| Basic Information | |
|---|---|
| Family ID | F097029 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MTTEIRIEADEARRLKNDTAFKQFMQSVRENQMQVFASSGAADV |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 99.04 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 89.42 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (46.154 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (16.346 % of family members) |
| Environment Ontology (ENVO) | Unclassified (70.192 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (75.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.83% β-sheet: 0.00% Coil/Unstructured: 54.17% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 53.85 % |
| Unclassified | root | N/A | 46.15 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10219234 | Not Available | 622 | Open in IMG/M |
| 3300000973|BBAY93_10120452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 664 | Open in IMG/M |
| 3300001938|GOS2221_1009904 | Not Available | 634 | Open in IMG/M |
| 3300002230|M1t2FKB2103N_1129780 | Not Available | 583 | Open in IMG/M |
| 3300003264|JGI26119J46589_1002363 | Not Available | 2640 | Open in IMG/M |
| 3300003580|JGI26260J51721_1011595 | All Organisms → Viruses → Predicted Viral | 2242 | Open in IMG/M |
| 3300005600|Ga0070726_10631771 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 540 | Open in IMG/M |
| 3300005941|Ga0070743_10022769 | Not Available | 2177 | Open in IMG/M |
| 3300006026|Ga0075478_10236382 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 551 | Open in IMG/M |
| 3300006029|Ga0075466_1095220 | Not Available | 813 | Open in IMG/M |
| 3300006793|Ga0098055_1129671 | Not Available | 977 | Open in IMG/M |
| 3300006803|Ga0075467_10292185 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 870 | Open in IMG/M |
| 3300006803|Ga0075467_10553941 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300006810|Ga0070754_10383097 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 618 | Open in IMG/M |
| 3300006947|Ga0075444_10030932 | All Organisms → Viruses → Predicted Viral | 2675 | Open in IMG/M |
| 3300007229|Ga0075468_10041092 | All Organisms → Viruses → Predicted Viral | 1607 | Open in IMG/M |
| 3300007344|Ga0070745_1280124 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 597 | Open in IMG/M |
| 3300007345|Ga0070752_1245818 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 697 | Open in IMG/M |
| 3300007346|Ga0070753_1187612 | Not Available | 770 | Open in IMG/M |
| 3300007640|Ga0070751_1268722 | Not Available | 643 | Open in IMG/M |
| 3300009071|Ga0115566_10177996 | All Organisms → Viruses → Predicted Viral | 1311 | Open in IMG/M |
| 3300009433|Ga0115545_1062443 | All Organisms → Viruses → Predicted Viral | 1405 | Open in IMG/M |
| 3300009435|Ga0115546_1061508 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1422 | Open in IMG/M |
| 3300009435|Ga0115546_1174722 | Not Available | 750 | Open in IMG/M |
| 3300009436|Ga0115008_10315079 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1110 | Open in IMG/M |
| 3300009437|Ga0115556_1274354 | Not Available | 597 | Open in IMG/M |
| 3300009443|Ga0115557_1171851 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 864 | Open in IMG/M |
| 3300009443|Ga0115557_1210890 | Not Available | 757 | Open in IMG/M |
| 3300009495|Ga0115571_1323712 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 611 | Open in IMG/M |
| 3300009507|Ga0115572_10231815 | All Organisms → Viruses → Predicted Viral | 1060 | Open in IMG/M |
| 3300009508|Ga0115567_10416733 | Not Available | 825 | Open in IMG/M |
| 3300009509|Ga0123573_11927508 | Not Available | 545 | Open in IMG/M |
| 3300010316|Ga0136655_1263216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. | 513 | Open in IMG/M |
| 3300010368|Ga0129324_10426052 | Not Available | 511 | Open in IMG/M |
| 3300011118|Ga0114922_11615443 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 520 | Open in IMG/M |
| 3300011129|Ga0151672_163916 | Not Available | 502 | Open in IMG/M |
| 3300017697|Ga0180120_10207937 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 808 | Open in IMG/M |
| 3300017735|Ga0181431_1157974 | Not Available | 503 | Open in IMG/M |
| 3300017751|Ga0187219_1055048 | All Organisms → Viruses → Predicted Viral | 1304 | Open in IMG/M |
| 3300017751|Ga0187219_1161465 | Not Available | 640 | Open in IMG/M |
| 3300017751|Ga0187219_1191858 | Not Available | 569 | Open in IMG/M |
| 3300017752|Ga0181400_1107395 | Not Available | 816 | Open in IMG/M |
| 3300017771|Ga0181425_1105677 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 901 | Open in IMG/M |
| 3300017776|Ga0181394_1028930 | All Organisms → Viruses → Predicted Viral | 1948 | Open in IMG/M |
| 3300017779|Ga0181395_1178073 | Not Available | 665 | Open in IMG/M |
| 3300017781|Ga0181423_1198255 | Not Available | 761 | Open in IMG/M |
| 3300020187|Ga0206130_10005334 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 15253 | Open in IMG/M |
| 3300021312|Ga0210306_1148608 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 535 | Open in IMG/M |
| 3300021378|Ga0213861_10287199 | Not Available | 851 | Open in IMG/M |
| 3300021958|Ga0222718_10558445 | Not Available | 544 | Open in IMG/M |
| 3300021959|Ga0222716_10190389 | All Organisms → Viruses → Predicted Viral | 1307 | Open in IMG/M |
| 3300021959|Ga0222716_10327570 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 915 | Open in IMG/M |
| 3300021960|Ga0222715_10523667 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 625 | Open in IMG/M |
| 3300022183|Ga0196891_1031118 | All Organisms → Viruses → Predicted Viral | 1001 | Open in IMG/M |
| 3300022308|Ga0224504_10158143 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 931 | Open in IMG/M |
| (restricted) 3300023112|Ga0233411_10088937 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 984 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10062091 | All Organisms → Viruses → Predicted Viral | 1532 | Open in IMG/M |
| (restricted) 3300023276|Ga0233410_10027906 | All Organisms → Viruses → Predicted Viral | 1629 | Open in IMG/M |
| 3300024267|Ga0228623_1071704 | Not Available | 650 | Open in IMG/M |
| 3300024294|Ga0228664_1046570 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1070 | Open in IMG/M |
| 3300024326|Ga0228652_1017224 | Not Available | 2151 | Open in IMG/M |
| 3300024346|Ga0244775_10027487 | Not Available | 5086 | Open in IMG/M |
| 3300024346|Ga0244775_10346942 | Not Available | 1226 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10191349 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 925 | Open in IMG/M |
| 3300025103|Ga0208013_1119648 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 650 | Open in IMG/M |
| 3300025483|Ga0209557_1064012 | Not Available | 870 | Open in IMG/M |
| 3300025543|Ga0208303_1077520 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 743 | Open in IMG/M |
| 3300025641|Ga0209833_1075691 | All Organisms → Viruses → Predicted Viral | 1039 | Open in IMG/M |
| 3300025641|Ga0209833_1175236 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 541 | Open in IMG/M |
| 3300025666|Ga0209601_1217931 | Not Available | 500 | Open in IMG/M |
| 3300025695|Ga0209653_1062245 | Not Available | 1351 | Open in IMG/M |
| 3300025803|Ga0208425_1002958 | Not Available | 5260 | Open in IMG/M |
| 3300025806|Ga0208545_1092088 | Not Available | 807 | Open in IMG/M |
| 3300025849|Ga0209603_1163755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 889 | Open in IMG/M |
| 3300025849|Ga0209603_1262541 | Not Available | 622 | Open in IMG/M |
| 3300025853|Ga0208645_1267421 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 558 | Open in IMG/M |
| 3300025879|Ga0209555_10065125 | All Organisms → Viruses → Predicted Viral | 1614 | Open in IMG/M |
| 3300025880|Ga0209534_10289704 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 760 | Open in IMG/M |
| 3300025892|Ga0209630_10009492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7498 | Open in IMG/M |
| 3300027204|Ga0208924_101838 | Not Available | 1907 | Open in IMG/M |
| 3300027753|Ga0208305_10274348 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 594 | Open in IMG/M |
| 3300027820|Ga0209578_10490889 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 552 | Open in IMG/M |
| 3300027833|Ga0209092_10131995 | Not Available | 1455 | Open in IMG/M |
| 3300027978|Ga0209165_10044038 | All Organisms → Viruses → Predicted Viral | 1588 | Open in IMG/M |
| 3300028109|Ga0247582_1098280 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 764 | Open in IMG/M |
| 3300028284|Ga0257120_1085587 | Not Available | 709 | Open in IMG/M |
| 3300028396|Ga0228643_1042651 | Not Available | 1144 | Open in IMG/M |
| 3300031167|Ga0308023_1038616 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 935 | Open in IMG/M |
| 3300031519|Ga0307488_10355617 | Not Available | 921 | Open in IMG/M |
| 3300031519|Ga0307488_10382505 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 876 | Open in IMG/M |
| 3300031565|Ga0307379_11192331 | Not Available | 632 | Open in IMG/M |
| 3300031569|Ga0307489_11215331 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 544 | Open in IMG/M |
| 3300031599|Ga0308007_10144625 | Not Available | 852 | Open in IMG/M |
| 3300031602|Ga0307993_1041623 | Not Available | 1153 | Open in IMG/M |
| 3300031602|Ga0307993_1187530 | Not Available | 517 | Open in IMG/M |
| 3300031621|Ga0302114_10225599 | Not Available | 773 | Open in IMG/M |
| 3300031658|Ga0307984_1077353 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 994 | Open in IMG/M |
| 3300031658|Ga0307984_1103813 | Not Available | 823 | Open in IMG/M |
| 3300031696|Ga0307995_1191069 | Not Available | 732 | Open in IMG/M |
| 3300031851|Ga0315320_10358285 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1023 | Open in IMG/M |
| 3300032088|Ga0315321_10809558 | Not Available | 531 | Open in IMG/M |
| 3300034374|Ga0348335_004769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 8531 | Open in IMG/M |
| 3300034374|Ga0348335_058432 | All Organisms → Viruses → Predicted Viral | 1431 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 16.35% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 14.42% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 9.62% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 6.73% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 5.77% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 5.77% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 5.77% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.85% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 2.88% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 2.88% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 2.88% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.88% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.88% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.88% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.92% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.92% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.96% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.96% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.96% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.96% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.96% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.96% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.96% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.96% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.96% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000973 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93 | Host-Associated | Open in IMG/M |
| 3300001938 | Marine microbial communities from Bedford Basin, Nova Scotia, Canada - GS005 | Environmental | Open in IMG/M |
| 3300002230 | Marine microbial communities from the Baltic Sea - M1t2 FKB2 (103N) | Environmental | Open in IMG/M |
| 3300003264 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_54_BLW_10 | Environmental | Open in IMG/M |
| 3300003580 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA | Environmental | Open in IMG/M |
| 3300005600 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009437 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 | Environmental | Open in IMG/M |
| 3300009443 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
| 3300009509 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11 | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300011129 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, 0.02 | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017735 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020187 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1 | Environmental | Open in IMG/M |
| 3300021312 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1072 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022308 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300023112 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MG | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300023276 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MG | Environmental | Open in IMG/M |
| 3300024267 | Seawater microbial communities from Monterey Bay, California, United States - 28D | Environmental | Open in IMG/M |
| 3300024294 | Seawater microbial communities from Monterey Bay, California, United States - 78D | Environmental | Open in IMG/M |
| 3300024326 | Seawater microbial communities from Monterey Bay, California, United States - 64D | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025483 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025641 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 (SPAdes) | Environmental | Open in IMG/M |
| 3300025666 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 (SPAdes) | Environmental | Open in IMG/M |
| 3300025695 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025806 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025879 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025880 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300027204 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027753 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes) | Environmental | Open in IMG/M |
| 3300027820 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027833 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027978 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028109 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028284 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI106_10 | Environmental | Open in IMG/M |
| 3300028396 | Seawater microbial communities from Monterey Bay, California, United States - 55D | Environmental | Open in IMG/M |
| 3300031167 | Marine microbial communities from water near the shore, Antarctic Ocean - #418 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031569 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 | Environmental | Open in IMG/M |
| 3300031599 | Marine microbial communities from water near the shore, Antarctic Ocean - #71 | Environmental | Open in IMG/M |
| 3300031602 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #260 | Environmental | Open in IMG/M |
| 3300031621 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_Surface | Environmental | Open in IMG/M |
| 3300031658 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #78 | Environmental | Open in IMG/M |
| 3300031696 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #262 | Environmental | Open in IMG/M |
| 3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
| 3300032088 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515 | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_102192341 | 3300000101 | Marine | MTTEIRIEADEARRLKSDTAFKQFMQSVRENQMQVFASSGAAD |
| BBAY93_101204521 | 3300000973 | Macroalgal Surface | MSADIRIKADEARRLKSDSAFSTFVQEVRDDQIRVFTTSG |
| GOS2221_10099041 | 3300001938 | Marine | VTTEVRIKADEARRLKADSAFSAFVQEVRDEQIKLFADSGAA |
| M1t2FKB2103N_11297803 | 3300002230 | Marine | MANKTEIRIKAEEAKRLKNDPAFKGFMVSVREAQISVFTDSVA |
| JGI26119J46589_10023633 | 3300003264 | Marine | MAQVIRLEAEEARRLKNDTAFQKFVENVREDQMKIFAESSASDVDAREEAHSIV |
| JGI26260J51721_10115952 | 3300003580 | Marine | MTTEIRIEADEARRLKSDTAFQQFMQSVRENQMQVFASSGAADVAAREEAHAMIR |
| Ga0070726_106317711 | 3300005600 | Marine Sediment | MTTEIRIEADEARRLKNDTAFKQFMQGVRENQMQIFASSGAADVAAREEAHAMI |
| Ga0070743_100227691 | 3300005941 | Estuarine | VTTEIRIKADEARRLKADSAFSAFVQDVRDEQMRLFASSGAADVAVREEAHGIIR |
| Ga0075478_102363822 | 3300006026 | Aqueous | MTTEIRIEADEARRLKNDTAFKQFMQSVRENQMQIFA |
| Ga0075466_10952202 | 3300006029 | Aqueous | MTTEIRIKADEARRLKSDSAFLAFMQEVRDGQIKAFADS |
| Ga0098055_11296712 | 3300006793 | Marine | LKNDIRIEAEEARRLKSDTAFKHFLDLVRENQIQAFKSSAAD |
| Ga0075467_102921851 | 3300006803 | Aqueous | MTTEIRIKADEARRLKSDSAFLAFMQEVRDGQIKAFADSG |
| Ga0075467_105539412 | 3300006803 | Aqueous | MITEIRIKADEARRLKSDSAFLAFMQEVRDGQIKAFADSGAA |
| Ga0070754_103830971 | 3300006810 | Aqueous | MTTEIRIEADEARRLKNDTAFKQFMQSVRENQMQIFASSGAADVAAREEAHAIIR |
| Ga0075444_100309321 | 3300006947 | Marine | MTTEIRMKADEARRLKADTSFLSFMQEVRDDQITVFTDSAASD |
| Ga0075468_100410921 | 3300007229 | Aqueous | MTTEIRIEADEARRLKNDTAFKQFMQSVRENQMQVFASSGAADVAAREE |
| Ga0070745_12801241 | 3300007344 | Aqueous | MTTEIRIEADEARRLKNDTAFKQFMQSVRENQMQIFASSGAADVAARE |
| Ga0070752_12458182 | 3300007345 | Aqueous | MTAEIRIEADEARRLKNDTAFKQFMQSVRENQMQIF |
| Ga0070753_11876121 | 3300007346 | Aqueous | MTAEIRIEADEARRLKNDTAFKQFMQSVRENQMQIFASSGAA |
| Ga0070751_12687221 | 3300007640 | Aqueous | MTTEIRIQADEAKRLKNDTAFVRFVDDVRKDQMMIFAHSD |
| Ga0115566_101779962 | 3300009071 | Pelagic Marine | MTTEIRIEADEARRLKNDTAFKQFMQSVRENQMQIFASSGAADVAVREEAHAILRA |
| Ga0115545_10624432 | 3300009433 | Pelagic Marine | MTTEIRIEADEARRLKNDTAFKQFMQSVRENQMQVFASSGAADV |
| Ga0115546_10615081 | 3300009435 | Pelagic Marine | MTTEIRIEADEARRLKNDTAFKQFMQSVRENQMQVFASSGAADVAAREEAH |
| Ga0115546_11747221 | 3300009435 | Pelagic Marine | MTTEIRIEADEARRLKNDTAFKQFMQSVRENQMQIF |
| Ga0115008_103150792 | 3300009436 | Marine | MTTEIRITADEAKRLKNDTAFKQFMQSVRDDQMRLFADSSASDVDVRE |
| Ga0115556_12743541 | 3300009437 | Pelagic Marine | MTTEIRIEADEARRLKNDTAFKQFMQSVRENQMQVFASS |
| Ga0115557_11718512 | 3300009443 | Pelagic Marine | MTTEIRIEADEARRLKNDTAFKQFMQSVRENQMQVFASSGAADVA |
| Ga0115557_12108902 | 3300009443 | Pelagic Marine | MTTEIRIEADEARRLKNDTAFKQFMQSVRENQMQVFASSGAADVVA |
| Ga0115571_13237122 | 3300009495 | Pelagic Marine | MTTEIRIEADEARRLKNDTAFKQFMQSVRENQMQVFAS |
| Ga0115572_102318151 | 3300009507 | Pelagic Marine | MSTEIRIKADEARRLKADTAFLSFVQGVRDDQIKVFT |
| Ga0115567_104167332 | 3300009508 | Pelagic Marine | MTIEIRIEADEARRLKNDTAFKQFMQSVRENQMQIFA |
| Ga0123573_119275081 | 3300009509 | Mangrove Sediment | VTTEVRIKADEARRLKADSAFSAFVQDVRDEQMRLF |
| Ga0136655_12632162 | 3300010316 | Freshwater To Marine Saline Gradient | MTTEIRIKADEARRLKSDSAFLAFMQEVRDGQIKVFADSGAADVAAREEA |
| Ga0129324_104260521 | 3300010368 | Freshwater To Marine Saline Gradient | VTTEVRIKADEARRLKADSAFSAFVQEVRDEQIKLFADSGAAD |
| Ga0114922_116154431 | 3300011118 | Deep Subsurface | MTTEIRIEADEARRLKNDTAFKQFMQSVRENQMQIFASSGAADVAVREEAH |
| Ga0151672_1639161 | 3300011129 | Marine | MTTEIRINADEAKRLKNDTAFKNFMQQVRDDQLRLFA |
| Ga0180120_102079371 | 3300017697 | Freshwater To Marine Saline Gradient | MTTEIRIEADEARRLKNDTAFKQFMQSVRENQMQVFASSGAADLAAREEAHA |
| Ga0181431_11579742 | 3300017735 | Seawater | MSTEIRIKADEARRLKSDTAFLEFMGAVRESQVQAFLSTAAGDAAAREEA |
| Ga0187219_10550481 | 3300017751 | Seawater | MTTEIRIEADEARRLKSDTAFQQFMQSVRENQMQVFASSGAADVA |
| Ga0187219_11614651 | 3300017751 | Seawater | MTTEIRINAEEAKRLKNDTAFKNFMQQVRDDQLRIFADSSASDVDVREDAH |
| Ga0187219_11918581 | 3300017751 | Seawater | MTTEIRINANEAKRLKNDTAFKNFMQQVRDDQMRLFADSS |
| Ga0181400_11073951 | 3300017752 | Seawater | MTTEIRIEADEARRLKSDTAFQQFMQSVHENQMQVFASSGAADV |
| Ga0181425_11056772 | 3300017771 | Seawater | MTTEIRINADEAKRLKNDTAFINFMQQVRDDQMRLFADSSASDVDVR |
| Ga0181394_10289302 | 3300017776 | Seawater | MTTEIRLNANEAKRLKTDTAFKNFMQQVRDDQLRLFADSSA |
| Ga0181395_11780731 | 3300017779 | Seawater | VSADIRIKADEARRLKADSAFSAFVQKVRDDQIMVFTTSEASDVEAREAAH |
| Ga0181423_11982551 | 3300017781 | Seawater | MTTEIRINAEEAKRLKNDTAFKKFMQQVRDDQLRIFADSS |
| Ga0181607_102882121 | 3300017950 | Salt Marsh | MMTTEIRITADEAKRLKADTAFLLFCDHVREEQHRIFADSSAE |
| Ga0206130_100053341 | 3300020187 | Seawater | MTTEIRINANEAKRLKNDTAFKNFMQQVRDDQLRLFADS |
| Ga0210306_11486082 | 3300021312 | Estuarine | MTTETRIKADEARRLKADSAFSAFVQEVRDDQIKVFASSG |
| Ga0213861_102871992 | 3300021378 | Seawater | MTTEIRIEADEARRLKNDTAFKQFMQSVRENQMQIFASSGAADVAA |
| Ga0222718_105584451 | 3300021958 | Estuarine Water | MTTEIRINANEAKRLKNDTAFKNFMQQVRDDQLRLFADSSASDVDVR |
| Ga0222716_101903893 | 3300021959 | Estuarine Water | MTTEIRIEADEARRLKNDTAFQQFMQGVRENQMQVFASSGAADVAAREEAHAMIRALN |
| Ga0222716_103275702 | 3300021959 | Estuarine Water | MTTEIRIEADEARRLKNDTAFKQFMQSVRENQMQIFASSGAADVAAREEAH |
| Ga0222715_105236671 | 3300021960 | Estuarine Water | MTTEIRIEADEARRLKNDTAFKQFMQSVRENQMQIFASSGAADVAAREEAHAII |
| Ga0196891_10311182 | 3300022183 | Aqueous | MTTEIRIEADEARRLKNDTAFKQFMQSVRENQMQIFASSGAADVAAREEAHAIIRA |
| Ga0224504_101581432 | 3300022308 | Sediment | MTTEIRIEADEARRLKSDTAFQQFMQSVRENQMQVFASSGQLT |
| (restricted) Ga0233411_100889372 | 3300023112 | Seawater | MTTEIRIEAEEARRLKNDTAFKQFMQGVRDNQMQVFANSGVADVAAREEAHA |
| (restricted) Ga0233412_100620912 | 3300023210 | Seawater | MKTEIRINANEAKRLKNDTAFKNFMQQVRDDQLRLFADSSASD |
| (restricted) Ga0233410_100279062 | 3300023276 | Seawater | MTTEIRIEAEEARRLKNDTAFKQFMQGVRDNQMQVFANSGVADV |
| Ga0228623_10717042 | 3300024267 | Seawater | MAQVIRLEAEEARRLKNDTAFQKFVENVREDQMKIFAESSA |
| Ga0228664_10465701 | 3300024294 | Seawater | MTTEIRIEADEARRLKGDTAFQQFMQSVRENQMQVFASSGAADVAAREEA |
| Ga0228652_10172241 | 3300024326 | Seawater | MAQVIRLEAEEARRLKNDTAFQKFVENVREDQMKIFAESSASDVDAREEAHS |
| Ga0244775_100274874 | 3300024346 | Estuarine | VTTEIRIKADEARRLKADSAFSAFVQDVRDEQMRLFASSGAADVAVREEAHGIIRAL |
| Ga0244775_103469421 | 3300024346 | Estuarine | MTTEIRINAEEAKRLKNDTAFVHFMQQVRDDQMRIFADSSASDVDVREDAHA |
| (restricted) Ga0255046_101913491 | 3300024519 | Seawater | MTTEIRIEAEEARRLKNDTAFKQFMQGVRDNQMQVFANSGV |
| Ga0208013_11196481 | 3300025103 | Marine | MTTEIRIEADEARRLKNDTAFKQFMQSVRENQMQVFANSGAADVAAR |
| Ga0209557_10640122 | 3300025483 | Marine | MTTEIRIEADEARRLKSDTAFQQFMQSVRENQMQVFASSGAADVAAREEAHAMIRAL |
| Ga0208303_10775203 | 3300025543 | Aqueous | MTTEIRIEADEARRLKNDTAFKQFMQSVRENQMQVFASSGAADVAAREEAHA |
| Ga0209833_10756912 | 3300025641 | Pelagic Marine | MTTEIRIEADEARRLKNDTAFKQFMQSVRENQMQVFASSG |
| Ga0209833_11752363 | 3300025641 | Pelagic Marine | MTTEIRIEADEARRLKNDTAFKQFMQSVRENQMQIFASS |
| Ga0209601_12179311 | 3300025666 | Pelagic Marine | MTTEIRIEADEARRLKSDTAFQQFMQSVRENQMQVFASSGAADVAAREEAHAIIR |
| Ga0209653_10622451 | 3300025695 | Marine | MTTEIRIEAEEARRLKNDTAFKQFMQSVRDNQMQVFANSGVADVSTREEA |
| Ga0208425_10029581 | 3300025803 | Aqueous | MTTEIRIEADEARRLKNDTAFKQFMQSVRENQMQIFASSG |
| Ga0208545_10920881 | 3300025806 | Aqueous | MTTEIRIKADEARRLKSDSAFLAFMQEVRDGQIKAFADSGAAD |
| Ga0209603_11637551 | 3300025849 | Pelagic Marine | MTTKIRITADEAKRLKNDTAFKQFMQSVRDDQMRLFADS |
| Ga0209603_12625411 | 3300025849 | Pelagic Marine | MAQVIRLEAEEAKRLKNDTAFQKFVENVREDQMKIFAESSASDVDVR |
| Ga0208645_12674211 | 3300025853 | Aqueous | MTTEIRIEADEARRLKNDTAFKQFMQSVRENQMQIFASSGAADVAAREEAHAI |
| Ga0209555_100651252 | 3300025879 | Marine | VSADIRIKADEARRLKSDTAFMSFVQEVRDDQIKVFTDSGASDVEAREAAHGIICALN |
| Ga0209534_102897042 | 3300025880 | Pelagic Marine | MTTEIRIEADEARRLKNDTAFKQFMQSVRENQMQV |
| Ga0209630_100094926 | 3300025892 | Pelagic Marine | MTTEIRIEADEARRLKNDTAFKQFMQSVRENQMQVFASSGAAD |
| Ga0208924_1018382 | 3300027204 | Estuarine | MAQVIRLEAEEARRLKNDTAFQKFVENVREDQMKIFAE |
| Ga0208305_102743482 | 3300027753 | Estuarine | MTTETRIKADEARRLKADSAFSAFVQEVRDDQIKVFASSGAADVAVR |
| Ga0209578_104908892 | 3300027820 | Marine Sediment | MTTEIRIEADEARRLKNDTAFKQFMQGVRENQMQIFASSGA |
| Ga0209092_101319951 | 3300027833 | Marine | MTTEIRIEADEARRLKNDTAFKQFMQGVRENQMQIFASSGAADVAAREE |
| Ga0209165_100440382 | 3300027978 | Marine Sediment | MSTEIRIKADEARRLKTDTAFLEFMGAVRESQVQAFLSTAAGDTAAREEAH |
| Ga0247582_10982801 | 3300028109 | Seawater | MTTEIRIEADEARRLKSDTAFQQFMQSVRENQMQVFASSGAADVAAREEAHA |
| Ga0257120_10855872 | 3300028284 | Marine | MAQVIRLEAEEARRLKNDTAFQKFVENVREDQMKIFAES |
| Ga0228643_10426512 | 3300028396 | Seawater | MTTEIRINADEAKRLKNDTAFINFMQQVRDDQMRLFADSSASDVDVRE |
| Ga0308023_10386161 | 3300031167 | Marine | MTTEIRIKADEARRLKADTSFLSFMQEVRDDQIKVFTDSAASDVEAREA |
| Ga0307488_103556173 | 3300031519 | Sackhole Brine | MTTEIRITADEAKRLKNDTAFKQFMQSVRDDQMRLFADSSAS |
| Ga0307488_103825051 | 3300031519 | Sackhole Brine | MTTEIRMEADEARRLKNDTAFQQFVQSVRENQMQIF |
| Ga0307379_111923311 | 3300031565 | Soil | VTTEVRIKADEARRLKADSAFSAFVQEVRDEQIKLFADSGAADVAVR |
| Ga0307489_112153312 | 3300031569 | Sackhole Brine | MTTEIRMEAEEARRLKNDTAFQQFMQSVRDNQMQIFANSGAADV |
| Ga0308007_101446252 | 3300031599 | Marine | MTTEIRIEAQEARRLKDDTAFKQFVQNVREDQMKIFASSGAADVAA |
| Ga0307993_10416231 | 3300031602 | Marine | MTTEIRIKADEARRLKADTSFLSFMQEVRDDQIKVFTDSAASDVEAREAAHGIICALN |
| Ga0307993_11875302 | 3300031602 | Marine | MTTGIRIKADEARRLKTDTSFLSFMQEVRDDQIKVFTDSAASDVEAREAAHGIICALN |
| Ga0302114_102255991 | 3300031621 | Marine | MTTEIRIEADDARRLKHDTAFQQFVQSVRENQMQIFANSGA |
| Ga0307984_10773532 | 3300031658 | Marine | MTTEIRMKADEARRLKADTSFLSFMQEVRDDQITVFTDSAASDVEAREAAH |
| Ga0307984_11038132 | 3300031658 | Marine | MTTEIRMKADEARRLKTDTSFLSFMQEVRDDQIKVFTDSVASDVEARE |
| Ga0307995_11910691 | 3300031696 | Marine | MTTEIRIKADEARRLKADTSFLSFMQEVRDDQIKVFTDSAASDVEAREAAHGI |
| Ga0315320_103582851 | 3300031851 | Seawater | MTTEIRIEADEARRLKSDTAFQQFMQSVRENQMQVFASSG |
| Ga0315321_108095581 | 3300032088 | Seawater | MTTEIRIEADEARRLKSDTAFQQFMQSVRENQMQVFASSGAA |
| Ga0348335_004769_2_151 | 3300034374 | Aqueous | MTTEIRIEADEARRLKNDTAFKQFMQSVRENQMQIFASSGAADVAAREEA |
| Ga0348335_058432_1285_1431 | 3300034374 | Aqueous | MTTEIRIEADEARRLKNDTAFKQFMQSVRENQMQIFASSGAADVAAREE |
| ⦗Top⦘ |