 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F097187 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 42 residues |
| Representative Sequence | TMKRLEALEKMLSLGLIDVEEAKEMEQMTPNGRETEDETYIQ |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 1.92 % |
| % of genes from short scaffolds (< 2000 bps) | 0.96 % |
| Associated GOLD sequencing projects | 77 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (98.077 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (24.038 % of family members) |
| Environment Ontology (ENVO) | Unclassified (75.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (76.923 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.43% β-sheet: 0.00% Coil/Unstructured: 68.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF04586 | Peptidase_S78 | 86.54 |
| PF05065 | Phage_capsid | 5.77 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 86.54 |
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 5.77 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 98.08 % |
| All Organisms | root | All Organisms | 1.92 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002278|B570J29590_100186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6190 | Open in IMG/M |
| 3300022200|Ga0196901_1036296 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1900 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 24.04% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 17.31% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 13.46% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 7.69% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 6.73% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 5.77% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.85% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.88% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.92% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.92% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.92% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.96% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.96% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.96% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.96% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.96% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.96% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Microbialites → Unclassified → Freshwater Lake | 0.96% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300001948 | Marine microbial communities from Chesapeake Bay, Maryland, USA - GS012 | Environmental | Open in IMG/M |
| 3300002278 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002294 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002465 | Anoxic frehswater biofilm from Lago dell Orsa, Frasassi caves, Italy | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003404 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD | Environmental | Open in IMG/M |
