| Basic Information | |
|---|---|
| Family ID | F097094 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 40 residues |
| Representative Sequence | VRLARLAIWIATASFVVMLFYPLVMEILARVAARGDSVLP |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 83.65 % |
| % of genes near scaffold ends (potentially truncated) | 20.19 % |
| % of genes from short scaffolds (< 2000 bps) | 75.00 % |
| Associated GOLD sequencing projects | 77 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.192 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (21.154 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.500 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.731 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.41% β-sheet: 0.00% Coil/Unstructured: 45.59% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF13419 | HAD_2 | 55.88 |
| PF07690 | MFS_1 | 12.75 |
| PF13242 | Hydrolase_like | 8.82 |
| PF00076 | RRM_1 | 7.84 |
| PF13893 | RRM_5 | 0.98 |
| PF00857 | Isochorismatase | 0.98 |
| PF00982 | Glyco_transf_20 | 0.98 |
| PF00578 | AhpC-TSA | 0.98 |
| PF13490 | zf-HC2 | 0.98 |
| PF02518 | HATPase_c | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0380 | Trehalose-6-phosphate synthase, GT20 family | Carbohydrate transport and metabolism [G] | 0.98 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.98 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.19 % |
| Unclassified | root | N/A | 4.81 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002908|JGI25382J43887_10039805 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2555 | Open in IMG/M |
| 3300003203|JGI25406J46586_10030887 | All Organisms → cellular organisms → Bacteria | 2011 | Open in IMG/M |
| 3300005166|Ga0066674_10076224 | All Organisms → cellular organisms → Bacteria | 1540 | Open in IMG/M |
| 3300005166|Ga0066674_10187764 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 982 | Open in IMG/M |
| 3300005167|Ga0066672_10093730 | All Organisms → cellular organisms → Bacteria | 1819 | Open in IMG/M |
| 3300005175|Ga0066673_10054079 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2035 | Open in IMG/M |
| 3300005186|Ga0066676_10040011 | All Organisms → cellular organisms → Bacteria | 2609 | Open in IMG/M |
| 3300005332|Ga0066388_100167590 | All Organisms → cellular organisms → Bacteria | 2793 | Open in IMG/M |
| 3300005332|Ga0066388_101368346 | All Organisms → cellular organisms → Bacteria | 1227 | Open in IMG/M |
| 3300005332|Ga0066388_102681870 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 909 | Open in IMG/M |
| 3300005332|Ga0066388_105123298 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 665 | Open in IMG/M |
| 3300005406|Ga0070703_10041255 | All Organisms → cellular organisms → Bacteria | 1438 | Open in IMG/M |
| 3300005445|Ga0070708_101132043 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 733 | Open in IMG/M |
| 3300005451|Ga0066681_10647806 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300005536|Ga0070697_100546162 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1016 | Open in IMG/M |
| 3300005552|Ga0066701_10304641 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300005560|Ga0066670_10094648 | All Organisms → cellular organisms → Bacteria | 1660 | Open in IMG/M |
| 3300005566|Ga0066693_10232391 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 726 | Open in IMG/M |
| 3300005569|Ga0066705_10553889 | Not Available | 712 | Open in IMG/M |
| 3300005764|Ga0066903_100325251 | All Organisms → cellular organisms → Bacteria | 2460 | Open in IMG/M |
| 3300005764|Ga0066903_106697996 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 599 | Open in IMG/M |
| 3300005937|Ga0081455_10479341 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 842 | Open in IMG/M |
| 3300006049|Ga0075417_10028316 | All Organisms → cellular organisms → Bacteria | 2301 | Open in IMG/M |
| 3300006049|Ga0075417_10059715 | All Organisms → cellular organisms → Bacteria | 1666 | Open in IMG/M |
| 3300006755|Ga0079222_10451370 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300006794|Ga0066658_10686801 | Not Available | 564 | Open in IMG/M |
| 3300006800|Ga0066660_10363384 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300006806|Ga0079220_11915915 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300006844|Ga0075428_100010843 | All Organisms → cellular organisms → Bacteria | 10129 | Open in IMG/M |
| 3300006845|Ga0075421_102138239 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 592 | Open in IMG/M |
| 3300006854|Ga0075425_100753552 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
| 3300006854|Ga0075425_102622267 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 557 | Open in IMG/M |
| 3300007255|Ga0099791_10075587 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1531 | Open in IMG/M |
| 3300007255|Ga0099791_10206126 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 927 | Open in IMG/M |
| 3300007265|Ga0099794_10138146 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1233 | Open in IMG/M |
| 3300007265|Ga0099794_10138146 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1233 | Open in IMG/M |
| 3300007265|Ga0099794_10162747 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300009012|Ga0066710_100874315 | All Organisms → cellular organisms → Bacteria | 1382 | Open in IMG/M |
| 3300009100|Ga0075418_10447617 | Not Available | 1384 | Open in IMG/M |
| 3300009137|Ga0066709_103687040 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 556 | Open in IMG/M |
| 3300009147|Ga0114129_10764989 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
| 3300009792|Ga0126374_11196004 | Not Available | 608 | Open in IMG/M |
| 3300010043|Ga0126380_11011030 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 701 | Open in IMG/M |
| 3300010046|Ga0126384_11267121 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 682 | Open in IMG/M |
| 3300010046|Ga0126384_11441519 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 643 | Open in IMG/M |
| 3300010046|Ga0126384_12023500 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 551 | Open in IMG/M |
| 3300010047|Ga0126382_12292622 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 522 | Open in IMG/M |
| 3300010140|Ga0127456_1256077 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 544 | Open in IMG/M |
| 3300010329|Ga0134111_10119162 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300010359|Ga0126376_10355321 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1301 | Open in IMG/M |
| 3300010362|Ga0126377_12410263 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 602 | Open in IMG/M |
| 3300012189|Ga0137388_11384630 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 642 | Open in IMG/M |
| 3300012198|Ga0137364_10304261 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1184 | Open in IMG/M |
| 3300012203|Ga0137399_10353815 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
| 3300012349|Ga0137387_10028065 | All Organisms → cellular organisms → Bacteria | 3602 | Open in IMG/M |
| 3300012362|Ga0137361_10530093 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300012393|Ga0134052_1316739 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 531 | Open in IMG/M |
| 3300012410|Ga0134060_1130387 | Not Available | 575 | Open in IMG/M |
| 3300012918|Ga0137396_10097581 | All Organisms → cellular organisms → Bacteria | 2093 | Open in IMG/M |
| 3300012918|Ga0137396_10451744 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 953 | Open in IMG/M |
| 3300012918|Ga0137396_10451744 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 953 | Open in IMG/M |
| 3300012925|Ga0137419_10668412 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300012927|Ga0137416_11816277 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 557 | Open in IMG/M |
| 3300012944|Ga0137410_10427271 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300012948|Ga0126375_10944772 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 697 | Open in IMG/M |
| 3300012976|Ga0134076_10013672 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2805 | Open in IMG/M |
| 3300015241|Ga0137418_10751576 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 739 | Open in IMG/M |
| 3300015371|Ga0132258_10936447 | All Organisms → cellular organisms → Bacteria | 2188 | Open in IMG/M |
| 3300015372|Ga0132256_102844049 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300017659|Ga0134083_10010420 | All Organisms → cellular organisms → Bacteria | 3106 | Open in IMG/M |
| 3300017659|Ga0134083_10131714 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300018431|Ga0066655_10003521 | All Organisms → cellular organisms → Bacteria | 6124 | Open in IMG/M |
| 3300018431|Ga0066655_10034240 | All Organisms → cellular organisms → Bacteria | 2503 | Open in IMG/M |
| 3300018468|Ga0066662_10441021 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
| 3300018482|Ga0066669_12346199 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 510 | Open in IMG/M |
| 3300019789|Ga0137408_1296361 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1299 | Open in IMG/M |
| 3300020170|Ga0179594_10087548 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
| 3300024330|Ga0137417_1100550 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300025939|Ga0207665_10061128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2553 | Open in IMG/M |
| 3300026277|Ga0209350_1049085 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1226 | Open in IMG/M |
| 3300026295|Ga0209234_1080463 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
| 3300026297|Ga0209237_1026214 | All Organisms → cellular organisms → Bacteria | 3249 | Open in IMG/M |
| 3300026297|Ga0209237_1110613 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1182 | Open in IMG/M |
| 3300026297|Ga0209237_1188387 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300026300|Ga0209027_1016960 | All Organisms → cellular organisms → Bacteria | 2760 | Open in IMG/M |
| 3300026301|Ga0209238_1014608 | All Organisms → cellular organisms → Bacteria | 3040 | Open in IMG/M |
| 3300026324|Ga0209470_1042661 | All Organisms → cellular organisms → Bacteria | 2234 | Open in IMG/M |
| 3300026536|Ga0209058_1035756 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2997 | Open in IMG/M |
| 3300026540|Ga0209376_1055778 | All Organisms → cellular organisms → Bacteria | 2238 | Open in IMG/M |
| 3300026542|Ga0209805_1007408 | All Organisms → cellular organisms → Bacteria | 6011 | Open in IMG/M |
| 3300026547|Ga0209156_10228731 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300026548|Ga0209161_10306727 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 759 | Open in IMG/M |
| 3300026552|Ga0209577_10122919 | All Organisms → cellular organisms → Bacteria | 2076 | Open in IMG/M |
| 3300027209|Ga0209875_1026054 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 696 | Open in IMG/M |
| 3300027655|Ga0209388_1089146 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 886 | Open in IMG/M |
| 3300027671|Ga0209588_1115493 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 861 | Open in IMG/M |
| 3300027765|Ga0209073_10087404 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1083 | Open in IMG/M |
| 3300027775|Ga0209177_10010482 | All Organisms → cellular organisms → Bacteria | 2061 | Open in IMG/M |
| 3300027873|Ga0209814_10009049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3900 | Open in IMG/M |
| 3300027873|Ga0209814_10047719 | All Organisms → cellular organisms → Bacteria | 1786 | Open in IMG/M |
| 3300027880|Ga0209481_10257260 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 880 | Open in IMG/M |
| 3300031716|Ga0310813_10460107 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1105 | Open in IMG/M |
| 3300031720|Ga0307469_11532293 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 639 | Open in IMG/M |
| 3300032180|Ga0307471_100998559 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1004 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 17.31% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 13.46% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.58% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.73% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.77% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.85% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.92% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.96% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010140 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012393 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027209 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25382J43887_100398053 | 3300002908 | Grasslands Soil | MRVARLAIWVATAVFVVMLFYPLVMEMLARVSARGESVLP* |
| JGI25406J46586_100308872 | 3300003203 | Tabebuia Heterophylla Rhizosphere | MKLARLAIWLATAGFIVMLFYPLVVELLMRFGSHGDSGLP* |
| Ga0066674_100762242 | 3300005166 | Soil | VKLARFAIWVATASFVLMLFYPLVMEILTRIAARGDSGLP* |
| Ga0066674_101877642 | 3300005166 | Soil | MRVARLAIWIATAVFVVMLFYPLVMEILARVSARGESVLP* |
| Ga0066672_100937303 | 3300005167 | Soil | VKLARLGIWIATAVFVVMLFYPLVMEILARVAARGDSVLP* |
| Ga0066673_100540792 | 3300005175 | Soil | VKLARFGIWIATAVFVVMLFYPLVMEILARVAARGDSVLP* |
| Ga0066676_100400113 | 3300005186 | Soil | VRLARLAIWVATASFVFMLFYPLVMEILARVAARGESGLP* |
| Ga0066388_1001675902 | 3300005332 | Tropical Forest Soil | VKLARLAIWIATAGFVVMLFYPLVMEIIVRIGSRGDSGVP* |
| Ga0066388_1013683461 | 3300005332 | Tropical Forest Soil | APDVRLARLAIWIATAGFVFMLFYPLVMEIFIRFGTHADSGVP* |
| Ga0066388_1026818702 | 3300005332 | Tropical Forest Soil | MRLARLAIWIATAGFVFMLFYPLVMEIFARFGTHADTTLP* |
| Ga0066388_1051232981 | 3300005332 | Tropical Forest Soil | VRLARLAIWIATAGFVFMLFYPLVMEIFLRFGSHGDSGLP* |
| Ga0070703_100412552 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | VRLARLAIWIATAGFVFMLFYPLVMEIFARFGTHADSVLP* |
| Ga0070708_1011320432 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VKLARLGIWIATAVFVVMLFYPLVMEILARAAARGDSVLP* |
| Ga0066681_106478062 | 3300005451 | Soil | MRLARLAIWLATAAFVVMLFYPLVREILVRIGGRGDSGLP* |
| Ga0070697_1005461622 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VKLARLAIWIATAGFVFMLFYPLVMEIFVRFGTHADSVPP* |
| Ga0066701_103046412 | 3300005552 | Soil | VKLARLGIWIATAVFVVMLFYPLVMEILARSAARGDSVLP* |
| Ga0066670_100946481 | 3300005560 | Soil | VKLARFGIWIATAVFVVMLFYPLVMEILARAAARGDSVLP* |
| Ga0066693_102323912 | 3300005566 | Soil | VKLARLGIWIATGVFVVMLFYPLVMEILARAAARGDSVLP* |
| Ga0066705_105538892 | 3300005569 | Soil | LARFGIWIATAVFVVMLFYPLVMEILARVAARGDSVLP* |
| Ga0066903_1003252512 | 3300005764 | Tropical Forest Soil | VRLARLAIWIATAGFVFMLFYPLVMEIFVRFGPHADSGLP* |
| Ga0066903_1066979962 | 3300005764 | Tropical Forest Soil | VRLARLAIWIATAGFVFMLFYPLVMEIFIRFGTHADSGVP* |
| Ga0081455_104793412 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VRLARLAIWLATASFVFMLFYPLVMEILARIGSRADSGLP* |
| Ga0075417_100283162 | 3300006049 | Populus Rhizosphere | MKLARLAIWLATAGFIFMLFYPLVVELLMRFGSHADSGLP* |
| Ga0075417_100597153 | 3300006049 | Populus Rhizosphere | VRLARLAIWIATAVFVLMLFYPLVHEIVVRFGARGENPLP* |
| Ga0079222_104513701 | 3300006755 | Agricultural Soil | VKLARVAIWIATAAFVLMLFYPLVREILARLGVHGESGLP* |
| Ga0066658_106868012 | 3300006794 | Soil | AIWVATASFVFMLFYPLVMEILTRIAARGDSGLP* |
| Ga0066660_103633842 | 3300006800 | Soil | VKLARFAIWVATASFVFMLFYPLVMEILTRIAARGDSGLP* |
| Ga0079220_119159152 | 3300006806 | Agricultural Soil | VRLARAAIWIATAIFVLMLFYPLVTEMLARLAVRGDSGLP* |
| Ga0075428_10001084310 | 3300006844 | Populus Rhizosphere | VRLARLAIWFATAGFVFMLFYPLVMEIFVRFGTHADSGVP* |
| Ga0075421_1021382392 | 3300006845 | Populus Rhizosphere | VRLARLAIWIATAGFIFMLFYPLLMEIFARLGTHADSGLP* |
| Ga0075425_1007535522 | 3300006854 | Populus Rhizosphere | VRLARLAIWLATASFVFMLFYPLVVELLMRFGPQADSGLP* |
| Ga0075425_1026222672 | 3300006854 | Populus Rhizosphere | VRLARLAIWFATAGFVFMLFYPLVMEIFARFGTHADSVLP* |
| Ga0099791_100755872 | 3300007255 | Vadose Zone Soil | VRLARLAIWIATASFVVMLFYPLVMEILARVAARGDSVLP* |
| Ga0099791_102061261 | 3300007255 | Vadose Zone Soil | VKLARLGIWVATAVFVVMLFYPLVMEILARAAARGDSVLP* |
| Ga0099794_101381463 | 3300007265 | Vadose Zone Soil | VKLARLGIWVATAVFVVMLFYPLVMEILARVAARGDSVLP* |
| Ga0099794_101381464 | 3300007265 | Vadose Zone Soil | GAARVKLTRLGIWIATAVFVVMLFYPLVMEILARVAARGDSVLP* |
| Ga0099794_101627472 | 3300007265 | Vadose Zone Soil | VRLVRLAIWVATAGFVLMLFYPLVMELLTQLAARGDTGLP* |
| Ga0066710_1008743153 | 3300009012 | Grasslands Soil | VKLERLGIWIATAVFLVMPFYPLVMEIPARAAARGDSVLP |
| Ga0075418_104476173 | 3300009100 | Populus Rhizosphere | ARMKLARLAIWLATAGFIFMLFYPLVVELLMRFGSHADSGLP* |
| Ga0066709_1036870401 | 3300009137 | Grasslands Soil | VKLARLGIWIATAVFVVMLFYPLVMEILARAAARGDS |
| Ga0114129_107649892 | 3300009147 | Populus Rhizosphere | VKLARLAIWVATAGFVFMLFYPLVMEILARIAARGESGVP* |
| Ga0126374_111960041 | 3300009792 | Tropical Forest Soil | VRLARLAIWIATAGFVFMLFYPLVMEIFARFGTHADNGLP* |
| Ga0126380_110110301 | 3300010043 | Tropical Forest Soil | VRLARLAIWIATAGFVFMLFYPLVMEIIVRIGSRADSGLP* |
| Ga0126384_112671212 | 3300010046 | Tropical Forest Soil | VRLARLAIWIATASFVFMLFYPLVMEIIVRIGSRADSGLP* |
| Ga0126384_114415191 | 3300010046 | Tropical Forest Soil | VRLTRLAIWIATAGFVFMLFYPLVMEIFARFGNHADTGLP* |
| Ga0126384_120235002 | 3300010046 | Tropical Forest Soil | VRLARLAIWIATAGFVFMLFYPLVMEIVVRFGTHADTALP* |
| Ga0126382_122926221 | 3300010047 | Tropical Forest Soil | VRLARLAIWIATAGFVFMLFYPLVMEIIVRIASRSDSGVP* |
| Ga0127456_12560772 | 3300010140 | Grasslands Soil | MRVARLAIWVATAVFVVMLFYPLVMEILARVSARGESVLP* |
| Ga0134111_101191623 | 3300010329 | Grasslands Soil | VKLARFAIWVATASFVLMLFYPLVMEILARVSARGESVLP* |
| Ga0126376_103553212 | 3300010359 | Tropical Forest Soil | VRLARLAIWIATAGFIFMLFYPLVMEIFVRFGTHADSGLP* |
| Ga0126377_124102632 | 3300010362 | Tropical Forest Soil | VRLARLAIWIATAGFVFMLFYPLVMEIFVRFGTHADSGLP* |
| Ga0137388_113846302 | 3300012189 | Vadose Zone Soil | VKLARLGIWIATAVFVVMLFYPLVMEILARVSARGESVLP* |
| Ga0137364_103042612 | 3300012198 | Vadose Zone Soil | VRLVRLAIWIATAGFVVMLFYPLVREILARIAGQGESGLP* |
| Ga0137399_103538153 | 3300012203 | Vadose Zone Soil | VRLARLAIWIATASFVVMLFYPLVMEILARLSARGESVLP* |
| Ga0137387_100280656 | 3300012349 | Vadose Zone Soil | MRVARLAIWIATAVFVVMLFYPLVMEMLARVSARGESVLP* |
| Ga0137361_105300933 | 3300012362 | Vadose Zone Soil | VKLARLGIWVATAVFVVMLFYPLVMEILARSAARGDSVLP* |
| Ga0134052_13167393 | 3300012393 | Grasslands Soil | AVGAARVRLARLAIWVATASFVFMLFYPLVMEILARVAARGESGLP* |
| Ga0134060_11303871 | 3300012410 | Grasslands Soil | AARVRLARLAIWVATASFVFMLFYPLVMEILARVAARGESGLP* |
| Ga0137396_100975813 | 3300012918 | Vadose Zone Soil | VRLVRLAIWVATAGFVLMLFYPLVMELLTRLAARSDTGLP |
| Ga0137396_104517442 | 3300012918 | Vadose Zone Soil | VRLARLAIWIATATFVVMLFYPLVMEILARISARGESGLP* |
| Ga0137396_104517443 | 3300012918 | Vadose Zone Soil | RLARLAIWIATAGFVVMLFYPLVMEILARLSARGESVLP* |
| Ga0137419_106684122 | 3300012925 | Vadose Zone Soil | VRLARLAIWIATASFVVMLFYPLVMEILARISARGESGLP* |
| Ga0137416_118162771 | 3300012927 | Vadose Zone Soil | VKLARLGIWIATAVFVVMLFYPLVMEILARVAARGDSV |
| Ga0137410_104272713 | 3300012944 | Vadose Zone Soil | VRLVRLAIWVATAGFVLMLFYPLVMELLTRLAARSDTGLP* |
| Ga0126375_109447721 | 3300012948 | Tropical Forest Soil | VRLARLAIWIATASFVFMLFYPLVMEIIVRIGSRGDSGVP* |
| Ga0134076_100136726 | 3300012976 | Grasslands Soil | RLAIWIATAVFVVMLFYPLVMEMLARVSARGESVLP* |
| Ga0137418_107515762 | 3300015241 | Vadose Zone Soil | VRLARLAIWIATASFVVMLFYPLVMEILVRVAARGDS |
| Ga0132258_109364471 | 3300015371 | Arabidopsis Rhizosphere | VKLARLAIWIATAGFVVMLFYPLVRELVVRLSVRGESGFP* |
| Ga0132256_1028440492 | 3300015372 | Arabidopsis Rhizosphere | VRLARLAIWIATAGFVFMLFYPLVMEIFVRFAPHADSGLP* |
| Ga0134083_100104202 | 3300017659 | Grasslands Soil | VKLARFAIWVATASFVFMLFYPLVTEILARVAARGESGLP |
| Ga0134083_101317142 | 3300017659 | Grasslands Soil | MRVARLAIWIATAVFVVMLFYPLVMEMLARVSARGESVLP |
| Ga0066655_100035213 | 3300018431 | Grasslands Soil | MRVARLAIWIATAVFVVMLFYPLVMEILARVSARGESVLP |
| Ga0066655_100342405 | 3300018431 | Grasslands Soil | VKLARFAIWVATASFVLMLFYPLVMEILTRIAARGDSGLP |
| Ga0066662_104410211 | 3300018468 | Grasslands Soil | VKLARLGIWIATAVFVVMLFYPLVMEILARVAARGDSVLP |
| Ga0066669_123461991 | 3300018482 | Grasslands Soil | VKLARLGIWIATAVFVVMLFYPLVMEILARAAARGDSVLP |
| Ga0137408_12963613 | 3300019789 | Vadose Zone Soil | VRLARLAIWIATASFVVMLFYPLVMEILARVAARGDSVLP |
| Ga0179594_100875483 | 3300020170 | Vadose Zone Soil | VRLARLAIWIATASFVVMLFYPLVMEILARAAARGDSVLP |
| Ga0137417_11005503 | 3300024330 | Vadose Zone Soil | VKLARLGIWIATAVFVVMLFYPLVMEILARSAARGDSVLP |
| Ga0207665_100611281 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | HPVALGAAHVKLARLAIWIATAGFVFMLFYPLVMEIFVRFGTHADSVPP |
| Ga0209350_10490853 | 3300026277 | Grasslands Soil | GAARMRVARLAIWIATAVFVVMLFYPLVMEILARVSARGESVLP |
| Ga0209234_10804631 | 3300026295 | Grasslands Soil | VKLARLGIWIATAVFVVMLFYPLVMEILARAAARGDSV |
| Ga0209237_10262143 | 3300026297 | Grasslands Soil | VRLVRLAIWVATAGFVLMLFYPLVMELLVQFAARGDTGLP |
| Ga0209237_11106133 | 3300026297 | Grasslands Soil | MRFARLAIWIATAVFVVMLFYPLVMEILARVSARGESVLP |
| Ga0209237_11883871 | 3300026297 | Grasslands Soil | MRVARLAIWVATAVFVVMLFYPLVMEMLARVSARGESVLP |
| Ga0209027_10169603 | 3300026300 | Grasslands Soil | VKLARFGIWIATAVFVVMLFYPLVMEILARSAARGDSVLP |
| Ga0209238_10146081 | 3300026301 | Grasslands Soil | VKLARFGIWIATAVFVVMLFYPLVMEILARVAARGDSVLP |
| Ga0209470_10426612 | 3300026324 | Soil | VRLARLAIWVATASFVFMLFYPLVTEILARVAARGESGLP |
| Ga0209058_10357561 | 3300026536 | Soil | VRLARLAIWVATASFVFMLFYPLVMEILARVAARGESGLP |
| Ga0209376_10557783 | 3300026540 | Soil | VKLARFAIWVATASFVFMLFYPLVMEIVTRIAARGDSGLP |
| Ga0209805_10074081 | 3300026542 | Soil | ARVKLARFAIWVATASFVFMLFYPLVMEILTRIAARGDSGLP |
| Ga0209156_102287312 | 3300026547 | Soil | VKLARFAIWVATASFVFMLFYPLVMEILTRIAARG |
| Ga0209161_103067271 | 3300026548 | Soil | VKLARFAIWVATASFVLMLFYPLVMEILTRIAARGDSGL |
| Ga0209577_101229193 | 3300026552 | Soil | VKLARFAIWVATASFVFMLFYPLVMEILTRIAARGDSGRP |
| Ga0209875_10260542 | 3300027209 | Groundwater Sand | VRLARLAIWIATASFIVMLFYPLVMEILARVTSRGGSGLP |
| Ga0209388_10891462 | 3300027655 | Vadose Zone Soil | VKLARLGIWVATAVFVVMLFYPLVMEILARAAARGDSVLP |
| Ga0209588_11154932 | 3300027671 | Vadose Zone Soil | VKLARLGIWVATAVFVVMLFYPLVMEILARVAARGDSVLP |
| Ga0209073_100874041 | 3300027765 | Agricultural Soil | VKLARVAIWIATAAFVLMLFYPLVREILARLGVHGESGLP |
| Ga0209177_100104823 | 3300027775 | Agricultural Soil | VKLARVAIWIATAAFVVMLFYPLVREILARLGLHGESGLP |
| Ga0209814_100090491 | 3300027873 | Populus Rhizosphere | MKLARLAIWLATAGFIFMLFYPLVVELLMRFGSHADSGLP |
| Ga0209814_100477191 | 3300027873 | Populus Rhizosphere | VRLARLAIWIATAVFVLMLFYPLVHEIVVRFGARGENPLP |
| Ga0209481_102572602 | 3300027880 | Populus Rhizosphere | VRLARLAIWFATAGFVFMLFYPLVMEIFVRFGTHADSGVP |
| Ga0310813_104601072 | 3300031716 | Soil | VKLARLAIWIATAGFVVMLFYPLVRELVVRLSVRGESGFP |
| Ga0307469_115322931 | 3300031720 | Hardwood Forest Soil | VKLVRLAIWIATAGFVFMLFYPLVMEIFARFGTHADSVLP |
| Ga0307471_1009985592 | 3300032180 | Hardwood Forest Soil | VRLVRLVIWLATAGFVFLLFYPLVMEALLRLRSRGDGSFP |
| ⦗Top⦘ |