| Basic Information | |
|---|---|
| Family ID | F097092 |
| Family Type | Metagenome |
| Number of Sequences | 104 |
| Average Sequence Length | 44 residues |
| Representative Sequence | RRGVAYRELADRHPRLDLWLAWRRGGLSAAARDFVAHARRSA |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.04 % |
| % of genes from short scaffolds (< 2000 bps) | 95.19 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (52.885 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil (10.577 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.731 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.192 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.29% β-sheet: 0.00% Coil/Unstructured: 65.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF01790 | LGT | 77.88 |
| PF03466 | LysR_substrate | 11.54 |
| PF03547 | Mem_trans | 4.81 |
| PF13098 | Thioredoxin_2 | 2.88 |
| PF13183 | Fer4_8 | 1.92 |
| PF02754 | CCG | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0682 | Prolipoprotein diacylglyceryltransferase | Cell wall/membrane/envelope biogenesis [M] | 77.88 |
| COG0679 | Predicted permease, AEC (auxin efflux carrier) family | General function prediction only [R] | 4.81 |
| COG0247 | Fe-S cluster-containing oxidoreductase, includes glycolate oxidase subunit GlcF | Energy production and conversion [C] | 0.96 |
| COG2048 | Heterodisulfide reductase, subunit B | Energy production and conversion [C] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 52.88 % |
| All Organisms | root | All Organisms | 47.12 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001305|C688J14111_10258361 | Not Available | 547 | Open in IMG/M |
| 3300001686|C688J18823_10791988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 602 | Open in IMG/M |
| 3300003996|Ga0055467_10094444 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 842 | Open in IMG/M |
| 3300004024|Ga0055436_10147856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 715 | Open in IMG/M |
| 3300004153|Ga0063455_100845057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 641 | Open in IMG/M |
| 3300004157|Ga0062590_101118627 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300004157|Ga0062590_101952650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 607 | Open in IMG/M |
| 3300004480|Ga0062592_101428254 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300004643|Ga0062591_102935557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 506 | Open in IMG/M |
| 3300005171|Ga0066677_10076861 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1727 | Open in IMG/M |
| 3300005178|Ga0066688_10941325 | Not Available | 530 | Open in IMG/M |
| 3300005328|Ga0070676_10426168 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 928 | Open in IMG/M |
| 3300005334|Ga0068869_101624918 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 576 | Open in IMG/M |
| 3300005343|Ga0070687_100242246 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1116 | Open in IMG/M |
| 3300005345|Ga0070692_10523029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 773 | Open in IMG/M |
| 3300005441|Ga0070700_101603065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 556 | Open in IMG/M |
| 3300005444|Ga0070694_101076916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 670 | Open in IMG/M |
| 3300005549|Ga0070704_101587674 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300005577|Ga0068857_100970581 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300005713|Ga0066905_101516001 | Not Available | 611 | Open in IMG/M |
