| Basic Information | |
|---|---|
| Family ID | F097060 |
| Family Type | Metagenome |
| Number of Sequences | 104 |
| Average Sequence Length | 44 residues |
| Representative Sequence | RYLYVLQTGGAQAIHAFRVQADGHLTALGPIAGLPNGTRGLAAF |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 89.42 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.67 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (30.769 % of family members) |
| Environment Ontology (ENVO) | Unclassified (55.769 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.692 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 30.56% Coil/Unstructured: 69.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.67 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF00578 | AhpC-TSA | 25.96 |
| PF10517 | DM13 | 23.08 |
| PF02518 | HATPase_c | 21.15 |
| PF08534 | Redoxin | 4.81 |
| PF13561 | adh_short_C2 | 2.88 |
| PF08546 | ApbA_C | 2.88 |
| PF02558 | ApbA | 2.88 |
| PF00106 | adh_short | 0.96 |
| PF02633 | Creatininase | 0.96 |
| PF00486 | Trans_reg_C | 0.96 |
| PF02627 | CMD | 0.96 |
| PF08281 | Sigma70_r4_2 | 0.96 |
| PF03476 | MOSC_N | 0.96 |
| PF00282 | Pyridoxal_deC | 0.96 |
| PF12840 | HTH_20 | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 2.88 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.96 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.96 |
| COG1402 | Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis) | Coenzyme transport and metabolism [H] | 0.96 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.96 |
| COG3217 | N-hydroxylaminopurine reductase subunit YcbX, contains MOSC domain | Defense mechanisms [V] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002558|JGI25385J37094_10156331 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 611 | Open in IMG/M |
| 3300002908|JGI25382J43887_10176647 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300002911|JGI25390J43892_10102487 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300002915|JGI25387J43893_1019508 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300005171|Ga0066677_10203241 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
| 3300005174|Ga0066680_10249039 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300005178|Ga0066688_10216951 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
| 3300005178|Ga0066688_10918591 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 538 | Open in IMG/M |
| 3300005354|Ga0070675_101885241 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300005450|Ga0066682_10343056 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300005451|Ga0066681_10191444 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
| 3300005471|Ga0070698_102166123 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300005518|Ga0070699_101669846 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 583 | Open in IMG/M |
| 3300005536|Ga0070697_100613767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 956 | Open in IMG/M |
| 3300005552|Ga0066701_10008153 | All Organisms → cellular organisms → Bacteria | 4595 | Open in IMG/M |
| 3300005554|Ga0066661_10601820 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300005555|Ga0066692_10833103 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 566 | Open in IMG/M |
| 3300005557|Ga0066704_10406557 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300005560|Ga0066670_10072017 | All Organisms → cellular organisms → Bacteria | 1861 | Open in IMG/M |
| 3300005568|Ga0066703_10903163 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300005574|Ga0066694_10198053 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300005576|Ga0066708_10681069 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300005587|Ga0066654_10057231 | All Organisms → cellular organisms → Bacteria | 1745 | Open in IMG/M |
| 3300005598|Ga0066706_11109637 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300005598|Ga0066706_11231225 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 568 | Open in IMG/M |
| 3300005598|Ga0066706_11479198 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 511 | Open in IMG/M |
| 3300006791|Ga0066653_10136640 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
| 3300006796|Ga0066665_11318375 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300006796|Ga0066665_11407133 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 540 | Open in IMG/M |
| 3300006806|Ga0079220_11453390 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 585 | Open in IMG/M |
| 3300007076|Ga0075435_101849436 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300007265|Ga0099794_10467221 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300009090|Ga0099827_11695758 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 551 | Open in IMG/M |
| 3300009137|Ga0066709_102790452 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 648 | Open in IMG/M |
| 3300009148|Ga0105243_10152815 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1982 | Open in IMG/M |
| 3300010323|Ga0134086_10092040 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300010325|Ga0134064_10054048 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_70_9 | 1237 | Open in IMG/M |
| 3300010329|Ga0134111_10027098 | All Organisms → cellular organisms → Bacteria | 1975 | Open in IMG/M |
| 3300010333|Ga0134080_10518533 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 569 | Open in IMG/M |
| 3300010335|Ga0134063_10380932 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 689 | Open in IMG/M |
| 3300011269|Ga0137392_10917873 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300012198|Ga0137364_10160690 | All Organisms → cellular organisms → Bacteria | 1630 | Open in IMG/M |
| 3300012198|Ga0137364_11334895 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 533 | Open in IMG/M |
| 3300012199|Ga0137383_10284725 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300012200|Ga0137382_10137234 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1648 | Open in IMG/M |
| 3300012201|Ga0137365_10520845 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300012201|Ga0137365_10601961 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300012201|Ga0137365_11126604 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 564 | Open in IMG/M |
| 3300012203|Ga0137399_10319877 | All Organisms → cellular organisms → Bacteria | 1285 | Open in IMG/M |
| 3300012203|Ga0137399_11114372 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300012204|Ga0137374_10105963 | All Organisms → cellular organisms → Bacteria | 2634 | Open in IMG/M |
| 3300012206|Ga0137380_10123490 | All Organisms → cellular organisms → Bacteria | 2365 | Open in IMG/M |
| 3300012208|Ga0137376_11168292 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300012349|Ga0137387_11227798 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 528 | Open in IMG/M |
| 3300012354|Ga0137366_10626731 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300012356|Ga0137371_10140242 | All Organisms → cellular organisms → Bacteria | 1894 | Open in IMG/M |
| 3300012359|Ga0137385_10826682 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 769 | Open in IMG/M |
| 3300012359|Ga0137385_11590164 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 518 | Open in IMG/M |
| 3300012361|Ga0137360_10156847 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1810 | Open in IMG/M |
| 3300012362|Ga0137361_10604701 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_70_9 | 1005 | Open in IMG/M |
| 3300012917|Ga0137395_10207481 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
| 3300012918|Ga0137396_11265652 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 515 | Open in IMG/M |
| 3300012923|Ga0137359_10108971 | All Organisms → cellular organisms → Bacteria | 2449 | Open in IMG/M |
| 3300012929|Ga0137404_11166443 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300012929|Ga0137404_12209868 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300012944|Ga0137410_11069142 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300012972|Ga0134077_10187204 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300014154|Ga0134075_10080366 | All Organisms → cellular organisms → Bacteria | 1368 | Open in IMG/M |
| 3300014154|Ga0134075_10264176 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300014154|Ga0134075_10487726 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300014157|Ga0134078_10152708 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300015358|Ga0134089_10558053 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300017657|Ga0134074_1178772 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 748 | Open in IMG/M |
| 3300017659|Ga0134083_10094279 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| 3300018433|Ga0066667_10015865 | All Organisms → cellular organisms → Bacteria | 3830 | Open in IMG/M |
| 3300018433|Ga0066667_10862308 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 776 | Open in IMG/M |
| 3300018482|Ga0066669_10137245 | All Organisms → cellular organisms → Bacteria | 1774 | Open in IMG/M |
| 3300018482|Ga0066669_10979769 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300025916|Ga0207663_11681801 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 511 | Open in IMG/M |
| 3300025939|Ga0207665_10422358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1019 | Open in IMG/M |
| 3300025939|Ga0207665_11285288 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 583 | Open in IMG/M |
| 3300026297|Ga0209237_1193691 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300026297|Ga0209237_1232921 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300026307|Ga0209469_1064334 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1127 | Open in IMG/M |
