Metagenome / Metatranscriptome Family F097094

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F097094
Family Type	Metagenome / Metatranscriptome
Number of Sequences	104
Average Sequence Length	40 residues
Representative Sequence	VRLARLAIWIATASFVVMLFYPLVMEILARVAARGDSVLP
Number of Associated Samples	85
Number of Associated Scaffolds	102

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	83.65 %
% of genes near scaffold ends (potentially truncated)	20.19 %
% of genes from short scaffolds (< 2000 bps)	75.00 %
Associated GOLD sequencing projects	77
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.54

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (95.192 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (21.154 % of family members)
Environment Ontology (ENVO)	Unclassified (37.500 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (56.731 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 54.41% β-sheet: 0.00% Coil/Unstructured: 45.59%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.54
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.54
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 102 Family Scaffolds
PF13419	HAD_2	55.88
PF07690	MFS_1	12.75
PF13242	Hydrolase_like	8.82
PF00076	RRM_1	7.84
PF13893	RRM_5	0.98
PF00857	Isochorismatase	0.98
PF00982	Glyco_transf_20	0.98
PF00578	AhpC-TSA	0.98
PF13490	zf-HC2	0.98
PF02518	HATPase_c	0.98

COG ID	Name	Functional Category	% Frequency in 102 Family Scaffolds
COG0380	Trehalose-6-phosphate synthase, GT20 family	Carbohydrate transport and metabolism [G]	0.98
COG1335	Nicotinamidase-related amidase	Coenzyme transport and metabolism [H]	0.98
COG1535	Isochorismate hydrolase	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.98

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	95.19 %
Unclassified	root	N/A	4.81 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	95.19 %
Unclassified	root	N/A	4.81 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	95.19 %
Unclassified	root	N/A	4.81 %

Name	Rank	Taxonomy	Distribution
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	44.23 %
Unclassified	root	N/A	4.81 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	3.85 %

Name	Rank	Taxonomy	Distribution
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	44.23 %
Unclassified	root	N/A	4.81 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.96 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.96 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	44.23 %
Unclassified	root	N/A	4.81 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.96 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.96 %

Name	Rank	Taxonomy	Distribution
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	41.35 %
Unclassified	root	N/A	4.81 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.96 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.96 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	41.35 %
Unclassified	root	N/A	4.81 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.96 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.96 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300002908\|JGI25382J43887_10039805	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	2555	Open in IMG/M
3300003203\|JGI25406J46586_10030887	All Organisms → cellular organisms → Bacteria	2011	Open in IMG/M
3300005166\|Ga0066674_10076224	All Organisms → cellular organisms → Bacteria	1540	Open in IMG/M
3300005166\|Ga0066674_10187764	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	982	Open in IMG/M
3300005167\|Ga0066672_10093730	All Organisms → cellular organisms → Bacteria	1819	Open in IMG/M
3300005175\|Ga0066673_10054079	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	2035	Open in IMG/M
