PF13604 | AAA_30 | 5.77 |
| PF04851 | ResIII | 4.81 |
| PF00271 | Helicase_C | 4.81 |
| PF01755 | Glyco_transf_25 | 1.92 |
| PF02511 | Thy1 | 1.92 |
| PF04041 | Glyco_hydro_130 | 0.96 |
| PF13578 | Methyltransf_24 | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 13.46 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 13.46 |
| COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 1.92 |
| COG3306 | Glycosyltransferase involved in LPS biosynthesis, GR25 family | Cell wall/membrane/envelope biogenesis [M] | 1.92 |
| COG2152 | Predicted glycosyl hydrolase, GH43/DUF377 family | Carbohydrate transport and metabolism [G] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.12 % |
| Unclassified | root | N/A | 2.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000882|FwDRAFT_10063428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1378 | Open in IMG/M |
| 3300002401|B570J29611_1000161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 6619 | Open in IMG/M |
| 3300002835|B570J40625_100073171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 4519 | Open in IMG/M |
| 3300003277|JGI25908J49247_10032014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1481 | Open in IMG/M |
| 3300003388|JGI25910J50241_10156105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 592 | Open in IMG/M |
| 3300003394|JGI25907J50239_1017899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1601 | Open in IMG/M |
| 3300003413|JGI25922J50271_10008734 | All Organisms → cellular organisms → Bacteria | 2772 | Open in IMG/M |
| 3300003491|JGI25924J51412_1046134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 691 | Open in IMG/M |
| 3300003497|JGI25925J51416_10016600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 2198 | Open in IMG/M |
| 3300003860|Ga0031658_1083423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 570 | Open in IMG/M |
| 3300004240|Ga0007787_10312389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 778 | Open in IMG/M |
| 3300004481|Ga0069718_16033680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1482 | Open in IMG/M |
| 3300005527|Ga0068876_10249823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1017 | Open in IMG/M |
| 3300005582|Ga0049080_10199904 | Not Available | 661 | Open in IMG/M |
| 3300005805|Ga0079957_1000316 | All Organisms → cellular organisms → Bacteria | 41661 | Open in IMG/M |
| 3300005805|Ga0079957_1013070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 6151 | Open in IMG/M |
| 3300005992|Ga0073924_1008250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1548 | Open in IMG/M |
| 3300006030|Ga0075470_10001086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 8490 | Open in IMG/M |
| 3300006641|Ga0075471_10004954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 8522 | Open in IMG/M |
| 3300006802|Ga0070749_10065991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 2177 | Open in IMG/M |
| 3300006863|Ga0075459_1000937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 4643 | Open in IMG/M |
| 3300007200|Ga0103273_1051721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1690 | Open in IMG/M |
| 3300007622|Ga0102863_1128727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 745 | Open in IMG/M |
| 3300007734|Ga0104986_1911 | All Organisms → cellular organisms → Bacteria | 44980 | Open in IMG/M |
| 3300007972|Ga0105745_1301490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 524 | Open in IMG/M |
| 3300007973|Ga0105746_1340974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 522 | Open in IMG/M |
| 3300007974|Ga0105747_1277549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 564 | Open in IMG/M |
| 3300008055|Ga0108970_10698437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 12325 | Open in IMG/M |