| 3300026318|Ga0209471_1248403 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300026319|Ga0209647_1133058 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
| 3300026319|Ga0209647_1286353 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300026323|Ga0209472_1007227 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5820 | Open in IMG/M |
| 3300026328|Ga0209802_1266596 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 577 | Open in IMG/M |
| 3300026334|Ga0209377_1038987 | All Organisms → cellular organisms → Bacteria | 2201 | Open in IMG/M |
| 3300026524|Ga0209690_1005840 | All Organisms → cellular organisms → Bacteria | 6867 | Open in IMG/M |
| 3300026527|Ga0209059_1123574 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 986 | Open in IMG/M |
| 3300026536|Ga0209058_1111531 | All Organisms → cellular organisms → Bacteria | 1363 | Open in IMG/M |
| 3300026547|Ga0209156_10142208 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_70_9 | 1166 | Open in IMG/M |
| 3300026548|Ga0209161_10513080 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300026550|Ga0209474_10270461 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_70_9 | 1031 | Open in IMG/M |
| 3300026552|Ga0209577_10097955 | All Organisms → cellular organisms → Bacteria | 2382 | Open in IMG/M |
| 3300027643|Ga0209076_1135030 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300027846|Ga0209180_10197437 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300027862|Ga0209701_10196970 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
| 3300031753|Ga0307477_10009876 | All Organisms → cellular organisms → Bacteria | 6568 | Open in IMG/M |
| 3300032180|Ga0307471_100060759 | All Organisms → cellular organisms → Bacteria | 3190 | Open in IMG/M |
| 3300032180|Ga0307471_103677030 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300032205|Ga0307472_101390846 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 680 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 30.77% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 29.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 12.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 12.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.77% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.85% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.96% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002915 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25385J37094_101563311 | 3300002558 | Grasslands Soil | SRYLYVLQTGGAQAIHGFRVQADGHLTPLGAIAGLPNGTRGLAAF* |
| JGI25382J43887_101766471 | 3300002908 | Grasslands Soil | IALSGNSRYLYVLGTGATPAIYAFRIERDGHLTALGPVGGLPAGTRGLAAF* |
| JGI25390J43892_101024871 | 3300002911 | Grasslands Soil | LSHNSRYLYVLQTGGAQAIHAFRVQADGHLTALGPIAGLPNGTRGLAAF* |
| JGI25387J43893_10195082 | 3300002915 | Grasslands Soil | SHNSRYLYVLQTGGAQAIHAFRVQADGHLTALGPIAGLPNGTRGLAAF* |
| Ga0066677_102032413 | 3300005171 | Soil | DIALSHNSRYLYVLQTGGAQAIHAFRVAADGHLTALGPVAGLPAGTRGLAAF* |
| Ga0066680_102490392 | 3300005174 | Soil | DIALSNNSRYLYVLQVGGAQAIHAFRIQADGHLTALGPIAGLPAGTRGLAAF* |
| Ga0066688_102169514 | 3300005178 | Soil | SRYLYVLQTGGAQAIHAFRVAADGHLTALGPVAGLPAGTRGLAAF* |
| Ga0066688_109185911 | 3300005178 | Soil | VLQTGGAQAIHAFHIEADGHLTALGPIAGLPAGTRGLAAF* |