3300005186\|Ga0066676_10040011	All Organisms → cellular organisms → Bacteria	2609	Open in IMG/M
3300005332\|Ga0066388_100167590	All Organisms → cellular organisms → Bacteria	2793	Open in IMG/M
3300005332\|Ga0066388_101368346	All Organisms → cellular organisms → Bacteria	1227	Open in IMG/M
3300005332\|Ga0066388_102681870	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	909	Open in IMG/M
3300005332\|Ga0066388_105123298	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	665	Open in IMG/M
3300005406\|Ga0070703_10041255	All Organisms → cellular organisms → Bacteria	1438	Open in IMG/M
3300005445\|Ga0070708_101132043	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	733	Open in IMG/M
3300005451\|Ga0066681_10647806	All Organisms → cellular organisms → Bacteria	647	Open in IMG/M
3300005536\|Ga0070697_100546162	All Organisms → cellular organisms → Bacteria → Proteobacteria	1016	Open in IMG/M
3300005552\|Ga0066701_10304641	All Organisms → cellular organisms → Bacteria	988	Open in IMG/M
3300005560\|Ga0066670_10094648	All Organisms → cellular organisms → Bacteria	1660	Open in IMG/M
3300005566\|Ga0066693_10232391	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	726	Open in IMG/M
3300005569\|Ga0066705_10553889	Not Available	712	Open in IMG/M
3300005764\|Ga0066903_100325251	All Organisms → cellular organisms → Bacteria	2460	Open in IMG/M
3300005764\|Ga0066903_106697996	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	599	Open in IMG/M
3300005937\|Ga0081455_10479341	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	842	Open in IMG/M
3300006049\|Ga0075417_10028316	All Organisms → cellular organisms → Bacteria	2301	Open in IMG/M
3300006049\|Ga0075417_10059715	All Organisms → cellular organisms → Bacteria	1666	Open in IMG/M
3300006755\|Ga0079222_10451370	All Organisms → cellular organisms → Bacteria	919	Open in IMG/M
3300006794\|Ga0066658_10686801	Not Available	564	Open in IMG/M
3300006800\|Ga0066660_10363384	All Organisms → cellular organisms → Bacteria	1181	Open in IMG/M
3300006806\|Ga0079220_11915915	All Organisms → cellular organisms → Bacteria	526	Open in IMG/M
3300006844\|Ga0075428_100010843	All Organisms → cellular organisms → Bacteria	10129	Open in IMG/M
3300006845\|Ga0075421_102138239	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	592	Open in IMG/M
3300006854\|Ga0075425_100753552	All Organisms → cellular organisms → Bacteria	1117	Open in IMG/M
3300006854\|Ga0075425_102622267	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	557	Open in IMG/M
3300007255\|Ga0099791_10075587	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1531	Open in IMG/M
3300007255\|Ga0099791_10206126	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	927	Open in IMG/M
3300007265\|Ga0099794_10138146	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1233	Open in IMG/M
3300007265\|Ga0099794_10138146	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1233	Open in IMG/M
3300007265\|Ga0099794_10162747	All Organisms → cellular organisms → Bacteria	1135	Open in IMG/M
3300009012\|Ga0066710_100874315	All Organisms → cellular organisms → Bacteria	1382	Open in IMG/M
3300009100\|Ga0075418_10447617	Not Available	1384	Open in IMG/M
3300009137\|Ga0066709_103687040	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	556	Open in IMG/M
3300009147\|Ga0114129_10764989	All Organisms → cellular organisms → Bacteria	1235	Open in IMG/M
3300009792\|Ga0126374_11196004	Not Available	608	Open in IMG/M
3300010043\|Ga0126380_11011030	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	701	Open in IMG/M
3300010046\|Ga0126384_11267121	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	682	Open in IMG/M
3300010046\|Ga0126384_11441519	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	643	Open in IMG/M
3300010046\|Ga0126384_12023500	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	551	Open in IMG/M
3300010047\|Ga0126382_12292622	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	522	Open in IMG/M
3300010140\|Ga0127456_1256077	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	544	Open in IMG/M
3300010329\|Ga0134111_10119162	All Organisms → cellular organisms → Bacteria	1025	Open in IMG/M
3300010359\|Ga0126376_10355321	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1301	Open in IMG/M
3300010362\|Ga0126377_12410263	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	602	Open in IMG/M
3300012189\|Ga0137388_11384630	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	642	Open in IMG/M
3300012198\|Ga0137364_10304261	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	1184	Open in IMG/M
3300012203\|Ga0137399_10353815	All Organisms → cellular organisms → Bacteria	1220	Open in IMG/M
3300012349\|Ga0137387_10028065	All Organisms → cellular organisms → Bacteria	3602	Open in IMG/M
3300012362\|Ga0137361_10530093	All Organisms → cellular organisms → Bacteria	1081	Open in IMG/M
3300012393\|Ga0134052_1316739	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	531	Open in IMG/M
3300012410\|Ga0134060_1130387	Not Available	575	Open in IMG/M
3300012918\|Ga0137396_10097581	All Organisms → cellular organisms → Bacteria	2093	Open in IMG/M
3300012918\|Ga0137396_10451744	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	953	Open in IMG/M
3300012918\|Ga0137396_10451744	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	953	Open in IMG/M
3300012925\|Ga0137419_10668412	All Organisms → cellular organisms → Bacteria	840	Open in IMG/M
3300012927\|Ga0137416_11816277	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	557	Open in IMG/M
3300012944\|Ga0137410_10427271	All Organisms → cellular organisms → Bacteria	1072	Open in IMG/M
3300012948\|Ga0126375_10944772	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	697	Open in IMG/M
3300012976\|Ga0134076_10013672	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	2805	Open in IMG/M
3300015241\|Ga0137418_10751576	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	739	Open in IMG/M
3300015371\|Ga0132258_10936447	All Organisms → cellular organisms → Bacteria	2188	Open in IMG/M
3300015372\|Ga0132256_102844049	All Organisms → cellular organisms → Bacteria	582	Open in IMG/M
3300017659\|Ga0134083_10010420	All Organisms → cellular organisms → Bacteria	3106	Open in IMG/M
3300017659\|Ga0134083_10131714	All Organisms → cellular organisms → Bacteria	1003	Open in IMG/M
3300018431\|Ga0066655_10003521	All Organisms → cellular organisms → Bacteria	6124	Open in IMG/M
3300018431\|Ga0066655_10034240	All Organisms → cellular organisms → Bacteria	2503	Open in IMG/M
3300018468\|Ga0066662_10441021	All Organisms → cellular organisms → Bacteria	1162	Open in IMG/M
3300018482\|Ga0066669_12346199	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	510	Open in IMG/M
3300019789\|Ga0137408_1296361	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1299	Open in IMG/M
3300020170\|Ga0179594_10087548	All Organisms → cellular organisms → Bacteria	1106	Open in IMG/M
3300024330\|Ga0137417_1100550	All Organisms → cellular organisms → Bacteria	1160	Open in IMG/M
3300025939\|Ga0207665_10061128	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2553	Open in IMG/M
3300026277\|Ga0209350_1049085	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	1226	Open in IMG/M
3300026295\|Ga0209234_1080463	All Organisms → cellular organisms → Bacteria	1237	Open in IMG/M
3300026297\|Ga0209237_1026214	All Organisms → cellular organisms → Bacteria	3249	Open in IMG/M