| 3300008110|Ga0114343_1214298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 544 | Open in IMG/M |
| 3300008117|Ga0114351_1046968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 2720 | Open in IMG/M |
| 3300008120|Ga0114355_1073666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1437 | Open in IMG/M |
| 3300008267|Ga0114364_1016747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 3154 | Open in IMG/M |
| 3300008267|Ga0114364_1043568 | Not Available | 1655 | Open in IMG/M |
| 3300008450|Ga0114880_1003280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 8927 | Open in IMG/M |
| 3300009068|Ga0114973_10021952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 3950 | Open in IMG/M |
| 3300009158|Ga0114977_10077995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 2025 | Open in IMG/M |
| 3300009158|Ga0114977_10357501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 821 | Open in IMG/M |
| 3300009158|Ga0114977_10627916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 577 | Open in IMG/M |
| 3300009163|Ga0114970_10714694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 531 | Open in IMG/M |
| 3300009168|Ga0105104_10233708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1002 | Open in IMG/M |
| 3300009180|Ga0114979_10122758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1598 | Open in IMG/M |
| 3300009183|Ga0114974_10584560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 617 | Open in IMG/M |
| 3300011268|Ga0151620_1018487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 2440 | Open in IMG/M |
| 3300011336|Ga0153703_1633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 11245 | Open in IMG/M |
| 3300013014|Ga0164295_10032190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 3998 | Open in IMG/M |
| (restricted) 3300013122|Ga0172374_1205704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 712 | Open in IMG/M |
| (restricted) 3300013130|Ga0172363_10748374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 610 | Open in IMG/M |
| 3300013372|Ga0177922_10206636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 605 | Open in IMG/M |
| 3300014962|Ga0134315_1019026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1066 | Open in IMG/M |
| 3300017707|Ga0181363_1005552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 2723 | Open in IMG/M |
| 3300017707|Ga0181363_1034491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 945 | Open in IMG/M |
| 3300017754|Ga0181344_1086939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 915 | Open in IMG/M |
| 3300019781|Ga0181360_117773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 579 | Open in IMG/M |
| 3300019783|Ga0181361_100015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 7391 | Open in IMG/M |
| 3300019783|Ga0181361_111331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 694 | Open in IMG/M |
| 3300019784|Ga0181359_1138035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 852 | Open in IMG/M |
| 3300019784|Ga0181359_1238229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 560 | Open in IMG/M |
| 3300020141|Ga0211732_1047738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1365 | Open in IMG/M |
| 3300020151|Ga0211736_10361556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1231 | Open in IMG/M |
| 3300020158|Ga0194038_1210709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 552 | Open in IMG/M |
| 3300020183|Ga0194115_10029030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 3974 | Open in IMG/M |
| 3300020518|Ga0208721_1043633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 532 | Open in IMG/M |
| 3300020539|Ga0207941_1017543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1088 | Open in IMG/M |