| Ga0070675_1018852412 | 3300005354 | Miscanthus Rhizosphere | RYLYELVAGSPAIHAFQIQADGHLDRLGPIGGLPAGTVGLAAR* |
| Ga0066682_103430563 | 3300005450 | Soil | YVLGTNATPAIHGFRIERDGHLTPLEPVGGLPAGTRGLAAF* |
| Ga0066681_101914442 | 3300005451 | Soil | LYVLGTNATPAIHAFRIERDGHLTPLGPVGGLPAGTRGLAAF* |
| Ga0070698_1021661231 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LSHNSRYLYVLQTGGAQAIHAFRVQADGHLTALGPIAGLPAGTRGLAAF* |
| Ga0070699_1016698461 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | SHNSRYLYVLQTGGAQAIHAFRIERDGHLAPLGPVGGLPAGTRGLAAF* |
| Ga0070697_1006137672 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | ALSGNSGYLYVLQTGGVQAIHAFRVQSDGHLVPLGPVTGLPTGTRGLAAR* |
| Ga0066701_100081531 | 3300005552 | Soil | QTGGAQAIHAFHIEADGHLTALGPIAGLPAGTRGLAAF* |
| Ga0066661_106018201 | 3300005554 | Soil | YVLQTGGAQAIHAFRVAADGHLTPLGPIAGLPAGTRGLAAR* |
| Ga0066692_108331032 | 3300005555 | Soil | IALSHNSRYLYVLQTGGAQAIHAFRVQADGHLTALGPIAGLPNGTRGLAAF* |
| Ga0066704_104065572 | 3300005557 | Soil | LQTGGAQAIHAFHIEADGHLTALGPIAGLPAGTRGLAAF* |
| Ga0066670_100720171 | 3300005560 | Soil | YVLQTGGAQAIHAFRVQADGHLTALGPIAGLPNGTRGLAAF* |
| Ga0066703_109031631 | 3300005568 | Soil | LQTGGAQAIHAFRVQADGHLTALGPIAGLPNGTRGLAAF* |
| Ga0066694_101980533 | 3300005574 | Soil | GTNATPAIHGFRIERDGHLTPLEPVGGLPAGTRGLAAF* |
| Ga0066708_106810691 | 3300005576 | Soil | LYVLQTSGAQAIHAFRIQADGHLTALGPIAGLPAGTRGLAAF* |
| Ga0066654_100572311 | 3300005587 | Soil | NSRYLYVLQTSGAQAIHAFRIEADGHLTPLGPVGGLPAGTRGLAAR* |
| Ga0066706_111096372 | 3300005598 | Soil | LYVLQTGGARAIHAFRIQNDGSLRALGPVGGLPAGIQGLAAF* |
| Ga0066706_112312252 | 3300005598 | Soil | SHNSRYLYVLQTGGAQAIHAFHIEADGHLTALGPIAGLPAGTRGLAAF* |
| Ga0066706_114791981 | 3300005598 | Soil | YVLQTGGAQAIHAFRVEADGHLTALGPIAGLPNGTRGLTAF* |
| Ga0066653_101366401 | 3300006791 | Soil | RYLYVLGTGATPVIYAFCIEADGHLNPLGPIGGLPAGTRGLAAF* |
| Ga0066665_113183751 | 3300006796 | Soil | NDIALSHNSRYLYVLQTGGAQAIHAFRVQADGHLTPLGAIAGLPNGTRGLAAF* |
| Ga0066665_114071332 | 3300006796 | Soil | ALSHNSRYLYVLQTGGAQAIHAFRVQADGHLTALGPIAGLPTGTRGLAAF* |
| Ga0079220_114533901 | 3300006806 | Agricultural Soil | ALSHDSRYLYVLQTGGAQAIHAFRVQADGHLTALGPIAGLPTGTRGLAAF* |
| Ga0075435_1018494361 | 3300007076 | Populus Rhizosphere | GKVPAIYAFRIQQDGSLAALGRVAGLPAGTRGLAAF* |
| Ga0099794_104672211 | 3300007265 | Vadose Zone Soil | ANSRYLYVLKTGGQQAIFAFRVQDDGHLTALGPVGGLPAGTRGLAAF* |
| Ga0099827_116957581 | 3300009090 | Vadose Zone Soil | SRYLYVLRTGGAQAILAFRVAPDGHLTPLGPIVGLPNGTRGLAAF* |
| Ga0066709_1027904521 | 3300009137 | Grasslands Soil | NSRYLYVLQTGGAQAIHAFRVAADGHLTALGPVAGLPAGTRGLAAF* |
| Ga0105243_101528151 | 3300009148 | Miscanthus Rhizosphere | NSRYLYELVAGSPAIHAFQIQADGHLDRLGPIGGLPAGTVGLAAR* |
| Ga0134086_100920401 | 3300010323 | Grasslands Soil | SRYLYQLVGGNTPAIHAFRVQRDGHLAPLGPVGGLPAGTVGLAAQ* |
| Ga0134064_100540481 | 3300010325 | Grasslands Soil | GGAQAIHAFRIQADGHLAALGAIAGLPAGTRGLAAF* |
| Ga0134111_100270984 | 3300010329 | Grasslands Soil | YLYVLGTGATPAIYAFRLEADGHLNPLGPIGELPAGTRGLAAR* |
| Ga0134080_105185332 | 3300010333 | Grasslands Soil | YLYVLQTGGAQAIHAFHIEADGHLTALGPIAGLPAGTRGLAAF* |
| Ga0134063_103809321 | 3300010335 | Grasslands Soil | TGGAQAIHAFRVQADGHLTALGPIAGLPNGTRGLAAF* |
| Ga0137392_109178731 | 3300011269 | Vadose Zone Soil | NSRYLYVLKTGGQQAIFAFRVQDDGHLTALGPVGGLPAGTRGLAAF* |
| Ga0137364_101606902 | 3300012198 | Vadose Zone Soil | LYALGTGSVQAIYAFRIENDGHLVALGAIGGLPAGTRGLAAF* |
| Ga0137364_113348951 | 3300012198 | Vadose Zone Soil | ITLSGNSRYLYVLQVGAAPAIQAFRVQADGHLTALGPIAGLPAGTRGLAAF* |
| Ga0137383_102847251 | 3300012199 | Vadose Zone Soil | GAQAIHAFRVQADGHLTALGAIAGLPTGTRGLAAF* |
| Ga0137382_101372341 | 3300012200 | Vadose Zone Soil | IALSSNSRYLYALGTGSVQAIYAFRIENDGHLVARGAIGGLPAGTRGLAAF* |
| Ga0137365_105208452 | 3300012201 | Vadose Zone Soil | LSHNSRYLYVLQTGGAQAIHAFRVAADGHLTALGPIAGLPAGTRGLAAF* |
| Ga0137365_106019612 | 3300012201 | Vadose Zone Soil | NSRYLYALGTGGVQAIYAFRIENDGRLVALGAIGALPAGTRGLAAF* |
| Ga0137365_111266041 | 3300012201 | Vadose Zone Soil | LSGNSHFLYVLGTNATPAIHAFRIERDGHLTPLEPVGGLPAGTRGLAAF* |
| Ga0137399_103198771 | 3300012203 | Vadose Zone Soil | GAQAIHAFRVAADGHLTALGPVGGLPAGTRGLAAF* |
| Ga0137399_111143722 | 3300012203 | Vadose Zone Soil | YVLKTGGQQAIFAFRVQDDGHLTALGPVGGLPAGTRGLAAF* |
| Ga0137374_101059634 | 3300012204 | Vadose Zone Soil | LSHNSRYLYVLGTGAAPAIHAFRVQADGHLTALGSIAGLPAGTRGLVGQ* |
| Ga0137380_101234901 | 3300012206 | Vadose Zone Soil | ATPAIYAFRIEADGHLNPLGPIGGLPAGTRGLAAR* |
| Ga0137376_111682922 | 3300012208 | Vadose Zone Soil | GGARAIHAFRIQNDGSLRALGPVGGLPAGIQGLAAF* |
| Ga0137387_112277982 | 3300012349 | Vadose Zone Soil | LSHNSRYLYVLQTGGAQAIHAFRVEADGHLTALGPIAGLPNGTRGLTAF* |
| Ga0137366_106267312 | 3300012354 | Vadose Zone Soil | YLYVLQTGGAQAIHAFRVAADGHLTALGLVGGLPAGTRGLAAF* |
| Ga0137371_101402425 | 3300012356 | Vadose Zone Soil | PTPAIHAFRVQPDGHLEPLGPVAGLPAGTTGLAAF* |
| Ga0137385_108266822 | 3300012359 | Vadose Zone Soil | YLYVLQVSGAQAIHAFHIQADGHLTPLGPVGGLPAGTRGLVAR* |
| Ga0137385_115901641 | 3300012359 | Vadose Zone Soil | SRYLYVLQTGGAQAIHAFRVQADGHLTALGPIAGLPTGTRGLAAF* |
| Ga0137360_101568473 | 3300012361 | Vadose Zone Soil | QTGGARAIHAFRIQNDGSLRALGPVGGLPAGIQGLAAF* |
| Ga0137361_106047012 | 3300012362 | Vadose Zone Soil | GAQAIHAFRVAADGHLTALGRVGGLPAGTRGLAAF* |
| Ga0137395_102074813 | 3300012917 | Vadose Zone Soil | AQAIHAFRVEADGHLTPLGAIAGLPNGTRGLTAF* |
| Ga0137396_112656522 | 3300012918 | Vadose Zone Soil | IALSANSRYLYVLQTGGPQAIHAFRIQVDGHLTPLGPIAGLPAGTRGLAAF* |
| Ga0137359_101089711 | 3300012923 | Vadose Zone Soil | TGGAQAIHAFRVAADGHLTALGPVGGLPAGTRGLAAF* |
| Ga0137404_111664432 | 3300012929 | Vadose Zone Soil | SRYLYVLQTGAAPAIHAFRVQADGHLTALGPIAGLPAGTRGLAAF* |
| Ga0137404_122098682 | 3300012929 | Vadose Zone Soil | RYLYVLQTGGARAIHAFRIQNDGSLRALGPVGGLPAGIQGLAAF* |
| Ga0137410_110691422 | 3300012944 | Vadose Zone Soil | YLYVLKTGGEQAIYAFRVQDDGHLRALGPIGGLPTGTRGLAAF* |
| Ga0134077_101872041 | 3300012972 | Grasslands Soil | QTGGAQAIHAFRVQADGHLTALGPIAGLPNGTRGLVAF* |
| Ga0134075_100803663 | 3300014154 | Grasslands Soil | NDIALSHNSRYLYVLQTGGAQAIHAFRVQADGHLTALGPIAGLPTGTRGLAAF* |
| Ga0134075_102641762 | 3300014154 | Grasslands Soil | NDIALSHNSRYLYVLQTGGAQAIHAFRVQADGHLTALGPIGGLPTGTRGLAAF* |
| Ga0134075_104877261 | 3300014154 | Grasslands Soil | LYALGTGGVQAIYAFRIENDGRLVALGAIGGLPAGTRGLAAF* |
| Ga0134078_101527083 | 3300014157 | Grasslands Soil | ALSHNSRYLYVLQTAGAQAIHAFRVAADGHLTALGPVAGLPAGTRGLAAF* |
| Ga0134089_105580532 | 3300015358 | Grasslands Soil | YVLQTGGAQAIHAFRVQADGHLTALGPIAGLPNGTRGLVAF* |