| 3300006755|Ga0079222_10530985 | Not Available | 873 | Open in IMG/M |
| 3300006847|Ga0075431_100563205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1126 | Open in IMG/M |
| 3300006852|Ga0075433_10229768 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1647 | Open in IMG/M |
| 3300006876|Ga0079217_10040197 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1815 | Open in IMG/M |
| 3300006876|Ga0079217_11621818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 517 | Open in IMG/M |
| 3300006876|Ga0079217_11634674 | Not Available | 516 | Open in IMG/M |
| 3300006894|Ga0079215_10685608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 689 | Open in IMG/M |
| 3300006904|Ga0075424_101238435 | Not Available | 794 | Open in IMG/M |
| 3300007004|Ga0079218_10279258 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1340 | Open in IMG/M |
| 3300007004|Ga0079218_11997285 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300009089|Ga0099828_11921216 | Not Available | 519 | Open in IMG/M |
| 3300009094|Ga0111539_10520001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1386 | Open in IMG/M |
| 3300009147|Ga0114129_10105260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. WDL1 | 3899 | Open in IMG/M |
| 3300009147|Ga0114129_13264880 | Not Available | 526 | Open in IMG/M |
| 3300009148|Ga0105243_10026640 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4426 | Open in IMG/M |
| 3300009609|Ga0105347_1227938 | Not Available | 758 | Open in IMG/M |
| 3300009609|Ga0105347_1536428 | Not Available | 509 | Open in IMG/M |
| 3300010337|Ga0134062_10367445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 697 | Open in IMG/M |
| 3300010397|Ga0134124_10217295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1744 | Open in IMG/M |
| 3300010397|Ga0134124_11388097 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 728 | Open in IMG/M |
| 3300010397|Ga0134124_12262960 | Not Available | 584 | Open in IMG/M |
| 3300010401|Ga0134121_12763416 | Not Available | 536 | Open in IMG/M |
| 3300010401|Ga0134121_12777249 | Not Available | 535 | Open in IMG/M |
| 3300010403|Ga0134123_12258386 | Not Available | 607 | Open in IMG/M |
| 3300010403|Ga0134123_12516807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 581 | Open in IMG/M |
| 3300011400|Ga0137312_1008049 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1263 | Open in IMG/M |
| 3300011402|Ga0137356_1043205 | Not Available | 842 | Open in IMG/M |
| 3300011410|Ga0137440_1076260 | Not Available | 669 | Open in IMG/M |
| 3300012179|Ga0137334_1127410 | Not Available | 576 | Open in IMG/M |
| 3300012206|Ga0137380_10254002 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1584 | Open in IMG/M |
| 3300012362|Ga0137361_11318500 | Not Available | 646 | Open in IMG/M |
| 3300012469|Ga0150984_112396399 | Not Available | 677 | Open in IMG/M |
| 3300012922|Ga0137394_10673490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 872 | Open in IMG/M |
| 3300012948|Ga0126375_11468018 | Not Available | 581 | Open in IMG/M |
| 3300012960|Ga0164301_10716819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 755 | Open in IMG/M |
| 3300013297|Ga0157378_12778352 | Not Available | 542 | Open in IMG/M |
| 3300014150|Ga0134081_10303011 | Not Available | 574 | Open in IMG/M |
| 3300014157|Ga0134078_10355534 | Not Available | 645 | Open in IMG/M |