3300026297\|Ga0209237_1110613	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1182	Open in IMG/M
3300026297\|Ga0209237_1188387	All Organisms → cellular organisms → Bacteria	688	Open in IMG/M
3300026300\|Ga0209027_1016960	All Organisms → cellular organisms → Bacteria	2760	Open in IMG/M
3300026301\|Ga0209238_1014608	All Organisms → cellular organisms → Bacteria	3040	Open in IMG/M
3300026324\|Ga0209470_1042661	All Organisms → cellular organisms → Bacteria	2234	Open in IMG/M
3300026536\|Ga0209058_1035756	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	2997	Open in IMG/M
3300026540\|Ga0209376_1055778	All Organisms → cellular organisms → Bacteria	2238	Open in IMG/M
3300026542\|Ga0209805_1007408	All Organisms → cellular organisms → Bacteria	6011	Open in IMG/M
3300026547\|Ga0209156_10228731	All Organisms → cellular organisms → Bacteria	875	Open in IMG/M
3300026548\|Ga0209161_10306727	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	759	Open in IMG/M
3300026552\|Ga0209577_10122919	All Organisms → cellular organisms → Bacteria	2076	Open in IMG/M
3300027209\|Ga0209875_1026054	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	696	Open in IMG/M
3300027655\|Ga0209388_1089146	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	886	Open in IMG/M
3300027671\|Ga0209588_1115493	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	861	Open in IMG/M
3300027765\|Ga0209073_10087404	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1083	Open in IMG/M
3300027775\|Ga0209177_10010482	All Organisms → cellular organisms → Bacteria	2061	Open in IMG/M
3300027873\|Ga0209814_10009049	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	3900	Open in IMG/M
3300027873\|Ga0209814_10047719	All Organisms → cellular organisms → Bacteria	1786	Open in IMG/M
3300027880\|Ga0209481_10257260	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	880	Open in IMG/M
3300031716\|Ga0310813_10460107	All Organisms → cellular organisms → Bacteria → Proteobacteria	1105	Open in IMG/M
3300031720\|Ga0307469_11532293	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	639	Open in IMG/M
3300032180\|Ga0307471_100998559	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1004	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	85.58%
Host-Associated	Host-Associated	14.42%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	85.58%
Plants	Host-Associated → Plants	14.42%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	85.58%
Rhizosphere	Host-Associated → Plants → Rhizosphere	11.54%
Rhizoplane	Host-Associated → Plants → Rhizoplane	2.88%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	74.04%
Loam	Environmental → Terrestrial → Soil → Loam	10.58%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	10.58%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.92%
Sand	Environmental → Terrestrial → Soil → Sand	0.96%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.96%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.96%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	37.50%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	30.77%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	10.58%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	5.77%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	3.85%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	3.85%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	1.92%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.92%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.96%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.96%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.96%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.96%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	21.15%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	17.31%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	13.46%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	10.58%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	8.65%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	6.73%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	5.77%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	3.85%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.85%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.92%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	1.92%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.96%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.96%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	0.96%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.96%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.96%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300002908	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm	Environmental	Open in IMG/M
3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Host-Associated	Open in IMG/M
3300005166	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123	Environmental	Open in IMG/M
3300005167	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121	Environmental	Open in IMG/M
3300005175	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122	Environmental	Open in IMG/M
3300005186	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Environmental	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005451	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130	Environmental	Open in IMG/M
3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Environmental	Open in IMG/M
3300005552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150	Environmental	Open in IMG/M
3300005560	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119	Environmental	Open in IMG/M
3300005566	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142	Environmental	Open in IMG/M
3300005569	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006794	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107	Environmental	Open in IMG/M
3300006800	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109	Environmental	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300007255	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1	Environmental	Open in IMG/M
3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010140	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010329	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012349	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012393	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012410	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012918	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG	Environmental	Open in IMG/M
3300012925	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012927	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012976	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG	Environmental	Open in IMG/M
3300015241	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300017659	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG	Environmental	Open in IMG/M
3300018431	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300019789	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300020170	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300024330	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300026277	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes)	Environmental	Open in IMG/M
3300026295	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)	Environmental	Open in IMG/M