| Ga0134074_11787722 | 3300017657 | Grasslands Soil | LSHNSRYLYVLQTGGAPAVHAFRVQADGHLTALGPIAGLPNGTRGLAAF |
| Ga0134083_100942791 | 3300017659 | Grasslands Soil | LYVLQTGGAQAIHAFHIEADGHLTALGPIAGLPAGTRGLAAF |
| Ga0066667_100158655 | 3300018433 | Grasslands Soil | YLYVLQTGGARAIHAFRIQNDGSLRALGPVGGLPAGIQGLAAF |
| Ga0066667_108623082 | 3300018433 | Grasslands Soil | LSNNSRYLYVLQTSGAQAIHAFRIEADGHLTPLGPVGGLPAGTRGLAAR |
| Ga0066669_101372453 | 3300018482 | Grasslands Soil | LNDIALSSNSRYLYALGTGGVQAIYAFRIENDGRLVALGAIGGLPAGTRGLAAF |
| Ga0066669_109797691 | 3300018482 | Grasslands Soil | LYVLGTNATPAIHGFRIERDGHLTPLEPVGGLPAGTRGLAAF |
| Ga0207663_116818012 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | ALSNNSRYLYVLQTGGAQAIHAFRVGADGQLTPLGPAGGLPSGTRGLAAF |
| Ga0207665_104223581 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LYVLQTGGAQAIHAFRVGADGQLTPLGPAGGLPSGTRGLAAF |
| Ga0207665_112852882 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | IALSHNSRYLYVLQTGGAQAIHAFRVAADGHLTPLGPIAGLPAGTRGLAAF |
| Ga0209237_11936912 | 3300026297 | Grasslands Soil | TGGAQAIHAFRVQADGHLTALGPIAGLPNGTRGLAAF |
| Ga0209237_12329211 | 3300026297 | Grasslands Soil | HISRYLYVLQTGGAQAIHAFRVAADGHLTALGPVAGLPTGTRGLAAF |
| Ga0209469_10643341 | 3300026307 | Soil | NSRYLYVLQTGGAQAIHAFRVQADGHLTALGPIAGLPNGTRGLAAF |
| Ga0209471_12484032 | 3300026318 | Soil | GGAQAIHAFRVAADGHLTALGPVGGLPAGTRGLAAF |
| Ga0209647_11330581 | 3300026319 | Grasslands Soil | YVLQTGGAQAIHAFRIQNDGSLKALGPVGGLPTGTRGLAAF |
| Ga0209647_12863532 | 3300026319 | Grasslands Soil | NDITLSGNSRYLYVLQTGAAPAIHAFRVQADGHLTALGPIAGLPAGTRGLAAF |
| Ga0209472_10072279 | 3300026323 | Soil | SGNSHFLYVLGTNATPAIHGFRIERDGHLTPLEPVGGLPAGTRGLAAF |
| Ga0209802_12665962 | 3300026328 | Soil | TSGAQAIHAFRIQADGHLTALGPIAGLPAGTRGLAAF |
| Ga0209377_10389873 | 3300026334 | Soil | RYLYVLQTGGAQAIHAFRVQADGHLTALGPIAGLPNGTRGLAAF |
| Ga0209690_100584010 | 3300026524 | Soil | QTGGAQAIHAFHIEADGHLTALGPIAGLPAGTRGLAAF |
| Ga0209059_11235741 | 3300026527 | Soil | LSHNSRYLYVLQTGGAQAIHAFRVAADGHLTALGPVAGLPAGTRGLAAF |
| Ga0209058_11115311 | 3300026536 | Soil | VLQTGGARAIHAFRIQNDGSLRALGPVGGLPAGIQGLAAF |
| Ga0209156_101422081 | 3300026547 | Soil | YVLQTGGAQAIHAFRVAADGHLTALGPVAGLPAGTRGLAAF |
| Ga0209161_105130801 | 3300026548 | Soil | LYVLQTGGARAIHAFRIQNDGSLRALGPVGGLPAGIQGLAAF |
| Ga0209474_102704611 | 3300026550 | Soil | YVLQTGGAQAIHAFRVAADGHLTALGPVAGLPTGTRGLAAF |
| Ga0209577_100979555 | 3300026552 | Soil | DIALSHNSRYLYVLQTGGAQAIHAFRIQADGHLTPLGPIAGLPAGTRGLAAF |
| Ga0209076_11350302 | 3300027643 | Vadose Zone Soil | VLQTGGAQAIHAFRIQDDGSLTALGPVGGLPTGTRGLAAF |
| Ga0209180_101974373 | 3300027846 | Vadose Zone Soil | IALSHNSRYLYVLQTGGAQAIHAFRVAADGHLTALGPVGGLPAGTRGLAAF |
| Ga0209701_101969701 | 3300027862 | Vadose Zone Soil | GAQAIHAFRIERDGHLAPLGPVGGLPAGTRGLAAF |
| Ga0307477_100098761 | 3300031753 | Hardwood Forest Soil | NSRYLYALETGGAQAIHAFRVGADGQLTPLGPVGGLPSGTRGLAAF |
| Ga0307471_1000607595 | 3300032180 | Hardwood Forest Soil | LYVLQTGGAQAIHAFRIAADGHLTPLGPIAGLPAGTRGLAAF |
| Ga0307471_1036770302 | 3300032180 | Hardwood Forest Soil | HDSRYLYVLQTGGAQAIHAFRIERDGHLALLGPVGGLPAGTRGLAAF |
| Ga0307472_1013908461 | 3300032205 | Hardwood Forest Soil | GAQAIHAFRVQADGHLTALGPIAGLPTWTRGLAAF |
| ⦗Top⦘ |