| 3300014269|Ga0075302_1010937 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1515 | Open in IMG/M |
| 3300015054|Ga0137420_1296146 | Not Available | 677 | Open in IMG/M |
| 3300015248|Ga0180079_1049687 | Not Available | 615 | Open in IMG/M |
| 3300015358|Ga0134089_10010221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3011 | Open in IMG/M |
| 3300017930|Ga0187825_10333892 | Not Available | 571 | Open in IMG/M |
| 3300017965|Ga0190266_10502019 | Not Available | 707 | Open in IMG/M |
| 3300018083|Ga0184628_10244204 | Not Available | 942 | Open in IMG/M |
| 3300018431|Ga0066655_10921999 | Not Available | 598 | Open in IMG/M |
| 3300018469|Ga0190270_11376576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 751 | Open in IMG/M |
| 3300020202|Ga0196964_10083815 | All Organisms → cellular organisms → Bacteria | 1386 | Open in IMG/M |
| 3300020202|Ga0196964_10702320 | Not Available | 501 | Open in IMG/M |
| 3300020215|Ga0196963_10480443 | Not Available | 562 | Open in IMG/M |
| 3300021080|Ga0210382_10244706 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 784 | Open in IMG/M |
| 3300024246|Ga0247680_1044133 | Not Available | 646 | Open in IMG/M |
| 3300024286|Ga0247687_1048824 | Not Available | 633 | Open in IMG/M |
| 3300025535|Ga0207423_1020448 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1085 | Open in IMG/M |
| 3300025604|Ga0207930_1119995 | Not Available | 586 | Open in IMG/M |
| 3300025711|Ga0207696_1192773 | Not Available | 536 | Open in IMG/M |
| 3300025893|Ga0207682_10091269 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1320 | Open in IMG/M |
| 3300025901|Ga0207688_10030570 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2971 | Open in IMG/M |
| 3300025903|Ga0207680_10021872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3469 | Open in IMG/M |
| 3300025907|Ga0207645_10186563 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1362 | Open in IMG/M |
| 3300025936|Ga0207670_10483498 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1003 | Open in IMG/M |
| 3300026041|Ga0207639_10398139 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1240 | Open in IMG/M |
| 3300026052|Ga0208289_1004300 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1068 | Open in IMG/M |
| 3300026535|Ga0256867_10168145 | Not Available | 814 | Open in IMG/M |
| 3300027513|Ga0208685_1134211 | Not Available | 529 | Open in IMG/M |
| 3300027639|Ga0209387_1127925 | Not Available | 647 | Open in IMG/M |
| 3300027695|Ga0209966_1077750 | Not Available | 733 | Open in IMG/M |
| 3300027775|Ga0209177_10229829 | Not Available | 675 | Open in IMG/M |
| 3300027775|Ga0209177_10486848 | Not Available | 512 | Open in IMG/M |
| 3300027821|Ga0209811_10232264 | Not Available | 701 | Open in IMG/M |
| 3300027886|Ga0209486_10894087 | Not Available | 588 | Open in IMG/M |
| 3300027964|Ga0256864_1066662 | Not Available | 992 | Open in IMG/M |
| 3300028145|Ga0247663_1080741 | Not Available | 578 | Open in IMG/M |
| 3300028802|Ga0307503_10911457 | Not Available | 509 | Open in IMG/M |
| 3300028812|Ga0247825_11364611 | Not Available | 519 | Open in IMG/M |
| 3300031184|Ga0307499_10199829 | Not Available | 614 | Open in IMG/M |
| 3300031716|Ga0310813_11296151 | Not Available | 673 | Open in IMG/M |
| 3300031720|Ga0307469_10441526 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1124 | Open in IMG/M |
| 3300031820|Ga0307473_11496087 | Not Available | 512 | Open in IMG/M |
| 3300031913|Ga0310891_10306454 | Not Available | 561 | Open in IMG/M |
| 3300032002|Ga0307416_103275189 | Not Available | 542 | Open in IMG/M |
| 3300032144|Ga0315910_11164599 | Not Available | 602 | Open in IMG/M |
| 3300033417|Ga0214471_11514252 | Not Available | 502 | Open in IMG/M |
| 3300034819|Ga0373958_0060903 | Not Available | 817 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 10.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.65% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 7.69% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 6.73% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.77% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.85% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 2.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.88% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.92% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.92% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.92% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.96% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.96% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.96% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.96% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.96% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.96% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
| 3300004024 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011400 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT133_2 | Environmental | Open in IMG/M |
| 3300011402 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT830_2 | Environmental | Open in IMG/M |
| 3300011410 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT222_2 | Environmental | Open in IMG/M |
| 3300012179 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2 | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014269 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1 | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015248 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT530_16_10D | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300020202 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10 | Environmental | Open in IMG/M |
| 3300020215 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300024246 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21 | Environmental | Open in IMG/M |
| 3300024286 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK28 | Environmental | Open in IMG/M |
| 3300025535 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025604 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026052 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
| 3300027513 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes) | Environmental | Open in IMG/M |
| 3300027639 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027964 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 HiSeq | Environmental | Open in IMG/M |
| 3300028145 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J14111_102583612 | 3300001305 | Soil | EIADAHPRLELWLAWRRGEVGVAARELISQARRLSA* |
| C688J18823_107919881 | 3300001686 | Soil | GRRGVVYRALADRHPRLELWLAWRRGSLSAAGQEFVAHARRLAA* |
| Ga0055467_100944441 | 3300003996 | Natural And Restored Wetlands | GVVYRELADVHPRLDLWLAWPRSGLGAAARDFLALARRRNR* |
| Ga0055436_101478561 | 3300004024 | Natural And Restored Wetlands | VPASVANLGRRGVVYRDIADAHPKLDLWLAWRRGAQGMAAREFVQHARRLAR* |