3300026297	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)	Environmental	Open in IMG/M
3300026300	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)	Environmental	Open in IMG/M
3300026301	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)	Environmental	Open in IMG/M
3300026324	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)	Environmental	Open in IMG/M
3300026536	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)	Environmental	Open in IMG/M
3300026540	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)	Environmental	Open in IMG/M
3300026542	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)	Environmental	Open in IMG/M
3300026547	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)	Environmental	Open in IMG/M
3300026548	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)	Environmental	Open in IMG/M
3300026552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)	Environmental	Open in IMG/M
3300027209	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 (SPAdes)	Environmental	Open in IMG/M
3300027655	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes)	Environmental	Open in IMG/M
3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)	Environmental	Open in IMG/M
3300027765	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)	Environmental	Open in IMG/M
3300027775	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)	Environmental	Open in IMG/M
3300027873	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027880	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)	Host-Associated	Open in IMG/M
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI25382J43887_100398053	3300002908	Grasslands Soil	MRVARLAIWVATAVFVVMLFYPLVMEMLARVSARGESVLP*
JGI25406J46586_100308872	3300003203	Tabebuia Heterophylla Rhizosphere	MKLARLAIWLATAGFIVMLFYPLVVELLMRFGSHGDSGLP*
Ga0066674_100762242	3300005166	Soil	VKLARFAIWVATASFVLMLFYPLVMEILTRIAARGDSGLP*
Ga0066674_101877642	3300005166	Soil	MRVARLAIWIATAVFVVMLFYPLVMEILARVSARGESVLP*
Ga0066672_100937303	3300005167	Soil	VKLARLGIWIATAVFVVMLFYPLVMEILARVAARGDSVLP*
Ga0066673_100540792	3300005175	Soil	VKLARFGIWIATAVFVVMLFYPLVMEILARVAARGDSVLP*
Ga0066676_100400113	3300005186	Soil	VRLARLAIWVATASFVFMLFYPLVMEILARVAARGESGLP*
Ga0066388_1001675902	3300005332	Tropical Forest Soil	VKLARLAIWIATAGFVVMLFYPLVMEIIVRIGSRGDSGVP*
Ga0066388_1013683461	3300005332	Tropical Forest Soil	APDVRLARLAIWIATAGFVFMLFYPLVMEIFIRFGTHADSGVP*
Ga0066388_1026818702	3300005332	Tropical Forest Soil	MRLARLAIWIATAGFVFMLFYPLVMEIFARFGTHADTTLP*
Ga0066388_1051232981	3300005332	Tropical Forest Soil	VRLARLAIWIATAGFVFMLFYPLVMEIFLRFGSHGDSGLP*
Ga0070703_100412552	3300005406	Corn, Switchgrass And Miscanthus Rhizosphere	VRLARLAIWIATAGFVFMLFYPLVMEIFARFGTHADSVLP*
Ga0070708_1011320432	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	VKLARLGIWIATAVFVVMLFYPLVMEILARAAARGDSVLP*
Ga0066681_106478062	3300005451	Soil	MRLARLAIWLATAAFVVMLFYPLVREILVRIGGRGDSGLP*
Ga0070697_1005461622	3300005536	Corn, Switchgrass And Miscanthus Rhizosphere	VKLARLAIWIATAGFVFMLFYPLVMEIFVRFGTHADSVPP*
Ga0066701_103046412	3300005552	Soil	VKLARLGIWIATAVFVVMLFYPLVMEILARSAARGDSVLP*
Ga0066670_100946481	3300005560	Soil	VKLARFGIWIATAVFVVMLFYPLVMEILARAAARGDSVLP*
Ga0066693_102323912	3300005566	Soil	VKLARLGIWIATGVFVVMLFYPLVMEILARAAARGDSVLP*
Ga0066705_105538892	3300005569	Soil	LARFGIWIATAVFVVMLFYPLVMEILARVAARGDSVLP*
Ga0066903_1003252512	3300005764	Tropical Forest Soil	VRLARLAIWIATAGFVFMLFYPLVMEIFVRFGPHADSGLP*
Ga0066903_1066979962	3300005764	Tropical Forest Soil	VRLARLAIWIATAGFVFMLFYPLVMEIFIRFGTHADSGVP*
Ga0081455_104793412	3300005937	Tabebuia Heterophylla Rhizosphere	VRLARLAIWLATASFVFMLFYPLVMEILARIGSRADSGLP*
Ga0075417_100283162	3300006049	Populus Rhizosphere	MKLARLAIWLATAGFIFMLFYPLVVELLMRFGSHADSGLP*
Ga0075417_100597153	3300006049	Populus Rhizosphere	VRLARLAIWIATAVFVLMLFYPLVHEIVVRFGARGENPLP*
Ga0079222_104513701	3300006755	Agricultural Soil	VKLARVAIWIATAAFVLMLFYPLVREILARLGVHGESGLP*
Ga0066658_106868012	3300006794	Soil	AIWVATASFVFMLFYPLVMEILTRIAARGDSGLP*
Ga0066660_103633842	3300006800	Soil	VKLARFAIWVATASFVFMLFYPLVMEILTRIAARGDSGLP*
Ga0079220_119159152	3300006806	Agricultural Soil	VRLARAAIWIATAIFVLMLFYPLVTEMLARLAVRGDSGLP*
Ga0075428_10001084310	3300006844	Populus Rhizosphere	VRLARLAIWFATAGFVFMLFYPLVMEIFVRFGTHADSGVP*
Ga0075421_1021382392	3300006845	Populus Rhizosphere	VRLARLAIWIATAGFIFMLFYPLLMEIFARLGTHADSGLP*
Ga0075425_1007535522	3300006854	Populus Rhizosphere	VRLARLAIWLATASFVFMLFYPLVVELLMRFGPQADSGLP*
Ga0075425_1026222672	3300006854	Populus Rhizosphere	VRLARLAIWFATAGFVFMLFYPLVMEIFARFGTHADSVLP*
Ga0099791_100755872	3300007255	Vadose Zone Soil	VRLARLAIWIATASFVVMLFYPLVMEILARVAARGDSVLP*
Ga0099791_102061261	3300007255	Vadose Zone Soil	VKLARLGIWVATAVFVVMLFYPLVMEILARAAARGDSVLP*
Ga0099794_101381463	3300007265	Vadose Zone Soil	VKLARLGIWVATAVFVVMLFYPLVMEILARVAARGDSVLP*
Ga0099794_101381464	3300007265	Vadose Zone Soil	GAARVKLTRLGIWIATAVFVVMLFYPLVMEILARVAARGDSVLP*
Ga0099794_101627472	3300007265	Vadose Zone Soil	VRLVRLAIWVATAGFVLMLFYPLVMELLTQLAARGDTGLP*
Ga0066710_1008743153	3300009012	Grasslands Soil	VKLERLGIWIATAVFLVMPFYPLVMEIPARAAARGDSVLP
Ga0075418_104476173	3300009100	Populus Rhizosphere	ARMKLARLAIWLATAGFIFMLFYPLVVELLMRFGSHADSGLP*
Ga0066709_1036870401	3300009137	Grasslands Soil	VKLARLGIWIATAVFVVMLFYPLVMEILARAAARGDS
Ga0114129_107649892	3300009147	Populus Rhizosphere	VKLARLAIWVATAGFVFMLFYPLVMEILARIAARGESGVP*
Ga0126374_111960041	3300009792	Tropical Forest Soil	VRLARLAIWIATAGFVFMLFYPLVMEIFARFGTHADNGLP*
Ga0126380_110110301	3300010043	Tropical Forest Soil	VRLARLAIWIATAGFVFMLFYPLVMEIIVRIGSRADSGLP*
Ga0126384_112671212	3300010046	Tropical Forest Soil	VRLARLAIWIATASFVFMLFYPLVMEIIVRIGSRADSGLP*
Ga0126384_114415191	3300010046	Tropical Forest Soil	VRLTRLAIWIATAGFVFMLFYPLVMEIFARFGNHADTGLP*
Ga0126384_120235002	3300010046	Tropical Forest Soil	VRLARLAIWIATAGFVFMLFYPLVMEIVVRFGTHADTALP*
Ga0126382_122926221	3300010047	Tropical Forest Soil	VRLARLAIWIATAGFVFMLFYPLVMEIIVRIASRSDSGVP*
Ga0127456_12560772	3300010140	Grasslands Soil	MRVARLAIWVATAVFVVMLFYPLVMEILARVSARGESVLP*
Ga0134111_101191623	3300010329	Grasslands Soil	VKLARFAIWVATASFVLMLFYPLVMEILARVSARGESVLP*
Ga0126376_103553212	3300010359	Tropical Forest Soil	VRLARLAIWIATAGFIFMLFYPLVMEIFVRFGTHADSGLP*
Ga0126377_124102632	3300010362	Tropical Forest Soil	VRLARLAIWIATAGFVFMLFYPLVMEIFVRFGTHADSGLP*
Ga0137388_113846302	3300012189	Vadose Zone Soil	VKLARLGIWIATAVFVVMLFYPLVMEILARVSARGESVLP*
Ga0137364_103042612	3300012198	Vadose Zone Soil	VRLVRLAIWIATAGFVVMLFYPLVREILARIAGQGESGLP*
Ga0137399_103538153	3300012203	Vadose Zone Soil	VRLARLAIWIATASFVVMLFYPLVMEILARLSARGESVLP*
Ga0137387_100280656	3300012349	Vadose Zone Soil	MRVARLAIWIATAVFVVMLFYPLVMEMLARVSARGESVLP*
Ga0137361_105300933	3300012362	Vadose Zone Soil	VKLARLGIWVATAVFVVMLFYPLVMEILARSAARGDSVLP*
Ga0134052_13167393	3300012393	Grasslands Soil	AVGAARVRLARLAIWVATASFVFMLFYPLVMEILARVAARGESGLP*
Ga0134060_11303871	3300012410	Grasslands Soil	AARVRLARLAIWVATASFVFMLFYPLVMEILARVAARGESGLP*
Ga0137396_100975813	3300012918	Vadose Zone Soil	VRLVRLAIWVATAGFVLMLFYPLVMELLTRLAARSDTGLP
Ga0137396_104517442	3300012918	Vadose Zone Soil	VRLARLAIWIATATFVVMLFYPLVMEILARISARGESGLP*
Ga0137396_104517443	3300012918	Vadose Zone Soil	RLARLAIWIATAGFVVMLFYPLVMEILARLSARGESVLP*
Ga0137419_106684122	3300012925	Vadose Zone Soil	VRLARLAIWIATASFVVMLFYPLVMEILARISARGESGLP*
Ga0137416_118162771	3300012927	Vadose Zone Soil	VKLARLGIWIATAVFVVMLFYPLVMEILARVAARGDSV