| 3300020553|Ga0208855_1037868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 654 | Open in IMG/M |
| 3300020570|Ga0208465_1001714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 4516 | Open in IMG/M |
| 3300021516|Ga0194045_1000020 | All Organisms → cellular organisms → Bacteria | 44921 | Open in IMG/M |
| 3300021962|Ga0222713_10207349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1306 | Open in IMG/M |
| 3300023174|Ga0214921_10071118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 2837 | Open in IMG/M |
| 3300025445|Ga0208424_1000117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 9484 | Open in IMG/M |
| 3300025585|Ga0208546_1001163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 8323 | Open in IMG/M |
| 3300025889|Ga0208644_1013864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 5340 | Open in IMG/M |
| 3300027126|Ga0255098_1002715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 3833 | Open in IMG/M |
| 3300027563|Ga0209552_1017366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 2175 | Open in IMG/M |
| 3300027733|Ga0209297_1007973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 5282 | Open in IMG/M |
| 3300027734|Ga0209087_1013231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 4171 | Open in IMG/M |
| 3300027736|Ga0209190_1119197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1188 | Open in IMG/M |
| 3300027769|Ga0209770_10009670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 4401 | Open in IMG/M |
| 3300027797|Ga0209107_10000308 | All Organisms → cellular organisms → Bacteria | 29009 | Open in IMG/M |
| 3300027870|Ga0209023_10820225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 522 | Open in IMG/M |
| 3300027899|Ga0209668_10000057 | All Organisms → cellular organisms → Bacteria | 43215 | Open in IMG/M |
| 3300027899|Ga0209668_10007552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 4989 | Open in IMG/M |
| 3300027956|Ga0209820_1001006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 6914 | Open in IMG/M |
| 3300031758|Ga0315907_10168680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1847 | Open in IMG/M |
| 3300031758|Ga0315907_10251507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1466 | Open in IMG/M |
| 3300031787|Ga0315900_10049817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 4429 | Open in IMG/M |
| 3300031857|Ga0315909_10002770 | All Organisms → cellular organisms → Bacteria | 22110 | Open in IMG/M |
| 3300031963|Ga0315901_10939307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 611 | Open in IMG/M |
| 3300032070|Ga0315279_10714693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 606 | Open in IMG/M |
| 3300032116|Ga0315903_10221907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1659 | Open in IMG/M |
| 3300032116|Ga0315903_10606236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 839 | Open in IMG/M |
| 3300033418|Ga0316625_102172568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 552 | Open in IMG/M |
| 3300033816|Ga0334980_0130209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1036 | Open in IMG/M |
| 3300033816|Ga0334980_0307438 | Not Available | 614 | Open in IMG/M |
| 3300033816|Ga0334980_0340330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 576 | Open in IMG/M |
| 3300033978|Ga0334977_0257941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Erwiniaceae → Pantoea → Pantoea agglomerans group → Pantoea agglomerans | 853 | Open in IMG/M |
| 3300034012|Ga0334986_0067439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 2217 | Open in IMG/M |
| 3300034060|Ga0334983_0134315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1575 | Open in IMG/M |
| 3300034082|Ga0335020_0015126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 4509 | Open in IMG/M |
| 3300034096|Ga0335025_0397129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 713 | Open in IMG/M |
| 3300034106|Ga0335036_0850472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 523 | Open in IMG/M |
| 3300034108|Ga0335050_0111611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1560 | Open in IMG/M |
| 3300034111|Ga0335063_0124390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Erwiniaceae → Pantoea → Pantoea agglomerans group → Pantoea agglomerans | 1530 | Open in IMG/M |
| 3300034120|Ga0335056_0403413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 736 | Open in IMG/M |
| 3300034283|Ga0335007_0307929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1034 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 17.31% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 15.38% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 9.62% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 6.73% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 6.73% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.85% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.85% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 2.88% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.88% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 2.88% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.92% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.92% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.92% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.92% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.92% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.96% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.96% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.96% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.96% |
| Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 0.96% |
| Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.96% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.96% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.96% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.96% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.96% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
| 3300002401 | Freshwater microbial communities from Lake Mendota, WI - 26JUN2009 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
| 3300003491 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
| 3300003860 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005992 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_14-Oct-14 | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006863 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007200 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Monthly Sampling-Site B) 9 sequencing projects | Environmental | Open in IMG/M |
| 3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
| 3300007734 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Jan | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300011336 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Paldang | Environmental | Open in IMG/M |
| 3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
| 3300013122 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3m | Environmental | Open in IMG/M |
| 3300013130 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2 | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014962 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0309 | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300019781 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM15.S.D | Environmental | Open in IMG/M |