| Ga0063455_1008450572 | 3300004153 | Soil | ANLGRRGVVYRELADAHPRLDLWLAWRRGDLGAAARDFLAHARRIAR* |
| Ga0062590_1011186271 | 3300004157 | Soil | VSNLGRRGVSYRELADRHPRLDLWLAWQRGGLSSAAREFVTHARRSV* |
| Ga0062590_1019526502 | 3300004157 | Soil | PGSVANLGRRGVVYRRISDRHPVLELWLAWRAGATSAAAAEFVALARSLAKA* |
| Ga0062592_1014282542 | 3300004480 | Soil | PASIANLGRRGVAYREIADAHPRLDLWLAWRSGALGAAAREFVLHARRIAR* |
| Ga0062591_1029355572 | 3300004643 | Soil | GAAIVPGSIANLGRRGVVYRELADSHPKLDLWLAWPRNEGGTAGLGAAARDFLALARQRAR* |
| Ga0066677_100768613 | 3300005171 | Soil | GAAIVPASVANLGRRGVAYRELAERHPRLDLWLAWCRGALDAAGREFVAHARRLV* |
| Ga0066688_109413251 | 3300005178 | Soil | RGVVYRELAERHPRLDLWLAWRRGVLDAPGHEFVALARTLAP* |
| Ga0070676_104261682 | 3300005328 | Miscanthus Rhizosphere | RRGVAYRELADRHPRLDLWLAWRRGGLSAAARDFVAHARRSA* |
| Ga0068869_1016249181 | 3300005334 | Miscanthus Rhizosphere | GSLANLGRRGVVYRRLSDRHPMLELWLAWRRGATGAAAEEFIAQARSLAKA* |
| Ga0070687_1002422461 | 3300005343 | Switchgrass Rhizosphere | ANLGRRGVVYRELADPHPKLDLWLAWPRNEGGTAGLGTAARDFLALARQRTR* |
| Ga0070692_105230292 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | AIVPGSIANLGRRGVVYRELADSHPKLDLWLAWPRNEGGTAGLGTAARDFLALARQRTR* |
| Ga0070700_1016030651 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | ACLANLGRRGVVYREIADPHPRLDLWLAWRRGALAFPGGGAAREFVAQARRLSKESR* |
| Ga0070694_1010769162 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | VVYRALADRHPRLDVWLAWRRGSLSAASQEFVAHARRIAA* |
| Ga0070704_1015876742 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | SIANLGRRGVVYRELADRHPRLDLWLAWRRGSLAAPAREFVSLARELAA* |
| Ga0068857_1009705812 | 3300005577 | Corn Rhizosphere | VPDSLANLGRRGVVYRKLADRHPTLELWLAWRRGSAGTALLEFIAQAQRLAKA* |
| Ga0066905_1015160012 | 3300005713 | Tropical Forest Soil | RRGVVYRELADRHPRLDVWLAWPRGPLGAAARDFVAHARELRRK* |
| Ga0079222_105309851 | 3300006755 | Agricultural Soil | YRALADRHPRLDVWLAWRRGSLSAASQEFVAYARRIAA* |
| Ga0075431_1005632051 | 3300006847 | Populus Rhizosphere | YRELADRHPRLDLWLAWPRGALSAAARDFVTHARRYV* |
| Ga0075433_102297681 | 3300006852 | Populus Rhizosphere | VANLGRRGVVYRELADRHPRLDVWLAWRRGVPDAAGKEFIALARSLAA* |
| Ga0079217_100401973 | 3300006876 | Agricultural Soil | RGVTYREIADAHPRLDLWLAWRRGALGAAGRDFVTHARRIAR* |
| Ga0079217_116218182 | 3300006876 | Agricultural Soil | RGVVYREIADPHPRLDLWLAWRRGALGATARDFLVHARRAAR* |
| Ga0079217_116346742 | 3300006876 | Agricultural Soil | VYREINDRHPRLDLWLAWPRGALGTVARDFLALARRRAR* |
| Ga0079215_106856083 | 3300006894 | Agricultural Soil | MAKLGRRGVVYRDIGDAHPRLDVWLAWPRGPLSVAAQQFVDLAR* |
| Ga0075424_1012384352 | 3300006904 | Populus Rhizosphere | LADRHPRLDLWLAWPRGALSAAARDFVTHARRGA* |
| Ga0079218_102792581 | 3300007004 | Agricultural Soil | LVPASLANLGRRGVRYRELKDAHPRLDLWLAWRRGTLGAAGREFLLHARRIAS* |
| Ga0079218_119972852 | 3300007004 | Agricultural Soil | AKLGRRGVVYRDIGDAHPRLDVWLAWPRGPLSVAAQQFVELAR* |
| Ga0099828_119212162 | 3300009089 | Vadose Zone Soil | LADRHPRLDLWLAWRRGMLDAPGREFVALARSLAP* |
| Ga0111539_105200011 | 3300009094 | Populus Rhizosphere | RRGVAYREIADAHPRLDLWLAWRRGAVASVAAREFIQHARRVAR* |
| Ga0114129_101052604 | 3300009147 | Populus Rhizosphere | DRHPRLELWLAWRRGPGGPTAGSAGRDFIAQARRLAE* |
| Ga0114129_132648802 | 3300009147 | Populus Rhizosphere | IANLGRRGVVYRSLADRHPRLDLWLAWRRAPLSEAALQFVAHARRLAA* |
| Ga0105243_100266404 | 3300009148 | Miscanthus Rhizosphere | AIVPGSIANLGRRGVVYRELADSHPKLDLWLAWPRNGLGTAARDFLALARQRAR* |
| Ga0105347_12279382 | 3300009609 | Soil | ANLGRRGVLYRELADRHPRLDLWLAWPRGALAAAARDFVAHARRIAS* |