Ga0137410_104272713	3300012944	Vadose Zone Soil	VRLVRLAIWVATAGFVLMLFYPLVMELLTRLAARSDTGLP*
Ga0126375_109447721	3300012948	Tropical Forest Soil	VRLARLAIWIATASFVFMLFYPLVMEIIVRIGSRGDSGVP*
Ga0134076_100136726	3300012976	Grasslands Soil	RLAIWIATAVFVVMLFYPLVMEMLARVSARGESVLP*
Ga0137418_107515762	3300015241	Vadose Zone Soil	VRLARLAIWIATASFVVMLFYPLVMEILVRVAARGDS
Ga0132258_109364471	3300015371	Arabidopsis Rhizosphere	VKLARLAIWIATAGFVVMLFYPLVRELVVRLSVRGESGFP*
Ga0132256_1028440492	3300015372	Arabidopsis Rhizosphere	VRLARLAIWIATAGFVFMLFYPLVMEIFVRFAPHADSGLP*
Ga0134083_100104202	3300017659	Grasslands Soil	VKLARFAIWVATASFVFMLFYPLVTEILARVAARGESGLP
Ga0134083_101317142	3300017659	Grasslands Soil	MRVARLAIWIATAVFVVMLFYPLVMEMLARVSARGESVLP
Ga0066655_100035213	3300018431	Grasslands Soil	MRVARLAIWIATAVFVVMLFYPLVMEILARVSARGESVLP
Ga0066655_100342405	3300018431	Grasslands Soil	VKLARFAIWVATASFVLMLFYPLVMEILTRIAARGDSGLP
Ga0066662_104410211	3300018468	Grasslands Soil	VKLARLGIWIATAVFVVMLFYPLVMEILARVAARGDSVLP
Ga0066669_123461991	3300018482	Grasslands Soil	VKLARLGIWIATAVFVVMLFYPLVMEILARAAARGDSVLP
Ga0137408_12963613	3300019789	Vadose Zone Soil	VRLARLAIWIATASFVVMLFYPLVMEILARVAARGDSVLP
Ga0179594_100875483	3300020170	Vadose Zone Soil	VRLARLAIWIATASFVVMLFYPLVMEILARAAARGDSVLP
Ga0137417_11005503	3300024330	Vadose Zone Soil	VKLARLGIWIATAVFVVMLFYPLVMEILARSAARGDSVLP
Ga0207665_100611281	3300025939	Corn, Switchgrass And Miscanthus Rhizosphere	HPVALGAAHVKLARLAIWIATAGFVFMLFYPLVMEIFVRFGTHADSVPP
Ga0209350_10490853	3300026277	Grasslands Soil	GAARMRVARLAIWIATAVFVVMLFYPLVMEILARVSARGESVLP
Ga0209234_10804631	3300026295	Grasslands Soil	VKLARLGIWIATAVFVVMLFYPLVMEILARAAARGDSV
Ga0209237_10262143	3300026297	Grasslands Soil	VRLVRLAIWVATAGFVLMLFYPLVMELLVQFAARGDTGLP
Ga0209237_11106133	3300026297	Grasslands Soil	MRFARLAIWIATAVFVVMLFYPLVMEILARVSARGESVLP
Ga0209237_11883871	3300026297	Grasslands Soil	MRVARLAIWVATAVFVVMLFYPLVMEMLARVSARGESVLP
Ga0209027_10169603	3300026300	Grasslands Soil	VKLARFGIWIATAVFVVMLFYPLVMEILARSAARGDSVLP
Ga0209238_10146081	3300026301	Grasslands Soil	VKLARFGIWIATAVFVVMLFYPLVMEILARVAARGDSVLP
Ga0209470_10426612	3300026324	Soil	VRLARLAIWVATASFVFMLFYPLVTEILARVAARGESGLP
Ga0209058_10357561	3300026536	Soil	VRLARLAIWVATASFVFMLFYPLVMEILARVAARGESGLP
Ga0209376_10557783	3300026540	Soil	VKLARFAIWVATASFVFMLFYPLVMEIVTRIAARGDSGLP
Ga0209805_10074081	3300026542	Soil	ARVKLARFAIWVATASFVFMLFYPLVMEILTRIAARGDSGLP
Ga0209156_102287312	3300026547	Soil	VKLARFAIWVATASFVFMLFYPLVMEILTRIAARG
Ga0209161_103067271	3300026548	Soil	VKLARFAIWVATASFVLMLFYPLVMEILTRIAARGDSGL
Ga0209577_101229193	3300026552	Soil	VKLARFAIWVATASFVFMLFYPLVMEILTRIAARGDSGRP
Ga0209875_10260542	3300027209	Groundwater Sand	VRLARLAIWIATASFIVMLFYPLVMEILARVTSRGGSGLP
Ga0209388_10891462	3300027655	Vadose Zone Soil	VKLARLGIWVATAVFVVMLFYPLVMEILARAAARGDSVLP
Ga0209588_11154932	3300027671	Vadose Zone Soil	VKLARLGIWVATAVFVVMLFYPLVMEILARVAARGDSVLP
Ga0209073_100874041	3300027765	Agricultural Soil	VKLARVAIWIATAAFVLMLFYPLVREILARLGVHGESGLP
Ga0209177_100104823	3300027775	Agricultural Soil	VKLARVAIWIATAAFVVMLFYPLVREILARLGLHGESGLP
Ga0209814_100090491	3300027873	Populus Rhizosphere	MKLARLAIWLATAGFIFMLFYPLVVELLMRFGSHADSGLP
Ga0209814_100477191	3300027873	Populus Rhizosphere	VRLARLAIWIATAVFVLMLFYPLVHEIVVRFGARGENPLP
Ga0209481_102572602	3300027880	Populus Rhizosphere	VRLARLAIWFATAGFVFMLFYPLVMEIFVRFGTHADSGVP
Ga0310813_104601072	3300031716	Soil	VKLARLAIWIATAGFVVMLFYPLVRELVVRLSVRGESGFP
Ga0307469_115322931	3300031720	Hardwood Forest Soil	VKLVRLAIWIATAGFVFMLFYPLVMEIFARFGTHADSVLP
Ga0307471_1009985592	3300032180	Hardwood Forest Soil	VRLVRLVIWLATAGFVFLLFYPLVMEALLRLRSRGDGSFP

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F097094

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences