NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F097041

Metagenome / Metatranscriptome Family F097041

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097041
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 72 residues
Representative Sequence MPDMTPHILPLQQGDNIALQYLGAAVVLQWETLPETARDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKS
Number of Associated Samples 84
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 57.69 %
% of genes near scaffold ends (potentially truncated) 43.27 %
% of genes from short scaffolds (< 2000 bps) 81.73 %
Associated GOLD sequencing projects 81
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.038 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(20.192 % of family members)
Environment Ontology (ENVO) Unclassified
(55.769 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(50.962 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 72.86%    β-sheet: 0.00%    Coil/Unstructured: 27.14%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF08592Anthrone_oxy 14.42
PF12762DDE_Tnp_IS1595 2.88
PF09335SNARE_assoc 1.92
PF07896DUF1674 1.92
PF03979Sigma70_r1_1 0.96
PF13670PepSY_2 0.96
PF12760Zn_Tnp_IS1595 0.96
PF02482Ribosomal_S30AE 0.96
PF03734YkuD 0.96
PF13193AMP-binding_C 0.96
PF03695UPF0149 0.96
PF03237Terminase_6N 0.96
PF02852Pyr_redox_dim 0.96
PF06325PrmA 0.96
PF07508Recombinase 0.96
PF07992Pyr_redox_2 0.96
PF01522Polysacc_deac_1 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG0398Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 familyFunction unknown [S] 1.92
COG0586Membrane integrity protein DedA, putative transporter, DedA/Tvp38 familyCell wall/membrane/envelope biogenesis [M] 1.92
COG1238Uncharacterized membrane protein YqaA, VTT domainFunction unknown [S] 1.92
COG5508Uncharacterized conserved protein, DUF1674 domainFunction unknown [S] 1.92
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.96
COG0726Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 familyCell wall/membrane/envelope biogenesis [M] 0.96
COG1376Lipoprotein-anchoring transpeptidase ErfK/SrfKCell wall/membrane/envelope biogenesis [M] 0.96
COG1544Ribosome-associated translation inhibitor RaiATranslation, ribosomal structure and biogenesis [J] 0.96
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 0.96
COG2264Ribosomal protein L11 methylase PrmATranslation, ribosomal structure and biogenesis [J] 0.96
COG2890Methylase of polypeptide chain release factorsTranslation, ribosomal structure and biogenesis [J] 0.96
COG3034Murein L,D-transpeptidase YafKCell wall/membrane/envelope biogenesis [M] 0.96
COG3079Uncharacterized conserved protein YgfB, UPF0149 familyFunction unknown [S] 0.96
COG3897Protein N-terminal and lysine N-methylase, NNT1/EFM7 familyPosttranslational modification, protein turnover, chaperones [O] 0.96


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.04 %
UnclassifiedrootN/A0.96 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000567|JGI12270J11330_10289980All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium512Open in IMG/M
3300000878|AL9A1W_1499208All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium531Open in IMG/M
3300004070|Ga0055488_10138537All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium624Open in IMG/M
3300005167|Ga0066672_10856672All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales567Open in IMG/M
3300005177|Ga0066690_10522259All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium797Open in IMG/M
3300005179|Ga0066684_10598641All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium740Open in IMG/M
3300005569|Ga0066705_10481520All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium778Open in IMG/M
3300005576|Ga0066708_10610935All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium698Open in IMG/M
3300006791|Ga0066653_10526685All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium598Open in IMG/M
3300006800|Ga0066660_10686608All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium843Open in IMG/M
3300006800|Ga0066660_11196446All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium597Open in IMG/M
3300006893|Ga0073928_10105443All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2355Open in IMG/M
3300006893|Ga0073928_11236800All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales502Open in IMG/M
3300009038|Ga0099829_10269077All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae1393Open in IMG/M
3300009090|Ga0099827_10252044All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1484Open in IMG/M
3300009137|Ga0066709_101391473All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1021Open in IMG/M
3300009521|Ga0116222_1509980All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium527Open in IMG/M
3300009552|Ga0116138_1219227All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium526Open in IMG/M
3300009621|Ga0116116_1062503All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1086Open in IMG/M
3300009631|Ga0116115_1075229All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium877Open in IMG/M
3300009636|Ga0116112_1167266All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium612Open in IMG/M
3300009637|Ga0116118_1198708All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium630Open in IMG/M
3300009639|Ga0116122_1055535All Organisms → cellular organisms → Bacteria → Proteobacteria1333Open in IMG/M
3300009640|Ga0116126_1056029All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1525Open in IMG/M
3300009640|Ga0116126_1073725All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1268Open in IMG/M
3300009643|Ga0116110_1050171All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1500Open in IMG/M
3300009643|Ga0116110_1058769All Organisms → cellular organisms → Bacteria → Proteobacteria1364Open in IMG/M
3300009645|Ga0116106_1009612All Organisms → cellular organisms → Bacteria → Proteobacteria3614Open in IMG/M
3300009645|Ga0116106_1060497All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1253Open in IMG/M
3300009646|Ga0116132_1101218All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium887Open in IMG/M
3300009762|Ga0116130_1021792All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2131Open in IMG/M
3300009764|Ga0116134_1024699All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2421Open in IMG/M
3300009839|Ga0116223_10753790All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium558Open in IMG/M
3300010379|Ga0136449_100533311All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2025Open in IMG/M
3300012096|Ga0137389_11194010All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium652Open in IMG/M
3300012189|Ga0137388_10412543All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1251Open in IMG/M
3300012199|Ga0137383_10283510All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae1213Open in IMG/M
3300012206|Ga0137380_10698756All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium881Open in IMG/M
3300012207|Ga0137381_10810722All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium811Open in IMG/M
3300012210|Ga0137378_10108921All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2550Open in IMG/M
3300012211|Ga0137377_11958262All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium502Open in IMG/M
3300012351|Ga0137386_10283591All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1192Open in IMG/M
3300012356|Ga0137371_10261931All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1350Open in IMG/M
3300012917|Ga0137395_10394741All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium990Open in IMG/M
3300013770|Ga0120123_1014279All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1557Open in IMG/M
3300014155|Ga0181524_10023643All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4416Open in IMG/M
3300014156|Ga0181518_10125647All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans → Hyphomicrobium denitrificans 1NES11401Open in IMG/M
3300014156|Ga0181518_10130354All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1369Open in IMG/M
3300014156|Ga0181518_10174526All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1134Open in IMG/M
3300014158|Ga0181521_10100628All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1775Open in IMG/M
3300014158|Ga0181521_10139144All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans → Hyphomicrobium denitrificans 1NES11414Open in IMG/M
3300014158|Ga0181521_10143602All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1383Open in IMG/M
3300014158|Ga0181521_10317581All Organisms → cellular organisms → Bacteria → Proteobacteria793Open in IMG/M
3300014164|Ga0181532_10067509All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2304Open in IMG/M
3300014164|Ga0181532_10163511All Organisms → cellular organisms → Bacteria → Proteobacteria1329Open in IMG/M
3300014165|Ga0181523_10146320All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans → Hyphomicrobium denitrificans 1NES11393Open in IMG/M
3300014165|Ga0181523_10282737All Organisms → cellular organisms → Bacteria940Open in IMG/M
3300014165|Ga0181523_10541963All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium641Open in IMG/M
3300014495|Ga0182015_10073718All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2415Open in IMG/M
3300014501|Ga0182024_10043634All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium7284Open in IMG/M
3300016750|Ga0181505_10890111All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium675Open in IMG/M
3300017925|Ga0187856_1069045All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1480Open in IMG/M
3300017931|Ga0187877_1233821All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense712Open in IMG/M
3300017938|Ga0187854_10068345All Organisms → cellular organisms → Bacteria → Proteobacteria1724Open in IMG/M
3300017938|Ga0187854_10165711All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria995Open in IMG/M
3300017940|Ga0187853_10065984All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1828Open in IMG/M
3300017946|Ga0187879_10086775All Organisms → cellular organisms → Bacteria1803Open in IMG/M
3300017946|Ga0187879_10451479All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium713Open in IMG/M
3300018009|Ga0187884_10072568All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1548Open in IMG/M
3300018013|Ga0187873_1092863All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1206Open in IMG/M
3300018014|Ga0187860_1015396All Organisms → cellular organisms → Bacteria → Proteobacteria4623Open in IMG/M
3300018014|Ga0187860_1127713All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1116Open in IMG/M
3300018016|Ga0187880_1054927All Organisms → cellular organisms → Bacteria → Proteobacteria2110Open in IMG/M
3300018016|Ga0187880_1432074All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium547Open in IMG/M
3300018017|Ga0187872_10142296All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans → Hyphomicrobium denitrificans 1NES11155Open in IMG/M
3300018024|Ga0187881_10136286All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1080Open in IMG/M
3300018025|Ga0187885_10110713All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1326Open in IMG/M
3300018033|Ga0187867_10144686All Organisms → cellular organisms → Bacteria → Proteobacteria1369Open in IMG/M
3300018035|Ga0187875_10011191All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria5661Open in IMG/M
3300018035|Ga0187875_10473267All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium666Open in IMG/M
3300018078|Ga0184612_10250571All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae914Open in IMG/M
3300018433|Ga0066667_10929787All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium749Open in IMG/M
3300018482|Ga0066669_10105627All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1967Open in IMG/M
3300019082|Ga0187852_1315063All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium621Open in IMG/M
3300019888|Ga0193751_1000226All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales50229Open in IMG/M
3300019888|Ga0193751_1060251All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1590Open in IMG/M
3300020581|Ga0210399_11604463All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium501Open in IMG/M
3300025507|Ga0208188_1059923All Organisms → cellular organisms → Bacteria → Proteobacteria932Open in IMG/M
3300025576|Ga0208820_1052373All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1134Open in IMG/M
3300026494|Ga0257159_1046009All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium739Open in IMG/M
3300027645|Ga0209117_1014956All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2566Open in IMG/M
3300029817|Ga0247275_1010918All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3353Open in IMG/M
3300029889|Ga0246001_1004576All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae5843Open in IMG/M
3300030619|Ga0268386_10412322All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium947Open in IMG/M
3300030945|Ga0075373_11618327All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium584Open in IMG/M
3300031128|Ga0170823_16611418All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium569Open in IMG/M
3300031170|Ga0307498_10299957All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium601Open in IMG/M
3300031229|Ga0299913_10108892All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2711Open in IMG/M
3300031229|Ga0299913_11022002All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium792Open in IMG/M
3300031274|Ga0307442_1042294All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1473Open in IMG/M
3300032160|Ga0311301_10617763All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1555Open in IMG/M
3300033433|Ga0326726_10898754All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium859Open in IMG/M
3300034090|Ga0326723_0435396Not Available598Open in IMG/M
3300034147|Ga0364925_0020544All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp.2098Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland20.19%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland16.35%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog12.50%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.69%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.85%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.88%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.92%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil1.92%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.92%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.96%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.96%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.96%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.96%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.96%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.96%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.96%
PeatEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat0.96%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300000878Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-5 cm-9A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300004070Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009552Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150EnvironmentalOpen in IMG/M
3300009621Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150EnvironmentalOpen in IMG/M
3300009631Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100EnvironmentalOpen in IMG/M
3300009636Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150EnvironmentalOpen in IMG/M
3300009637Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40EnvironmentalOpen in IMG/M
3300009639Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40EnvironmentalOpen in IMG/M
3300009640Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40EnvironmentalOpen in IMG/M
3300009643Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009646Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150EnvironmentalOpen in IMG/M
3300009762Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40EnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300013770Permafrost microbial communities from Nunavut, Canada - A15_5cm_18MEnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019082Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300025507Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025576Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes)EnvironmentalOpen in IMG/M
3300026494Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-AEnvironmentalOpen in IMG/M
3300027645Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300029817Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25EnvironmentalOpen in IMG/M
3300029889Peat microbial communities from Marcell Experimental Forest bog in Minnesota, USA - MG_T3F_30cmEnvironmentalOpen in IMG/M
3300030619Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)EnvironmentalOpen in IMG/M
3300030945Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031274Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-30EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M
3300034147Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12270J11330_1028998023300000567Peatlands SoilMPDMTPHILPLQQGDDIALQYLGAAVVLQWETLPEAIRDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKS*
AL9A1W_149920813300000878PermafrostMPDMTPHVLPLQQGDDIALQYLGAAVVLQWENLPEAARDAIWQQAEXXXXXXSLHEQLKSLIRRTKR*
Ga0055488_1013853723300004070Natural And Restored WetlandsEAPMPDMSAQVLHLKPGDELTLQYLGAAVILQWDKLPEEARGAIWQQAESVGGLQPVTSLHEQIKALIRRTRD*
Ga0066672_1085667223300005167SoilMPDMTPHVLSLQQGDDIALQYLGAAVVLQWEALPEAARDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKS*
Ga0066690_1052225923300005177SoilKKDSRMPDMTPHVLSLQQGDDIALQYLGAAVVLQWEALPEAARDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKS*
Ga0066684_1059864123300005179SoilMPDMTPHVLPLQQGDNIALQYLGAAVILQWENLPEAARDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKS*
Ga0066705_1048152013300005569SoilMDSRMPDMTPHVLPLQQGDDIALQYLGAAVVLQWENLPEAARDAIWQQAESVGGLPPVTSLHEQLKSLIRRAKS*
Ga0066708_1061093513300005576SoilMPDMTPHVLPLQQGDNIALQYLGAAVILQWENLPEAARDAIWQQAESVGGLPPVTSLHEQLKSLI
Ga0066653_1052668523300006791SoilMPDMTPHVLSLQQGDDIALQYLGAAVVLQWEALPEAARDAIWQQAESVGGLPPVTSHHEQLKSLIRRTKS*
Ga0066660_1068660813300006800SoilSGLGAVKKDSRMPDMTPHVLSLQQGDDIALQYLGAAVVLQWEALPEAARDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKS*
Ga0066660_1119644633300006800SoilMPDMTPHVLPLQQGDDIALQYLGAAVVLQWENLPEAARDAIWQQAESVGGLPPVTSLHEQLKSLIRR
Ga0073928_1010544323300006893Iron-Sulfur Acid SpringMPDMTPHVLPLQQGDDIALQYLGAAVVLQWENLPEAARDAIWQQAESVGGLPPVTSLHEQFKSLIRRTKR*
Ga0073928_1123680013300006893Iron-Sulfur Acid SpringKRPRSTAPWRKSVSSGLGAVKKDSRMPDMTPHVLSLQQGDDIALQYLGAAVVLQWENLPEAARDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKS*
Ga0099829_1026907723300009038Vadose Zone SoilMPDMTPHVLTLQQGDDIALQYLGAAVVLQWETLPEAARDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKS*
Ga0099827_1025204443300009090Vadose Zone SoilSRMPDMTPHVLSLQQGDDIALQYLGAAVVLQWEALPEAARDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKS*
Ga0066709_10139147333300009137Grasslands SoilLPLQQGDDIALQYLGAAVVLQWEALPEAARDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKS*
Ga0116222_150998023300009521Peatlands SoilMPDMTPHILPLQQGEDIALQYLGAAVVLQWETLPEAIRDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKS*
Ga0116138_121922713300009552PeatlandMPDMTPHILPLQQGDNIALQYLGAAVVLQWETLPETARDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKS*
Ga0116116_106250323300009621PeatlandMPDMTPHILPLQQGDNIALQYLGAAVVLQWDTLPEAVRDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKS*
Ga0116115_107522923300009631PeatlandMPDMTPHILPLQQGDNIALQYLGAAVVLQWETLPQTVRDAIWQQAESVGGLPPVTSLDEQLKSLIRRTKG*
Ga0116112_116726623300009636PeatlandMPDMTPHILPLQQGDNIALQYLGAAVVLQWETLPETARDAIWQQAESVGGLPPVTSLHEQLKALIRRTKG*
Ga0116118_119870813300009637PeatlandILPLQQGDNIALQYLGAAVVLQWETLPQTVRDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKG*
Ga0116122_105553523300009639PeatlandMPDMTPHILPLQQGDNIALQYLGAAVVLQWETLPETVRDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKG*
Ga0116126_105602913300009640PeatlandMPDMTPHILPLQQGDNIALQYLGAAVVLQWETLPEAIRDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKS*
Ga0116126_107372513300009640PeatlandDMTPHILPLQQGDNIALQYLGAAVVLQWETLPETVRDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKG*
Ga0116110_105017113300009643PeatlandAVKKDFRMPDMTPHILPLQQGDNIALQYLGAAVVLQWETLPETARDAIWQQAESVGGLPPVTSLHEQLKALIRRTKG*
Ga0116110_105876923300009643PeatlandAVKKDFRMPDMTPHILPLQQGDNIALQYLGAAVVLQWETLPQTVRDAIWQQAESVGGLPPVTSLDEQLKSLIRRTKG*
Ga0116106_1009612103300009645PeatlandVKKDFRMPDMTPHILPLQQGDNIALQYLGAAVVLQWETLPETVRDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKG*
Ga0116106_106049713300009645PeatlandMPDMTPHILPLQQGDNIALQYLGAAVVLQSETLPETARDAIWQQAESVGGLPPVTSLHEQLKALIRRTKG*
Ga0116132_110121823300009646PeatlandMPDMTPHILPLQQGDNIALQYLGAAVVLQWETLPEAIRDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKG*
Ga0116130_102179223300009762PeatlandMPDMTPHILPLQQGDNIALQYLGAAVVLQSETLPETARDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKG*
Ga0116134_102469943300009764PeatlandMPDMTPHILPLQQGDNIALQYLGAAVVLQWETLPEAIRDAIWQQAESVGGLPPVTSLHEQLKALIRRTKG*
Ga0116223_1075379023300009839Peatlands SoilMTPHILPLQQGDDIALQYLGAAVVLQWETLPEAIRDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKS*
Ga0136449_10053331113300010379Peatlands SoilMPDMTPHILPLQQGDNIALQYLGAAVVLQWETLPQTVRDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKG*
Ga0137389_1119401013300012096Vadose Zone SoilMVWANRLRGRIFRAVKKDSRMPDMTPHVLTLQQGDDIALQYLGAAVVLQWETLPEGARDALWQQAESVGGLPPVTSLHEQLKSLIRRTKS*
Ga0137388_1041254333300012189Vadose Zone SoilMTPHVLPLQQGDDIALQYLGAAVVLQWENLPEAARDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKS*
Ga0137383_1028351023300012199Vadose Zone SoilMTTAAKFSHPGDDIALQYLGAAVVLQWEALPEAARDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKS*
Ga0137380_1069875613300012206Vadose Zone SoilGRIFRAVKKDSRMPDMTPHVLSLQQGDDIALQYLGAAVVLQWEALPEAARDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKS*
Ga0137381_1081072213300012207Vadose Zone SoilKNVSSGLGAVKKDSRMPDMTPHVLSLQQGDDIALQYLGAAVVLQWEALPEAARDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKS*
Ga0137378_1010892143300012210Vadose Zone SoilMPDMTPHVLSLQHGDDIALQYLGAAVVLQWEALPEAARDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKS*
Ga0137377_1195826213300012211Vadose Zone SoilMTPHVLSLQQGDDIALQYLGAAVVLQWEALPEAARDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKS*
Ga0137386_1028359123300012351Vadose Zone SoilMPDMTPHVLSLQQGDDIALQYLGAAVVLQWEALPEAARDAIWQQSESVGGLPPVTSLHEQLKSLIRRTKS*
Ga0137371_1026193133300012356Vadose Zone SoilMPDMTPHVLSLQQSDDIALQYLGAAVVLQWEALPEAARDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKS*
Ga0137395_1039474123300012917Vadose Zone SoilVIIEYRAMAEECFSSGLGAVKKDSRMPDMTPHVLSLQQGDDIALQYLGAAVVLQWEALPEAARDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKS*
Ga0120123_101427933300013770PermafrostMPDMTPHVLPLQQGDDIALQYLGAAVVLQWENLPEAARDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKR*
Ga0181524_1002364393300014155BogMPDMTPHILPLQQGDNIALQYLGAAVVLQWETLPETVRDAIWQQAESVGGLPPVTSLDEQLKSLIRRTKG*
Ga0181518_1012564713300014156BogFRMPDMTPHILPLQQGDNIALQYLGAAVVLQWETLPQTVRDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKG*
Ga0181518_1013035413300014156BogKDFRMPDMTPHILPLQQGDNIALQYLGAAVVLQWETLPETVRDAIWQQAESVGGLPPVTSLDEQLKSLIRRTKG*
Ga0181518_1017452613300014156BogKDFRMPDMTPHILPLQQGDNIALQYLGAAVVLQWETLPETARDAIWQQAESVGGLPPVTSLHEQLKALIRRTKG*
Ga0181521_1010062843300014158BogMPDMTPHILPLQQDDNIALQYLGAAVVLQWETLPETARDAIWQQAESVGGLPPVTSLHEQLKALIRRTKG*
Ga0181521_1013914423300014158BogAVKKDFRMPDMTPHILPLQQGDNIALQYLGAAVVLQWETLPQTVRDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKG*
Ga0181521_1014360223300014158BogMPDMTPHVLPLQQGDNIALQYLGAAVVLQWETLPEAVRDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKS*
Ga0181521_1031758113300014158BogAVKKDFRMPDMTPHILPLQQGDNIALQYLGAAVVLQWETLPETVRDAIWQQAESVGGLPPVTSLDEQLKSLIRRTKG*
Ga0181532_1006750913300014164BogHILPLQQGDNIALQYLGAAVVLQWETLPETARDAIWQQAESVGGLPPVTSLHEQLKSLIRRAKG*
Ga0181532_1016351123300014164BogPLQQGDNIALQYLGAAVVLQWETLPETVRDAIWQQAESVGGLPPVTSLDEQLKSLIRRTKG*
Ga0181523_1014632023300014165BogPDMTPHILPLQQGDNIALQYLGAAVVLQWETLPQTVRDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKG*
Ga0181523_1028273723300014165BogDLTPHILPLQQGDNIALQYLGAAVVLQWETLPETARDAIWQQAESVGGLPPVTSLHEQLKSLIRRAKG*
Ga0181523_1054196323300014165BogMTPHLLPLQEDDNIVLQYLGAAVILQWETLPEAARDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKS*
Ga0182015_1007371853300014495PalsaMPDMTPHVLPLQQGDDIALQYLGAAVILQWETLPQAARDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKS*
Ga0182024_1004363483300014501PermafrostMPDLTPHILPLQQGDNIALQYLGAAVVLQWETLPETARDAIWQQAESVGGLPPVTSLHEQLKSLIRRAKG*
Ga0181505_1089011113300016750PeatlandMPDLTPHILPLQQGDNIALQYLGAAVVLQWETLPETVRDAIWQQAESVGGLPPVTSLDEQLKSLIRRTKG
Ga0187856_106904513300017925PeatlandMPDMTPHILPLQQGDDIALQYLGAAVVLQWETLPEAIRDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKS
Ga0187877_123382123300017931PeatlandMPDMTPHILPLQQGDNIALQYLGAAVVLQWETLPETVRDAIWQLAESVGGLPPVISLDEQLKSLIRRTKS
Ga0187854_1006834543300017938PeatlandRIFGAVKKDFRMPDMTPHILPLQQGDNIALQYLGAAVVLQWETLPETVRDAIWQQAESVGGLPPVTSLDEQLKSLIRRTKG
Ga0187854_1016571123300017938PeatlandRIFGAVKKDFRMPDMTPHILPLQQGDNIALQYLGAAVVLQSETLPETARDAIWQQAESVGGLPPVTSLHEQLKALIRRTKG
Ga0187853_1006598423300017940PeatlandMPDMTPHILPLQQGDNIALQYLGAAVVLQWETLPETVRDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKG
Ga0187879_1008677523300017946PeatlandMPDMTPHILPLLQGDDIALQYLGAAVVLQWETLPEAIRDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKS
Ga0187879_1045147923300017946PeatlandTPHILPLQQGDNIALQYLGAAVVLQWETLPETARDAIWQQAESVGGLPPVTSLHEQLKSLIRRAKG
Ga0187884_1007256813300018009PeatlandMPDMTPHILPLQQGDNIALQYLGAAVVLQWDTLPEAVRDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKS
Ga0187873_109286313300018013PeatlandMPDMTPHILPLQQGDDIALQYLGAAVVLQWETLPEAIRDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKG
Ga0187860_101539633300018014PeatlandMPDMTPHILPLQQGDNIALQYLGAAVVLQWETLPETVRDAIWQQAESVGGLPPVTSLDEQLKSLIRRTKG
Ga0187860_112771333300018014PeatlandPLQQGDNIALQYLGAAVVLQWETLPETARDAIWQQAESVGGLPPVTSLHEQLKALIRRTK
Ga0187880_105492763300018016PeatlandRRIFGAVKKDFRMPDMTPHILPLQQGDNIALQYLGAAVVLQWETLPETVRDAIWQQAESVGGLPPVTSLDEQLKSLIRRTKG
Ga0187880_143207423300018016PeatlandVKKDFRMPDMTPHILPLQQGDDIALQYLGAAVVLQWETLPEAIRDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKS
Ga0187872_1014229613300018017PeatlandMPDMTPHILPLQQGDNIALQYLGAAVVLQWETLPQTVRDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKG
Ga0187881_1013628613300018024PeatlandRMPDMTPHILPLQQGDNIALQYLGAAVVLQWETLPETARDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKS
Ga0187885_1011071323300018025PeatlandMPDMTPHILPLQQGDNIALQYLGAAVVLQWETLPETVRDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKS
Ga0187867_1014468613300018033PeatlandKDFRMPDMTPHILPLQQGDNIALQYLGAAVVLQWETLPETVRDAIWQQAESVGGLPPVTSLDEQLKSLIRRTKG
Ga0187875_1001119113300018035PeatlandAVKKDFRMPDMTPHILPLQQGDNIALQYLGAAVVLQWETLPETVRDAIWQQAESVGGLPPVTSLDEQLKSLIRRTKG
Ga0187875_1047326713300018035PeatlandAVKKDFRMPDMTPHILPLQQGDNIALQYLGAAVVLQWETLPQTVRDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKG
Ga0184612_1025057133300018078Groundwater SedimentMPNMTPQVLALQQGDDIALQYLGAAGVLQWDALPEEARNAIWQQAESVGGLPPVTALHEQLKSLIRRTK
Ga0066667_1092978713300018433Grasslands SoilMPDMTPHVLPLQQGDNIALQYLGAAVILQWENLPEAARDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKS
Ga0066669_1010562743300018482Grasslands SoilMPDMTPHVLSLQQGDDIALQYLGAAVVLQWEALPEAARDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKS
Ga0187852_131506333300019082PeatlandMPDMTPHILPLQQGDDIALQYLGAAVVLQWETLPETVRDAIWQQAESVGGLPPVTSLDEQLKSLIRRTKG
Ga0193751_100022653300019888SoilMPDLTPRVLSLQQGDNIALQYLGAAVVLQWENLPEAARDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKS
Ga0193751_106025153300019888SoilRTFRAMKKDSRMPDMTPHVLPLQQGDDIALQYLGAAVVLQWENLPEAARDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKS
Ga0210399_1160446313300020581SoilMPDMTPHVLSLQQGDDIALQYLGAAVVLQWDTLPEAARDAIWQQAESVGGLPPVTSLHEQIKSL
Ga0208188_105992313300025507PeatlandDFRMPDMTPHILPLQQGDNIALQYLGAAVVLQWETLPETVRDAIWQQAESVGGLPPVTSLDEQLKSLIRRTKG
Ga0208820_105237313300025576PeatlandRLLRRIFGAVKKDFRMPDMTPHILPLQQGDNIALQYLGAAVVLQSETLPETARDAIWQQAESVGGLPPVTSLHEQLKALIRRTKG
Ga0257159_104600913300026494SoilVIIEYRAMAEECFSSGLGAVKKDSRMPDMTPHVLSLQRGDDIALQYLGAAVVLQWEALPEAARDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKS
Ga0209117_101495623300027645Forest SoilMPDMTPHVLPLQQGDDIALQYLGAAVVLQWENLPEAARDAIWQQAESVGGLPPVTSLHEQLKSLIRWTER
Ga0247275_101091893300029817SoilQQGDNIALQYLGAAVVLQWETLPETVRDAIWQQAESVGGLPPVTSLDEQLKSLIRRTKG
Ga0246001_100457693300029889PeatMPDMTPHILPLQQGDNIALQYLGAAVVLQSETLPETARDAIWQQAESVGGLPPVTSLHEQLKALIRRTKG
Ga0268386_1041232223300030619SoilMPDMSAQVLHLKPGDELTLQYLGAAVILQWDKLPEEARGAIWQQAESVGGLQPVTSLHEQIKALIRRTRG
Ga0075373_1161832713300030945SoilPDMTPHVLSLQQGDDIALQYLGAAVVLQWEALPEAARDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKS
Ga0170823_1661141823300031128Forest SoilMFQSGLGAVKKDSRMPDMTPHVLSLQQGDDIALQYLGAAVVLQWEALPEAARDAIWQPAESVGGLPPVTSLHEQLKSLIRRTKS
Ga0307498_1029995723300031170SoilMPDMTPHVLPLQQGDDIALQYLGAAVVLQWENLPEAARDAIWQQAESVGGLPPVTSLHEQLKSLIRRAKS
Ga0299913_1010889213300031229SoilMPDMSAQVLHLTPGDELTLQYLGAAVILQWDKLPEEARGAIWQQAESVGGLQPVTSLHEQIKALIRRTRG
Ga0299913_1102200213300031229SoilMPDMTAQVLQLEPGDEIALQYLGAAVVLQWDKLPEEAQNAIWQQAESVGGLRPVTSLHEQIKTLLRRTREQALRLS
Ga0307442_104229423300031274Salt MarshMPDMMAQVLHLKQGDEIALWYLGAAVVLQWGSLPEKAQQAILQQANSVGGLPPVTSLNEQIKSLIQRIRD
Ga0311301_1061776363300032160Peatlands SoilPHILPLQQGDDIALQYLGAAVVLQWETLPEAIRDAIWQQAESVGGLPPVTSLHEQLKSLIRRTKS
Ga0326726_1089875423300033433Peat SoilMPDMTAQVLHLKQGDEIVLWYLGAAVVLQWGYLPEEAQQAILQQANSVGGLPPVTSLNEQIKSLIQRIRD
Ga0326723_0435396_375_5873300034090Peat SoilMPDLTAQILHLEPGDEIALQYLGAAVVLQWDALPEKAHQAILQQAVAVGGLRPVTSLPEQIKSLIGRIRN
Ga0364925_0020544_1861_20733300034147SedimentMPDLTAQVLHLEPGDEIALQYLGAAVVLQWDALPEKAQQAILQQAVSVGGLRPVTSLAEQIKSLIGRIRN


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.