| Ga0105347_15364282 | 3300009609 | Soil | RRGVAYREIADPHPRLDLWLAWRRGTQGVAAREFVQHARRVAR* |
| Ga0134062_103674451 | 3300010337 | Grasslands Soil | AAIVPASVANLGRRGVVYRELADRHPRLDVWLAWRRGVPDAAGKEFIALARSLAA* |
| Ga0134124_102172951 | 3300010397 | Terrestrial Soil | ELADAHPRLDLWLAWRRGTATGVAAREFLQHARRLAR* |
| Ga0134124_113880971 | 3300010397 | Terrestrial Soil | LADAHPSLDLWLAWRRGPLGVAAREFMQHARRISR* |
| Ga0134124_122629602 | 3300010397 | Terrestrial Soil | YRELADAHPRLDLWLAWRRGAAAGVAAREFLQHARRLAR* |
| Ga0134121_127634162 | 3300010401 | Terrestrial Soil | ALVPASLANLGRRGVVYRELADPHPRLDVRLAWRKGLFGSVHGVAAREFVLHARRIAR* |
| Ga0134121_127772491 | 3300010401 | Terrestrial Soil | NLGRRGVAYRELADAHPRLDLWLAWLRGSVGATAGIAAREFLQHARRLAR* |
| Ga0134123_122583862 | 3300010403 | Terrestrial Soil | PASVANLGRRGVVYRELAGRHPRLDLWLAWPRGTLVAAARDFVAHARRTRR* |
| Ga0134123_125168071 | 3300010403 | Terrestrial Soil | AVVPGSVANLARRGVVYRRISDRHPMLELWLAWRVGTPSAAAAEFIALARSLAKA* |
| Ga0137312_10080491 | 3300011400 | Soil | RELADAHPRLDLWLAWRRGALGATARDFLLHARRGAR* |
| Ga0137356_10432052 | 3300011402 | Soil | NLGRRGVVYRELADRHPRLDLWLAWPRGALAAAARDFVAHARRIAS* |
| Ga0137440_10762601 | 3300011410 | Soil | EIADAHPKLDLWLAWRRGAVGTTAGVAAREFVQHARRIAR* |
| Ga0137334_11274102 | 3300012179 | Soil | VYRELADAHPRLDLWLAWRRGALGATARDFLAHARRGAR* |
| Ga0137380_102540021 | 3300012206 | Vadose Zone Soil | NLGRRGVVYRELADPHPRLDLWLAWRRGASGATAGAAGREFVAHARRLAR* |
| Ga0137361_113185001 | 3300012362 | Vadose Zone Soil | IAEPHPRLDLWLAWRRGALGVAGREFAAQARRLAR* |
| Ga0150984_1123963992 | 3300012469 | Avena Fatua Rhizosphere | REISDPHPRLELWLAWRRGELGIAARELIAQARRLSG* |
| Ga0137394_106734901 | 3300012922 | Vadose Zone Soil | AAIVPASVANLGRRGVAYRELADRHPRLDVWLAWRKKVPDAAGREFISLARSLAA* |
| Ga0126375_114680182 | 3300012948 | Tropical Forest Soil | ELADRHPRLDLWLAWRRGALSAAARDFVTHARRRA* |
| Ga0164301_107168192 | 3300012960 | Soil | PASVSNLGRRGVSYRELADRHPRLDLWLAWQRGGLSSAAREFVTHARRSV* |
| Ga0157378_127783521 | 3300013297 | Miscanthus Rhizosphere | IADPHPRLELWLGWRRGELGAAARELVAQAKRLAA* |
| Ga0134081_103030112 | 3300014150 | Grasslands Soil | VYREIAEPHPRLDLWLAWRRGALGAAGREFAAQARRLAR* |
| Ga0134078_103555342 | 3300014157 | Grasslands Soil | EIADPHPRLELWLAWRRGELGVAARELITQARRLSG* |
| Ga0075302_10109373 | 3300014269 | Natural And Restored Wetlands | ASVANLGRRGVTYREIADAHPRLDLWLAWRRGVFGSVHGAAARDFIQHARRLAR* |
| Ga0137420_12961461 | 3300015054 | Vadose Zone Soil | VAYREIADPHPRLDLWLAWRRGALGAAGREFAAQARRLAR* |
| Ga0180079_10496871 | 3300015248 | Soil | IADAHPRLDLWLAWRGGALGAAAREFVLHARRIAR* |
| Ga0134089_100102211 | 3300015358 | Grasslands Soil | LGRRGVAYREIADPHPRLDLWLAWRRGALGAAGREFAAQARRLAR* |
| Ga0187825_103338922 | 3300017930 | Freshwater Sediment | LAERHPRLDLWLGWPRAAGSGLGAAARDFLALARGLSR |
| Ga0190266_105020191 | 3300017965 | Soil | NLGRRGVAYREIADAHPRLDLWLAWRSGPLGAAAREFVLHARRIAR |
| Ga0184628_102442042 | 3300018083 | Groundwater Sediment | YREIADAHPKLDLWLAWRRSTVGTTAGVAAREFVQHARRLTR |
| Ga0066655_109219992 | 3300018431 | Grasslands Soil | SEIAESHPRLDVWLAWRRGTMSPVQREFVALARREDR |
| Ga0190270_113765762 | 3300018469 | Soil | RRGVVYREINDRHPRLDLWLAWPRGGLGTAARDFLALARRGR |
| Ga0196964_100838151 | 3300020202 | Soil | GCMAKLGRRGVVYREISDPHPRLDLWLAWPRGGLGIAAAQFVGLAR |
| Ga0196964_107023201 | 3300020202 | Soil | SVANLGRRGVAYRELADRHPRLDLWLAWPRGSLGAPGHDFVAHARRLAP |
| Ga0196963_104804432 | 3300020215 | Soil | EIAEAHPRLDLWLAWPRGTPGAAAHDFIALARGGR |
| Ga0210382_102447061 | 3300021080 | Groundwater Sediment | GRSGVTYRDLADRHPRLDLWLAWPRGALGAAGRDFVAHARQIAR |
| Ga0247680_10441331 | 3300024246 | Soil | VAYRELADRHPRLDLWLAWPRGTLSAAARDFVAHARRSGQ |
| Ga0247687_10488241 | 3300024286 | Soil | ASVSNLGRRGVAYRELADRHPRLDLWLAWRRGGLSAAARDFVAHARRSA |
| Ga0207423_10204481 | 3300025535 | Natural And Restored Wetlands | AYRELADRHPRLDVWLAWPRGALGAAARDFVARARELRP |
| Ga0207930_11199952 | 3300025604 | Arctic Peat Soil | YRELADGHPRLDLWLAWRRGALGVPGGTAGRDFVRHARRMAGQSR |
| Ga0207696_11927732 | 3300025711 | Switchgrass Rhizosphere | LGRRGVAYRELADRHPRLDLWLAWRRGGLSAAARDFVAHARRSA |
| Ga0207682_100912691 | 3300025893 | Miscanthus Rhizosphere | PHPKLDLWLAWPRNQGGAAGLGTAARDFLALARRRAR |
| Ga0207688_100305701 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | IANLGRRGVVYRELADPHPKLDLWLAWPRNQDGAAGLGTAARDFLALARRRAR |
| Ga0207680_100218723 | 3300025903 | Switchgrass Rhizosphere | RGVAYRELADRHPRLDLWLAWRRGGLSAAARDFVAHARRSA |
| Ga0207645_101865631 | 3300025907 | Miscanthus Rhizosphere | GAAIVPGSIANLGRRGVVYRELADPHPKLDLWLAWPRNQGGAAGLGTAARDFLALARRRA |
| Ga0207670_104834983 | 3300025936 | Switchgrass Rhizosphere | RELADRHPRLDLWLAWPRGTLSAAARDFVAHARRSGQ |
| Ga0207639_103981391 | 3300026041 | Corn Rhizosphere | YRELADRHPRLDLWLAWRRGGLSAAARDFVAHARRSA |
| Ga0208289_10043001 | 3300026052 | Natural And Restored Wetlands | EIADAHPRLDLWLAWRRGGLGAAAREFVLHARRLAR |
| Ga0256867_101681452 | 3300026535 | Soil | IGDAHPRLDLWLAWRRGSLGAAGREFVLHARREAR |
| Ga0208685_11342112 | 3300027513 | Soil | VPASVANLGRRGVVYREIADAHPRLDLWLAWRRGSLGAAGREFVQHARRIAR |
| Ga0209387_11279252 | 3300027639 | Agricultural Soil | IADAHPRLDLWLAWRRGALGAAGRDFLTHARRIAR |
| Ga0209966_10777502 | 3300027695 | Arabidopsis Thaliana Rhizosphere | NLGRRGVAYREIADAHPRLDLWLAWRRGGLGAAGREFVQHARRIAR |
| Ga0209177_102298291 | 3300027775 | Agricultural Soil | DPHPKLDLWLAWRRGPGGIIAGAAGREFVIHAKRLAR |
| Ga0209177_104868481 | 3300027775 | Agricultural Soil | SVANLGRRGVVYRELRDAHPRLDVWLAWPRATLEPAAQEFVALARRLAP |
| Ga0209811_102322641 | 3300027821 | Surface Soil | ASVSNLGRRGVSYRELADRHPRLDLWLAWQRGGLSSAAREFVTHARRSV |
| Ga0209486_108940871 | 3300027886 | Agricultural Soil | LVPASLANLGRRGVRYRELKDAHPRLDLWLAWRRGTLGAAGREFLLHARRIAS |
| Ga0256864_10666621 | 3300027964 | Soil | RDIGDAHPRLDLWLAWRRGSLGAAGREFVLHARREAR |
| Ga0247663_10807412 | 3300028145 | Soil | VVPGSVANLARRGVVYRRISDRHPMLELWLAWRVGTPSAAAAEFIALARSLEKA |
| Ga0307503_109114572 | 3300028802 | Soil | SGVVYRELADAHPRLDLWLAWRRGELGATARDFLAHARRRTR |
| Ga0247825_113646112 | 3300028812 | Soil | VVPACMAKLGRRGVVYREIADAHPRLDLWLAWPGGALGVAAQQFADLARKP |
| Ga0307499_101998292 | 3300031184 | Soil | AYRELADPHPKLDLWLAWRRGPLGVAARDFVQHARRLI |
| Ga0310813_112961511 | 3300031716 | Soil | ANLGRRGVVYREISDPHPKLDLWLAWRRGPGGITAGAAGREFVIHAKRLAR |
| Ga0307469_104415261 | 3300031720 | Hardwood Forest Soil | GVVYRELADAHPRLDLWLAWPRGALSAAGREFLAHARRSGH |
| Ga0307473_114960872 | 3300031820 | Hardwood Forest Soil | GRRGVVYRELADRHSRLDLWLAWRRGALDAPAREFVALARELAP |
| Ga0310891_103064541 | 3300031913 | Soil | NLGRRGVVYRALAERHPRLDLWLAWRRGALAQPAAEFVALARRLAQ |
| Ga0307416_1032751892 | 3300032002 | Rhizosphere | VPASIANLGRRGVVYREIADAHPRLDLWLAWRRGGLGASARDFLACARRNAR |
| Ga0315910_111645992 | 3300032144 | Soil | RGVVYREIGDPHPRLDLWLAWRRGELGATARDFLAQARRGTR |
| Ga0214471_115142522 | 3300033417 | Soil | YRDIGDAHPRLDLWLAWRRGSLGAAGREFVLHARREAR |
| Ga0373958_0060903_704_817 | 3300034819 | Rhizosphere Soil | YSELADRHPRLDLWLAWPRGARSAAARDFVTHARRGA |
| ⦗Top⦘ |