| 3300019783 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020158 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L227-6m | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020518 | Freshwater microbial communities from Lake Mendota, WI - 17AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020539 | Freshwater microbial communities from Lake Mendota, WI - 13SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020553 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020570 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021516 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L626-11m | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300025445 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027126 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8d | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027870 | Freshwater and sediment microbial communities from Lake Erie, Canada (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032070 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_20 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034060 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034096 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
| 3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FwDRAFT_100634284 | 3300000882 | Freshwater And Marine | MIHKANRPPSPEELKQLLIMAFGMGMVVASAYFLLFVVK* |
| B570J29611_10001615 | 3300002401 | Freshwater | VIHKANRPPSPEELKQLLIMAFGMGMVVASAYFILFVVK* |
| B570J40625_1000731713 | 3300002835 | Freshwater | MIRRSNRPPTESEIKQMLIAAFCMGMIITSAYFILFILK* |
| JGI25908J49247_100320142 | 3300003277 | Freshwater Lake | VIHKANRPPSPEELKQLLIMAFGMGMVVASAYFLLFVVK* |
| JGI25910J50241_101561051 | 3300003388 | Freshwater Lake | MIHKANRPPSPEELKHLLIMAFCMGMVITAAYFVLFVVK* |
| JGI25907J50239_10178991 | 3300003394 | Freshwater Lake | MIHKANRPPSPEELKQLLIMAFGMGMVITAAYFLLFVVK* |
| JGI25922J50271_100087346 | 3300003413 | Freshwater Lake | MIHRANRPPSPEEIKQLLIAAFAAGVVITSAYFILFVLK* |
| JGI25924J51412_10461342 | 3300003491 | Freshwater Lake | MIQKMHRPPSPEELKQLLIAAFAMGVVVASAYFILFVVK* |
| JGI25925J51416_100166002 | 3300003497 | Freshwater Lake | MIQNMHRPPSPEELKQLLIAAFAMGVVVASAYFILFVVK* |
| Ga0031658_10834233 | 3300003860 | Freshwater Lake Sediment | MIHKMHRPPSPEEIKQLLIAAFAAGVVITSAYFMLFVIKP* |
| Ga0007787_103123892 | 3300004240 | Freshwater Lake | VIHRMNRPPSPEEIKQLLIAAFAAGVVITSAYFILFVLK* |
| Ga0069718_160336806 | 3300004481 | Sediment | MIRRSSRPPSPDELKQLLIATFCAGMVITAAYFILFVVK* |
| Ga0068876_102498233 | 3300005527 | Freshwater Lake | MIRRSSRPPSPDELKQLLIAAFCAGMVITAAYFILFVLK* |
| Ga0049080_101999042 | 3300005582 | Freshwater Lentic | MIHKSNRPPSPEELKHLLIMAFCMGMVITAAYFVLFVVK* |
| Ga0079957_10003164 | 3300005805 | Lake | MRRANRPPSKDELKELLVAAFAAGVVITAAYFMLFIVK* |
| Ga0079957_10130705 | 3300005805 | Lake | MNHKMYRPPSPDELKQLLIAAFCAGMVITAAYFILFVVK* |
| Ga0073924_10082504 | 3300005992 | Sand | MIQKMHRPPSPEELKQLLIMAFGMGMVVASAYFLLFVVK* |
| Ga0075470_1000108613 | 3300006030 | Aqueous | MIRRANRPPSPEDIKQLLIAAFAAGVVITSAYFMLFVVKP* |
| Ga0075471_1000495418 | 3300006641 | Aqueous | MIHRMQRPPSPEELKHLLIAAFCMGMIITACYFLMFVL* |
| Ga0070749_100659915 | 3300006802 | Aqueous | MIHKMHRPPSPEEIKQLLIAAFAAGVVITSAYFMLFVVKP* |
| Ga0075459_100093712 | 3300006863 | Aqueous | VIHKMHRPPSPEEIKQLLIAAFAAGVVITSAYFMLFVVKP* |
| Ga0103273_10517213 | 3300007200 | Freshwater Lake | MIRMNRPPSPDELKQMLIASFAMGVVITSAYFILFVL* |
| Ga0102863_11287271 | 3300007622 | Estuarine | KANRPPSPEELRQLLIAAFAMGVVVASAYFILFVLK* |
| Ga0104986_19118 | 3300007734 | Freshwater | MIHKSNRPPSPEELKQLLIAAFAMGVVVASAYFILFVVK* |
| Ga0105745_13014902 | 3300007972 | Estuary Water | MNRPPSPEELKQMLIAAFAMGVVITSAYFILFVIK* |
| Ga0105746_13409741 | 3300007973 | Estuary Water | MIRRMNRPPSPEELKQMLIAAFAMGVVITSAYFILFVLK* |
| Ga0105747_12775492 | 3300007974 | Estuary Water | MIRRMNRPPSPEELKQMLIAAFAMGVVITSAYFILFVIK* |
| Ga0108970_1069843712 | 3300008055 | Estuary | MYRPPSPDELKQLLIAAFCAGMVITAAYFILFVVK* |
| Ga0114343_12142982 | 3300008110 | Freshwater, Plankton | MIRRSSRPPSPDELKQLLIAAFCAGMVITAAYFIL |
| Ga0114351_10469686 | 3300008117 | Freshwater, Plankton | MYRPPSPDELKQLLIATFCAGMVITAAYFILFVVK* |
| Ga0114355_10736663 | 3300008120 | Freshwater, Plankton | MNHKMYRPPSPDELKQLLIATFCAGMVITAAYFILFVVK* |
| Ga0114364_10167475 | 3300008267 | Freshwater, Plankton | VIHKANRPPSKDELKELLVAAFAAGVVITAAYFMLFIVK* |
| Ga0114364_10435684 | 3300008267 | Freshwater, Plankton | MIHRANRPPSPDELKQLLIATFCAGMVITAAYFILFVVK* |
| Ga0114880_100328013 | 3300008450 | Freshwater Lake | MIHKANRPPSPEELKHLLIMAFCMGMVITAAYFILFVIK* |
| Ga0114973_100219526 | 3300009068 | Freshwater Lake | VIHKANRPPSPEELKQLLIMAFGMGMVVASAYFILFVLK* |
| Ga0114977_100779952 | 3300009158 | Freshwater Lake | VIHKANRPPSPEELKQLLIMAFGMGMVVASAYFILFVIK* |
| Ga0114977_103575013 | 3300009158 | Freshwater Lake | MIQKMHRPPSPEELKQLLIAAFAMGIVVASAYFILFVVK* |
| Ga0114977_106279161 | 3300009158 | Freshwater Lake | VIHKASRPPSPEELKQLLIAAFAMGVVVASAYFILFVIK* |
| Ga0114970_107146942 | 3300009163 | Freshwater Lake | MIQKMHRPPSPEELKQLLIAAFAMGVVVASAYFILFVIK* |
| Ga0105104_102337084 | 3300009168 | Freshwater Sediment | MYRPPSPDELKQLLIATFCAGMVVTAAYFILFVVK* |
| Ga0114979_101227581 | 3300009180 | Freshwater Lake | MIQKMHRPPSPEELKQLLIAAFAMGIVVASAYFILF |
| Ga0114974_105845602 | 3300009183 | Freshwater Lake | VIHKASRPPSPEELKQLLIAAFAMGVVVASAYFILFVVK* |
| Ga0151620_10184872 | 3300011268 | Freshwater | MNHRMYRPPSPEELKQLLIAAFAMGVVITSAYFILFVIK* |
| Ga0153703_163310 | 3300011336 | Freshwater | MIHKANRPPSPEELKQLLIMAFGMGMVVASAYFILFVVK* |
| Ga0164295_100321904 | 3300013014 | Freshwater | MIHKMHRPPSPEELKQLLIAAFAMGVVVASSYFILFVIK* |
| (restricted) Ga0172374_12057043 | 3300013122 | Freshwater | MMIHGNRPPSPDELKSLLIAAFCMGMIITAFYFLMFVL* |
| (restricted) Ga0172363_107483742 | 3300013130 | Sediment | MMIHGNRPPSPDELKSLLIAAFCMGMIITAFYFLMFV |
| Ga0177922_102066362 | 3300013372 | Freshwater | MIQKMHRPPSPEELKQLLIMAFGMGVVVASAYFLLFVVK* |
| Ga0134315_10190263 | 3300014962 | Surface Water | MIMRGSRPPSPEELKNLLIAAFAMGVVITSAYFLLFVL* |
| Ga0181363_10055523 | 3300017707 | Freshwater Lake | MIHRANRPPSPDELKQLLIATFCAGMVITAAYFILFVVK |
| Ga0181363_10344915 | 3300017707 | Freshwater Lake | LRPRRYTVIHRMNRPPSPEEIKQLLIAAFAAGVVITSAYFMLFVVKP |
| Ga0181344_10869393 | 3300017754 | Freshwater Lake | VIHKANRPPSPEELKQLLIMAFGMGMVVASAYFVLFVVK |
| Ga0181360_1177731 | 3300019781 | Freshwater Lake | MIHKANRPPSPEELKHLLIMAFCMGMVITAAYFVLFVVK |
| Ga0181361_1000152 | 3300019783 | Freshwater Lake | MIHKANRPPSPEELKQLLIMAFGMGMVVASAYFLLFVVK |
| Ga0181361_1113312 | 3300019783 | Freshwater Lake | VIHKANRPPSPEELKQLLIMAFGMGMVVASAYFLLFVVK |
| Ga0181359_11380354 | 3300019784 | Freshwater Lake | MNRPPSPEEIKQLLIAAFAAGVVITSAYFMLFVVKP |
| Ga0181359_12382291 | 3300019784 | Freshwater Lake | MIQNMHRPPSPEELKQLLIAAFAMGVVVASAYFILFVVK |
| Ga0211732_10477382 | 3300020141 | Freshwater | MIHKANRPPSPEELKQLLIMAFGMGMVVASAYFILFVVK |
| Ga0211736_103615562 | 3300020151 | Freshwater | MIHKANRPPSPEELKQLLIAAFAMGVVVASAYFILFVVK |
| Ga0194038_12107092 | 3300020158 | Anoxic Zone Freshwater | GRWPVIHKANRPPSPEELKQLLIMAFGMGMVVASAYFILFVLK |
| Ga0194115_100290309 | 3300020183 | Freshwater Lake | MMIHGNRPPSPDELKSLLIAAFCMGMIITAFYFLIFIL |
| Ga0208721_10436332 | 3300020518 | Freshwater | MIRRSNRPPTESEIKQMLIAAFCMGMIITSAYFILFILK |
| Ga0207941_10175434 | 3300020539 | Freshwater | RMNRPPSPEELKQMLIAAFAMGVVITSAYFILFVLK |
| Ga0208855_10378683 | 3300020553 | Freshwater | MNRPPSPEELKQMLIAAFAMGVVITSAYFILFVLK |
| Ga0208465_10017146 | 3300020570 | Freshwater | MIRRSSRPPSSDEIRQLLIAAFCAGMVITAAYFILFVVK |
| Ga0194045_100002015 | 3300021516 | Anoxic Zone Freshwater | VIHKANRPPSPEELKQLLIMAFGMGMVVASAYFILFVLK |
| Ga0222713_102073492 | 3300021962 | Estuarine Water | MNHRMYRPPSPEELKQLLIAAFAMGVVITSAYFILFVIK |
| Ga0214921_100711186 | 3300023174 | Freshwater | MIHKANRPPSPEELKHLLIMAFCMGMVITAAYFILFVIK |
| Ga0208424_100011717 | 3300025445 | Aqueous | VIHKMHRPPSPEEIKQLLIAAFAAGVVITSAYFMLFVVKP |
| Ga0208546_100116312 | 3300025585 | Aqueous | MIRRANRPPSPEDIKQLLIAAFAAGVVITSAYFMLFVVKP |
| Ga0208644_101386411 | 3300025889 | Aqueous | MIHKMHRPPSPEEIKQLLIAAFAAGVVITSAYFMLFVIKP |
| Ga0255098_10027157 | 3300027126 | Freshwater | MNRPPSPEELKQMLIAAFAMGVVITSAYFILFVIK |
| Ga0209552_10173662 | 3300027563 | Freshwater Lake | MIQKMHRPPSPEELKQLLIAAFAMGVVVASAYFILFVVK |
| Ga0209297_10079732 | 3300027733 | Freshwater Lake | VIHKASRPPSPEELKQLLIAAFAMGVVVASAYFILFVIK |
| Ga0209087_10132317 | 3300027734 | Freshwater Lake | MIQKMHRPPSPEELKQLLIAAFAMGIVVASAYFILFVVK |
| Ga0209190_11191973 | 3300027736 | Freshwater Lake | MIQKMHRPPSPEELKQLLIAAFAMGVVVASAYFILFVIK |
| Ga0209770_100096708 | 3300027769 | Freshwater Lake | MIHRANRPPSPEEIKQLLIAAFAAGVVITSAYFILFVLK |
| Ga0209107_100003084 | 3300027797 | Freshwater And Sediment | MIHKSNRPPSPEELKHLLIMAFCMGMVITAAYFVLFVVK |
| Ga0209023_108202253 | 3300027870 | Freshwater And Sediment | QMIHKANRPPSPEELKQLLIAAFAMGVVVASAYFILFVIK |
| Ga0209668_1000005759 | 3300027899 | Freshwater Lake Sediment | MRRANRPPSKDELKELLVAAFAAGVVITAAYFMLFIVK |
| Ga0209668_1000755210 | 3300027899 | Freshwater Lake Sediment | MNHRMYRPPSPEELKQMLIAAFAMGVVITSAYFILFVIK |
| Ga0209820_10010066 | 3300027956 | Freshwater Sediment | MIRRSSRPPTESEIKQMLIAAFCMGMIITSAYFILFILK |
| Ga0315907_101686802 | 3300031758 | Freshwater | MIRRMNRPPSPEELKQMLIAAFAMGVVITSAYFILFVLK |
| Ga0315907_102515077 | 3300031758 | Freshwater | PLRSRRRQMIRRMNRPPSPEELKQMLIAAFAMGVVITSAYFILFVLK |
| Ga0315900_100498175 | 3300031787 | Freshwater | MMRMQRPPSHEEIKHMLIAAFCMGMIITACYFLMFVL |
| Ga0315909_100027702 | 3300031857 | Freshwater | MIRRSSRPPSPDELKQLLIAAFCAGMVITAAYFILFVVK |
| Ga0315901_109393072 | 3300031963 | Freshwater | MIRRANRPPSPEQLREMLIAAFAMGVVITSAYFILFVLKP |
| Ga0315279_107146932 | 3300032070 | Sediment | MIHKANRPPSPEELKHLLIMAFCIGMVITAAYFVLFVVK |
| Ga0315903_102219071 | 3300032116 | Freshwater | MIRRSSRPPSPDELKQLLIAAFCAGMVITAAYFILFVLK |
| Ga0315903_106062364 | 3300032116 | Freshwater | SPLRSRRRQMIRRMNRPPSPEELKQMLIAAFAMGVVITSAYFILFVLK |
| Ga0316625_1021725682 | 3300033418 | Soil | MIHRMQRPPSPEELKHLLIAAFCMGMIITACYFLM |
| Ga0334980_0130209_686_805 | 3300033816 | Freshwater | MNRKINRPPSKDELKELMIAAFAAGVVITAAYFILFILK |
| Ga0334980_0307438_124_243 | 3300033816 | Freshwater | MIQKMHRPPSPEELKHLLIMAFGMGMVVASAYFILFVVK |
| Ga0334980_0340330_152_271 | 3300033816 | Freshwater | VIHKANRPPSPEELKQLLIMAFGMGMVVASAYFILFVVK |
| Ga0334977_0257941_715_822 | 3300033978 | Freshwater | MYRPPSPDELKQLLIAAFCAGMVITAAYFILFVVK |
| Ga0334986_0067439_950_1069 | 3300034012 | Freshwater | VIHKANRPPSPEELNQLLIAAFAMGVVVASAYFILFVVK |
| Ga0334983_0134315_3_119 | 3300034060 | Freshwater | IHKANRPPSPEELKQLLIMAFGMGMVVASAYFLLFVVK |
| Ga0335020_0015126_1256_1375 | 3300034082 | Freshwater | VIHKANRPPSPEELKQLLIAAFAMGVVVASAYFLLFVVK |
| Ga0335025_0397129_420_539 | 3300034096 | Freshwater | MIRRSSRPPSPDEIRQLLIAAFCAGMVITAAYFILFVVK |
| Ga0335036_0850472_111_233 | 3300034106 | Freshwater | MIHKMHRPPSPEEIKQLLIAAFAAGVVITSAYFMLFVVKP |
| Ga0335050_0111611_576_695 | 3300034108 | Freshwater | MIQKMHRPPSPEELKQLLIMAFGMGMVVASAYFLLFVVK |
| Ga0335063_0124390_833_940 | 3300034111 | Freshwater | MYRPPSSDEIRQLLIAAFCAGMVITAAYFILFVVK |
| Ga0335056_0403413_627_734 | 3300034120 | Freshwater | MIQKMHRPPSPEELKQLLIMAFGMGMVVASAYFLLF |
| Ga0335007_0307929_212_331 | 3300034283 | Freshwater | VIHKANRPPSPEELKQLLIMAFGMGMVVASAYFLLFVIK |
| ⦗Top⦘ |