| 3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
| 3300003491 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003493 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008263 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTR | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300012712 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES121 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012716 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES130 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012730 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES126 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300018682 | Metatranscriptome of marine microbial communities from Baltic Sea - GS680_0p1 | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020553 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300027337 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8d | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12421J11937_100382463 | 3300000756 | Freshwater And Sediment | KRLEALEKMLSLGLITVEEAKEMENMTPEGNENGNAEYINSTKGENA* |
| GOS2228_10419172 | 3300001948 | Marine | MKRLEAIEKMLSLGLIDVEQAKEMEDMSPNGNESTDATYVQ* |
| B570J29590_1001869 | 3300002278 | Freshwater | MKRLEALEKMINLGLIDVEEAKEMEQMTPNGRETEDETYIQ* |
| B570J29584_10047202 | 3300002294 | Freshwater | LRADTMKRLEALEKMINLGLIDVEEAKEMEQMTPNGREEDNETYIQ* |
| B570J29032_1088560592 | 3300002408 | Freshwater | EAIEKMLSLGLIDIDDAKEMESLTPNGREVEDDTYIQ* |
| B570J29032_1092013892 | 3300002408 | Freshwater | ADTMKRLEAIEKMLALGLIDVEDAKEMEQMTPNGKEVEDDTYIQ* |
| LO132_100217421 | 3300002465 | Freshwater Lake | MKRLEALEKMLSLGLITVEEAKQMEDLTPNGNESADVTYVQ* |
| B570J40625_1017100491 | 3300002835 | Freshwater | ADTMKRLEAIEKMLTLGLIDLDTAKEMEDMTPEGSESNDETYIQ* |
| JGI25908J49247_101255471 | 3300003277 | Freshwater Lake | RADTMKRLEALEKMLSLGLITVEEAKEMENMTPEGSEDNATYIQ* |
| JGI25910J50241_101378581 | 3300003388 | Freshwater Lake | EALEKMLSLGLITVEEAKEMENMTPEGNENGNAEYISSTKGENA* |
| JGI25907J50239_10709581 | 3300003394 | Freshwater Lake | MKRLEALEKMLSLGLITVEEAKEMENMTPEGSEDNATYIQ* |
| JGI25920J50251_100854461 | 3300003404 | Freshwater Lake | GVRADTMKRLEALEKMLSLGLITVEEAKEMENMTPEGNENGNAEYISSTKGENA* |
| JGI25911J50253_101799243 | 3300003411 | Freshwater Lake | KMLSLGLITVEEAKEMENMTPEGNXNGNAEYISSTKGENA* |
| JGI25924J51412_10668762 | 3300003491 | Freshwater Lake | ALEKMLSLGLITVEEAKEMENMTPEGNENDNAEYINSTKGENA* |
| JGI25923J51411_10571551 | 3300003493 | Freshwater Lake | RLEALEKMLSLGLITVEEAKEMENMTPEGNENDNAEYINSTKGENA* |
| Ga0065166_103340651 | 3300004112 | Freshwater Lake | DTMKRLEAIEKMLSLGLIDIDDAKEMESLTPNGREVEDDTYIQ* |
| Ga0049083_102434311 | 3300005580 | Freshwater Lentic | RLEALEKMLSLGLITVEEAKEMENMTPEGSEDNATYIQ* |
| Ga0049082_102627211 | 3300005584 | Freshwater Lentic | EALEKMLSLGLITVEEAKEMENMTPEGSEDNATYIQ* |
| Ga0079957_13395381 | 3300005805 | Lake | IEKMLSLGLIDVEQAKEMESLTPNGNEDTDVTYVQ* |
| Ga0075471_103277151 | 3300006641 | Aqueous | DTMKRLEALEKMINLGLIDVEDAKEMESLTPNGKEEEDETYIQ* |
| Ga0075472_102827692 | 3300006917 | Aqueous | LRADTAKRLEAIEKMLNLGLIDVEQAKQMENMTPNGNETNDATYVQ* |
| Ga0099851_13231352 | 3300007538 | Aqueous | EAIEKMLALGLIDVEQAKEMEQMTPNGNEEADATYIQ* |
| Ga0099847_11105131 | 3300007540 | Aqueous | FLRADTIKRLEAIEKMLALGLIDVEQAKEMEQMTPNGNEEADATYIQ* |
| Ga0099850_10312953 | 3300007960 | Aqueous | EESFLRADTMKRLEAIEKMLNLGLIDVEDAKEMESLTPNGRETEDETYIQ* |
| Ga0114351_13923981 | 3300008117 | Freshwater, Plankton | MKRLEAIEKMLSLGLIDVEQAKEMEQMTPNGNEDTDVTYVQ* |
| Ga0114355_10580754 | 3300008120 | Freshwater, Plankton | DTIKRLEAIEKMLNLGLIDIDDAKEMESLTPNGREEDNETYIQ* |
| Ga0114336_10468821 | 3300008261 | Freshwater, Plankton | ESFLRADTIKRLEAIEKMLALGLIDVEDAKEMEQMTPNGREVEDDTYIQ* |
| Ga0114349_11705781 | 3300008263 | Freshwater, Plankton | TMKRLEALEKMMALGLIDVEDAKEMEQMTPNGRETEDETYIQ* |
| Ga0114363_11664171 | 3300008266 | Freshwater, Plankton | EESFLRADTMKRLEALEKMINLGLIDVEQAKEMEQMTPNGREQDDDTYIQ* |
| Ga0114363_11810672 | 3300008266 | Freshwater, Plankton | SFLRADTMKRLEALEKMINLGLIDVEEAKEMEQMTPNGRETEDETYIQ* |
| Ga0114363_12049702 | 3300008266 | Freshwater, Plankton | IEKMLSLGLIDVEQAKEMEQMTPNGNEDTDVTYVQ* |
| Ga0114363_12205422 | 3300008266 | Freshwater, Plankton | KRLEALEKMLALGLIDVEDAKEMESLTPNGRETEDDTYIQ* |
| Ga0114880_11989922 | 3300008450 | Freshwater Lake | TMKRLEALEKMLNLGLIDIDDAKEMESLTPNGREEEDDTYIQ* |
| Ga0114880_12154601 | 3300008450 | Freshwater Lake | LEKMINLGLIDVEEAKEMEQMTPNGRETEDETYIQ* |
| Ga0114880_12188542 | 3300008450 | Freshwater Lake | ALEKMINLGLIDVEEAKEMEQMTPNGRETEDETYIQ* |
| Ga0114880_12363212 | 3300008450 | Freshwater Lake | RADTMKRLEALEKMLSLGLITVEEAKEMENMTPEGNENNNAEYINSTKGENA* |
| Ga0114880_12724712 | 3300008450 | Freshwater Lake | TMKRLEALEKMLNLGLIDIDDAKEMESLTPNGREEEDETYIQ* |
| Ga0114980_105372951 | 3300009152 | Freshwater Lake | RADTMKRLEAIEKMLSLGLIDIQQAKEMEDMSPNGSESYNVS* |
| Ga0114968_105482832 | 3300009155 | Freshwater Lake | SFLRADTMKRLEAIEKMLALGLIDVEDAKEMESLTPNGRETEDDTYIQ* |
| Ga0114977_103782692 | 3300009158 | Freshwater Lake | IEKMLSLGLIDVEQAKQMEQMTPNGNETDNATYVQ* |
| Ga0114977_105474901 | 3300009158 | Freshwater Lake | KRLEAIEKMLALGLIDVEQAKEMEDMSPNGNESYNVS* |
| Ga0114977_106512841 | 3300009158 | Freshwater Lake | EAIEKMLALGLIDVEQAKEMEDMSPNGNESYNVS* |
| Ga0114981_107548281 | 3300009160 | Freshwater Lake | LEAIEKMLALGLIDVEQAKEMEDMSPNGNESYNVS* |
| Ga0114966_106577221 | 3300009161 | Freshwater Lake | SFLRADTMKRLEAIEKMLALGLIDVEQAKEMEDMSPNGNENYNVS* |
| Ga0114970_107375992 | 3300009163 | Freshwater Lake | EAIEKMLSLGLIDVEQAKEMEDMSPNGNESTDATYVQ* |
| Ga0105102_104622582 | 3300009165 | Freshwater Sediment | RADTMKRLEALEKMINLGLIDVEEAKEMEQMTPNGREEDNETYIQ* |
| Ga0114979_105349121 | 3300009180 | Freshwater Lake | FLRADTMKRLEAIEKMLALGLIDVEQAKEMEDMSPNGNESYNVS* |
| Ga0114969_105238882 | 3300009181 | Freshwater Lake | EKMLALGLIDVEDAKEMEQMTPNGKEVEDDTYIQ* |
| Ga0114967_104172372 | 3300010160 | Freshwater Lake | RLEAIEKMLALGLIDVEQAKEMEDMSPNGNESYNVS* |
| Ga0157598_12105811 | 3300012712 | Freshwater | KRLEALEKMINLGLIDVEEAKEMEQMTPNGRETEDETYIQ* |
| Ga0157605_10724511 | 3300012716 | Freshwater | RLEALEKMINLGLIDVEEAKEMEQMTPNGRETEDETYIQ* |
| Ga0157602_11279961 | 3300012730 | Freshwater | TMKRLEALEKMLSLGLIDVEEAKEMEQMTPNGRETEDETYIQ* |
| Ga0164293_106950672 | 3300013004 | Freshwater | RLEALEKMLSLGLIDVEEAKEMEQMTPNGRETEDETYIQ* |
| Ga0170791_158398531 | 3300013295 | Freshwater | DTMKRLEAIEKMLSLGLIDVEQAKEMEDMTPNGNESYNVS* |
| Ga0177922_110143181 | 3300013372 | Freshwater | DTMKRLEAIEKMLTLGLIDLDTAKEMEDMTPEGSESNDETYIR* |
| Ga0177922_112243191 | 3300013372 | Freshwater | ESFLRADTMKRLEALEKMLAFGLIDVEDAKEMENMTPNGKEVEDDTYIQ* |
| Ga0181365_10930182 | 3300017736 | Freshwater Lake | ALEKMLNLGLIDIDDAKQMESLTPNGREVEDDTYIQ |
| Ga0181365_11177471 | 3300017736 | Freshwater Lake | KRLEALEKMLSLGLITVEEAKEMENMTPEGSEDNATYIQ |
| Ga0181356_12060421 | 3300017761 | Freshwater Lake | TMKRLEALEKMLSLGLITVEEAKEMENMTPEGSEDNATYIQ |
| Ga0181343_10739682 | 3300017766 | Freshwater Lake | DTMKRLEALEKMINLGLIDVEQAKEMEQMTPNGREQDDDTYIQ |
| Ga0181358_12051562 | 3300017774 | Freshwater Lake | LRADTMKRLEALEKMLSLGLITVEEAKEMENMTPEGSENNATYIQ |
| Ga0181358_12223922 | 3300017774 | Freshwater Lake | RADTMKRLEALEKMLSLGLITVEEAKEMENMTPEGSENDVTYVQ |
| Ga0181358_12320151 | 3300017774 | Freshwater Lake | LEALEKMLSLGLITVEEAKEMENMTPEGSEDNATYIQ |
| Ga0181357_10448132 | 3300017777 | Freshwater Lake | RADTMKRLEALEKMLSLGLITVEEAKEMENMTPEGSEDNATYIQ |
| Ga0181349_12603482 | 3300017778 | Freshwater Lake | EALEKMLSLGLITVEEAKEMENMTPEGSENDVTYVQ |
| Ga0181346_12081251 | 3300017780 | Freshwater Lake | AIEKMLALGLIDVEDAKEMEQMTPNGKEVEDDTYIQ |
| Ga0188851_10267152 | 3300018682 | Freshwater Lake | TIKRLEAIEKMLALGLIDVEQAKEMEQMTPNGNEEADATYIQ |
| Ga0181359_12057912 | 3300019784 | Freshwater Lake | SFLRADTMKRLEAIEKMLALGLIDVEDAKEMESLTPNGRETEDDTYIQ |
| Ga0181359_12229062 | 3300019784 | Freshwater Lake | MKRLEALEKMLSLGLITVEEAKEMENMTPEGSENDVTYVQ |
| Ga0207193_18398971 | 3300020048 | Freshwater Lake Sediment | MKRLEAIEKMLALGLIDVEDAKEMEQMTPNGKEVEDDTYIQ |
| Ga0208235_10280072 | 3300020530 | Freshwater | MKRLEALEKMINLGLIDVEEAKEMEQMTPNGRETEDETYIQ |
| Ga0208235_10286711 | 3300020530 | Freshwater | ADTMKRLEAIEKMLALGLIDVEDAKEMEQMTPNGKEVEDDTYIQ |
| Ga0208235_10297041 | 3300020530 | Freshwater | MKRLEALEKMINLGLIDVEEAKEMEQMTPNGREEDNETYIQ |
| Ga0207942_10288982 | 3300020549 | Freshwater | LRADTMKRLEALEKMINLGLIDVEEAKEMEQMTPNGRETEDETYIQ |
| Ga0208855_10363141 | 3300020553 | Freshwater | LRADTMKRLEALEKMINLGLIDVEEAKEMEQMTPNGREEDNETYIQ |
| Ga0222712_101705532 | 3300021963 | Estuarine Water | FLRADTMKRLEAIEKMLALGLIDVEQAKEMEDMTPNGNESNDATYVQ |
| Ga0222712_107902871 | 3300021963 | Estuarine Water | TMKRLEAIEKMLALGLIDLEDAKEMEQMTPNGSEVEDDTYIQ |
| Ga0196905_11493212 | 3300022198 | Aqueous | IEKMLALGLIDVEQAKEMEQMTPNGNEEADATYIQ |
| Ga0196901_10362961 | 3300022200 | Aqueous | FLRADTMKRLEAIEKMLNLGLIDVEDAKEMESLTPNGREIEDETYIQ |
| Ga0214917_102338182 | 3300022752 | Freshwater | RLEAIEKMLALGLIDVEQAKEMEDMSPNGNESYNVS |
| Ga0214919_106016871 | 3300023184 | Freshwater | ESFLRADTMKRLEAIEKMLALGLIDVEQAKEMEDMSPNGNESYNVS |
| Ga0255087_10195942 | 3300027337 | Freshwater | LEAIEKMLSLGLIDVEQAKEMEDMTPNGNESEDATYVQ |
| Ga0209033_12369931 | 3300027697 | Freshwater Lake | RADTMKRLEAIEKMLALGLIDVEDAKEMESLTPNGRETEDDTYIQ |
| Ga0209297_12818091 | 3300027733 | Freshwater Lake | MKRLEAIEKMLSLGLIDVEQAKEMEDMSPNGNESYNVS |
| Ga0209444_102735141 | 3300027756 | Freshwater Lake | RLEALEKMLSLGLITVEEAKEMENMTPEGNENDNAEYINSTKGENA |
| Ga0209598_103820181 | 3300027760 | Freshwater Lake | RLEAIEKMLSLGLIDVEQAKEMEDMSPNGNESYNVS |
| Ga0209088_102956132 | 3300027763 | Freshwater Lake | FLRADTMKRLEAIEKMLALGLIDVEQAKEMEDMSPNGNESYNVS |
| Ga0209768_101659833 | 3300027772 | Freshwater Lake | ADTMKRLEALEKMLSLGLITVEEAKEMENMTPEGNENGNAEYISSTKGENA |
| Ga0209500_102523971 | 3300027782 | Freshwater Lake | IEKMLSLGLIDVEQAKEMEDMTPNGNESNDATYVQ |
| Ga0209500_102880221 | 3300027782 | Freshwater Lake | MKRLEAIEKMLALGLIDVEQAKEMEDMSPNGNESYNVS |
| Ga0209246_103010032 | 3300027785 | Freshwater Lake | RLEALEKMLSLGLITVEEAKEMENMTPEGSEDNATYIQ |
| Ga0209401_12518002 | 3300027971 | Freshwater Lake | DTMKRLEAIEKMLALGLIDIQQAKEMEDMSPNGSESYNVS |
| Ga0209401_12561551 | 3300027971 | Freshwater Lake | TIKRLEAIEKMLSLGLIDVEQAKQMEQMTPNGNETDNATYVQ |
| Ga0315294_106228852 | 3300031952 | Sediment | LRADTMKRLEAIEKMLTLGLIDLDHAKEMENMTPEGSADNATYVQ |
| Ga0315906_109258722 | 3300032050 | Freshwater | LRADTMKRLEAIEKMLQLGLIDVDDAKEMEDLTPNGREVEDDTYIQ |
| Ga0315905_110402921 | 3300032092 | Freshwater | TMKRLEALEKMLSIFLITVEEAKEMENMTPEGNENSNGEYINSTKGENA |
| Ga0334979_0591859_3_125 | 3300033996 | Freshwater | KRLEAIEKMLNLGLIDLDDAKQMESLTPNGREEDNETYIQ |
| Ga0334998_0518691_530_655 | 3300034019 | Freshwater | MKRLEAIEKMLALGLIDVEDAKEMEQMTPNGRETEDETYIQ |
| Ga0334995_0048638_36_161 | 3300034062 | Freshwater | MKRLEALEKMINLGLIDVEDAKEMEQMTPNGRETEDETYIQ |
| Ga0334995_0547428_524_649 | 3300034062 | Freshwater | MKRLEALEKMINLGLIDVEDAKEMEQMTPNGRETENETYIQ |
| Ga0335027_0607140_29_154 | 3300034101 | Freshwater | MKRLEALEKMLNLGLIDIDDAKEMESLTPNGREEEDDTYIQ |
| Ga0335066_0687866_333_458 | 3300034112 | Freshwater | MKRLEALEKMLALGLIDVEDAKEMENMTPNGKEVEDDTYIQ |
| Ga0335056_0212206_989_1111 | 3300034120 | Freshwater | KRLEAIEKMLALGLIDVEDAKEMEQMTPNGREVEDDTYIQ |
| Ga0335016_0548779_494_619 | 3300034166 | Freshwater | MKRLEAIEKMLALGLIDVEDAKEMESLTPNGRETEDDTYIQ |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |