NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F097025

Metagenome Family F097025

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097025
Family Type Metagenome
Number of Sequences 104
Average Sequence Length 44 residues
Representative Sequence FKILNREYSQKDGREELFERERHSEPVAGWHSCALACADS
Number of Associated Samples 85
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.98 %
% of genes near scaffold ends (potentially truncated) 97.12 %
% of genes from short scaffolds (< 2000 bps) 94.23 %
Associated GOLD sequencing projects 74
AlphaFold2 3D model prediction Yes
3D model pTM-score0.16

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.231 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(43.269 % of family members)
Environment Ontology (ENVO) Unclassified
(58.654 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(74.038 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 26.47%    β-sheet: 0.00%    Coil/Unstructured: 73.53%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.16
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF00072Response_reg 4.81
PF04185Phosphoesterase 2.88
PF13088BNR_2 1.92
PF12840HTH_20 0.96
PF00903Glyoxalase 0.96
PF00069Pkinase 0.96
PF11345DUF3147 0.96
PF14417MEDS 0.96
PF13518HTH_28 0.96
PF04191PEMT 0.96
PF01384PHO4 0.96
PF01609DDE_Tnp_1 0.96
PF00313CSD 0.96
PF13620CarboxypepD_reg 0.96
PF01258zf-dskA_traR 0.96
PF08238Sel1 0.96
PF13671AAA_33 0.96
PF13545HTH_Crp_2 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.85
COG3511Phospholipase CCell wall/membrane/envelope biogenesis [M] 2.88
COG0306Phosphate/sulfate permeaseInorganic ion transport and metabolism [P] 0.96
COG1734RNA polymerase-binding transcription factor DksATranscription [K] 0.96
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.96
COG3293TransposaseMobilome: prophages, transposons [X] 0.96
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.96
COG5421TransposaseMobilome: prophages, transposons [X] 0.96
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.96
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.96


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.23 %
UnclassifiedrootN/A5.77 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002558|JGI25385J37094_10158605All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium606Open in IMG/M
3300002558|JGI25385J37094_10172721All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium579Open in IMG/M
3300002560|JGI25383J37093_10071721All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1073Open in IMG/M
3300002562|JGI25382J37095_10146783All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium774Open in IMG/M
3300002908|JGI25382J43887_10212031All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium922Open in IMG/M
3300005175|Ga0066673_10069040All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1831Open in IMG/M
3300005177|Ga0066690_10306338Not Available1073Open in IMG/M
3300005177|Ga0066690_10552080All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium771Open in IMG/M
3300005177|Ga0066690_10916853All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium558Open in IMG/M
3300005178|Ga0066688_10390184All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium903Open in IMG/M
3300005180|Ga0066685_10158136All Organisms → cellular organisms → Bacteria1544Open in IMG/M
3300005180|Ga0066685_10174363All Organisms → cellular organisms → Bacteria1469Open in IMG/M
3300005186|Ga0066676_10721727All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium678Open in IMG/M
3300005447|Ga0066689_10417405All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium840Open in IMG/M
3300005450|Ga0066682_10364529All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium929Open in IMG/M
3300005454|Ga0066687_10382861All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium810Open in IMG/M
3300005455|Ga0070663_100991053All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium730Open in IMG/M
3300005540|Ga0066697_10086308All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1816Open in IMG/M
3300005552|Ga0066701_10343435All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium925Open in IMG/M
3300005552|Ga0066701_10393430All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium858Open in IMG/M
3300005553|Ga0066695_10168041All Organisms → cellular organisms → Bacteria1370Open in IMG/M
3300005555|Ga0066692_10054148All Organisms → cellular organisms → Bacteria → Acidobacteria2241Open in IMG/M
3300005555|Ga0066692_10502320All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium772Open in IMG/M
3300005556|Ga0066707_10658224All Organisms → cellular organisms → Bacteria → Acidobacteria661Open in IMG/M
3300005557|Ga0066704_10551970All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium750Open in IMG/M
3300005561|Ga0066699_10564524All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium816Open in IMG/M
3300005568|Ga0066703_10172543All Organisms → cellular organisms → Bacteria → Acidobacteria1305Open in IMG/M
3300005574|Ga0066694_10156628All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1080Open in IMG/M
3300005575|Ga0066702_10630239All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium642Open in IMG/M
3300005576|Ga0066708_10102809All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1700Open in IMG/M
3300005617|Ga0068859_100607729All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1186Open in IMG/M
3300006032|Ga0066696_10433268All Organisms → cellular organisms → Bacteria860Open in IMG/M
3300006032|Ga0066696_10987560All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium535Open in IMG/M
3300006032|Ga0066696_11092781All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium507Open in IMG/M
3300006794|Ga0066658_10062178All Organisms → cellular organisms → Bacteria1643Open in IMG/M
3300006794|Ga0066658_10906733All Organisms → cellular organisms → Bacteria → Acidobacteria507Open in IMG/M
3300006796|Ga0066665_10619928All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium866Open in IMG/M
3300006796|Ga0066665_10625158All Organisms → cellular organisms → Bacteria861Open in IMG/M
3300006797|Ga0066659_10842751All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium762Open in IMG/M
3300006800|Ga0066660_10441089All Organisms → cellular organisms → Bacteria → Proteobacteria1085Open in IMG/M
3300006854|Ga0075425_101482223All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium766Open in IMG/M
3300007076|Ga0075435_100231893All Organisms → cellular organisms → Bacteria → Acidobacteria1569Open in IMG/M
3300009012|Ga0066710_103538997All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium590Open in IMG/M
3300009012|Ga0066710_103765977All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium569Open in IMG/M
3300009012|Ga0066710_103895340All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Treponemataceae → Treponema → Treponema bryantii559Open in IMG/M
3300009038|Ga0099829_10916884All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium727Open in IMG/M
3300009137|Ga0066709_100716811All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1440Open in IMG/M
3300009137|Ga0066709_104578676All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium505Open in IMG/M
3300009177|Ga0105248_13304155All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium513Open in IMG/M
3300009545|Ga0105237_11206604All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium763Open in IMG/M
3300010360|Ga0126372_10397969All Organisms → cellular organisms → Bacteria1256Open in IMG/M
3300010360|Ga0126372_11315903All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium752Open in IMG/M
3300010366|Ga0126379_11668625All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium742Open in IMG/M
3300010376|Ga0126381_104828748All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300010398|Ga0126383_13643896All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium503Open in IMG/M
3300012096|Ga0137389_11611652All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium545Open in IMG/M
3300012199|Ga0137383_10278370All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1225Open in IMG/M
3300012207|Ga0137381_10292203All Organisms → cellular organisms → Bacteria1419Open in IMG/M
3300012211|Ga0137377_11480952All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium605Open in IMG/M
3300012211|Ga0137377_11787298All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium534Open in IMG/M
3300012349|Ga0137387_10430190All Organisms → cellular organisms → Bacteria957Open in IMG/M
3300012351|Ga0137386_10120890All Organisms → cellular organisms → Bacteria → Acidobacteria1863Open in IMG/M
3300012351|Ga0137386_10423333All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium959Open in IMG/M
3300012357|Ga0137384_11084767All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium642Open in IMG/M
3300012359|Ga0137385_11392427All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium565Open in IMG/M
3300012361|Ga0137360_11131011All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium677Open in IMG/M
3300012929|Ga0137404_11401166All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium645Open in IMG/M
3300012951|Ga0164300_11042260All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium530Open in IMG/M
3300012957|Ga0164303_10272745Not Available982Open in IMG/M
3300012972|Ga0134077_10089776All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1179Open in IMG/M
3300014968|Ga0157379_10478474All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1152Open in IMG/M
3300015359|Ga0134085_10028925All Organisms → cellular organisms → Bacteria2151Open in IMG/M
3300015374|Ga0132255_101853454All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium917Open in IMG/M
3300016319|Ga0182033_11012641All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium739Open in IMG/M
3300017961|Ga0187778_10056531All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2400Open in IMG/M
3300018468|Ga0066662_10245884All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1458Open in IMG/M
3300018468|Ga0066662_11905530Not Available622Open in IMG/M
3300018482|Ga0066669_12462332All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium500Open in IMG/M
3300021362|Ga0213882_10491927All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300021560|Ga0126371_10635399All Organisms → cellular organisms → Bacteria1216Open in IMG/M
3300025922|Ga0207646_10694880All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium910Open in IMG/M
3300026298|Ga0209236_1040073All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2421Open in IMG/M
3300026315|Ga0209686_1075407All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1196Open in IMG/M
3300026323|Ga0209472_1053031All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1736Open in IMG/M
3300026329|Ga0209375_1202994All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium751Open in IMG/M
3300026335|Ga0209804_1088561All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1439Open in IMG/M
3300026342|Ga0209057_1089597All Organisms → cellular organisms → Bacteria1275Open in IMG/M
3300026523|Ga0209808_1101254All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1216Open in IMG/M
3300026528|Ga0209378_1201660Not Available658Open in IMG/M
3300026532|Ga0209160_1309033All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium538Open in IMG/M
3300026538|Ga0209056_10196753All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1480Open in IMG/M
3300026540|Ga0209376_1369521All Organisms → cellular organisms → Bacteria → Acidobacteria538Open in IMG/M
3300026547|Ga0209156_10386755All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium589Open in IMG/M
3300026552|Ga0209577_10617117All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium641Open in IMG/M
3300027727|Ga0209328_10221149All Organisms → cellular organisms → Bacteria → Acidobacteria569Open in IMG/M
3300027748|Ga0209689_1361159All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium555Open in IMG/M
3300031718|Ga0307474_10884217All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium707Open in IMG/M
3300031912|Ga0306921_10367310All Organisms → cellular organisms → Bacteria → Acidobacteria1682Open in IMG/M
3300031941|Ga0310912_10971676All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300031946|Ga0310910_10472146All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium996Open in IMG/M
3300032001|Ga0306922_11292788All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium738Open in IMG/M
3300032001|Ga0306922_12386051All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium505Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil43.27%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil13.46%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil12.50%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.92%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.92%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.92%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.92%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.96%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.96%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.96%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.96%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cmEnvironmentalOpen in IMG/M
3300002560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cmEnvironmentalOpen in IMG/M
3300002562Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300002908Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300021362Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026298Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026315Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes)EnvironmentalOpen in IMG/M
3300026323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)EnvironmentalOpen in IMG/M
3300026329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026342Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes)EnvironmentalOpen in IMG/M
3300026523Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)EnvironmentalOpen in IMG/M
3300026528Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)EnvironmentalOpen in IMG/M
3300026532Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027727Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI25385J37094_1015860513300002558Grasslands SoilILNREYSQKDGREELFERERHSEPVAGWHVCALACAELEHVNR*
JGI25385J37094_1017272113300002558Grasslands SoilTWFKILNRKYSQKDGREELFERERHSEPVPGWHSCALACTELEENA*
JGI25383J37093_1007172123300002560Grasslands SoilKIRNKGYSQMVGREELFERDRHSEPVLGWHSCELACAGVEG*
JGI25382J37095_1014678323300002562Grasslands SoilTWFKIRNREYSQMQGREKLFERERHSEPVPGWHSCDLACASLEV*
JGI25382J43887_1021203133300002908Grasslands SoilSTWFKILNRKYSQKDGREEMFERERHQEPVAGWHACALACAELES*
Ga0066673_1006904043300005175SoilILNREYSQKDGREELFERERHSEPVAGWHSCALACAGVEGN*
Ga0066690_1030633823300005177SoilSTWFKILNREYSQMQGREELFERERHGEPVPGWHSCELACAELEQLDV*
Ga0066690_1055208013300005177SoilSTWFKILNRGYSQMQGREELFERERRQEPVPGWHSCAVACEELNPNIRT*
Ga0066690_1091685313300005177SoilILNREYSQKDGREELFERERHQEPVAGWHSCDFLEAADN*
Ga0066688_1039018413300005178SoilVTEREQSTWYKILNREYSQKDGREELFERERHAEPVPGWHLCDLACVDL*
Ga0066685_1015813613300005180SoilEQSTWFKILNREYSQKEGREELFERERHNEPVAGWHVCDLACAGVEGN*
Ga0066685_1017436313300005180SoilKILNREYSQKDGREELFERERHQEPVPGWHLCDLACVDL*
Ga0066676_1072172723300005186SoilGTRQSTWFKILNREYSQKDGREELFERERHSEPVAGWHVCALACAELEHVNR*
Ga0066689_1041740513300005447SoilENSTWFKIRNRAYSQMQRREELFQRERHREPAPGWHSCDLACASLEAVN*
Ga0066682_1036452913300005450SoilWFKILNREYSQKDGREELFERERHQEPVAGWHVCALACAELEHVNR*
Ga0066687_1038286133300005454SoilQSTWFKILNREYSQKDGREELFERERHSEPVAGWHVCALACAELEHVNR*
Ga0070663_10099105323300005455Corn RhizosphereKNRNYSQMQGREELFERERHQEPVAGWHSCELACAEAEQWINGL*
Ga0070697_10049640113300005536Corn, Switchgrass And Miscanthus RhizosphereTTWFKIKNRNYSQMEGREKLFERERHQEPASGWHCCELACAELEEDYAST*
Ga0066697_1008630813300005540SoilILNREYSQKDGREELFERERRQEPVPGWHLCDLACGNAEQ*
Ga0066701_1034343513300005552SoilSTWFKILNREYSQKDGREELFERERHQEPVPGWHSCAVACEELNPNVRT*
Ga0066701_1039343023300005552SoilFKILNREYSQKDGREELFERERHSEPVAGWHSCALACADS*
Ga0066695_1016804123300005553SoilKILNREYSQKDGREELFERERHSEPVAGWHVCVLACAELERLRR*
Ga0066692_1005414813300005555SoilNREYSQKDGREELFERERHQEPVAGWHSCDFLEAADN*
Ga0066692_1050232013300005555SoilSTWYKILNREYSQKDGREELFERERHSEPVPGWHSCAVACEELNPNVRT*
Ga0066707_1065822413300005556SoilKILNREYSQKDGREELFERERHSEPVAGWHVCALVCEALNG*
Ga0066704_1055197013300005557SoilRNRGYSQMVGRDQLFERDQHKEPVPGWHTCDLACEDAA*
Ga0066699_1056452423300005561SoilWYKIRNPGYSQMVGRNEMFERERHKEPVPGWHTCELACAEAT*
Ga0066703_1017254323300005568SoilYSQKDGREELFERERHQEPVAGWHSCDFLEAADN*
Ga0066694_1015662813300005574SoilLNREYSQKNGREKLFERERHSEPVAGWHVCVLACAELEQVNR*
Ga0066702_1063023923300005575SoilLNREYSQKDGREELFERERHQEPVAGWHSCDFLEAADN*
Ga0066708_1010280913300005576SoilRGYSQMVWREELFDRERHQEPVAGWHVCVLACAELEML*
Ga0068859_10060772943300005617Switchgrass RhizosphereERERTTWFKIRKPKYLQMGGREKLRERHSEPVPGWHSCDLACSEL*
Ga0066696_1043326813300006032SoilWFKILNREYSQKDGREELFERERHNEPVAGWHVCDLACAGVEGN*
Ga0066696_1098756033300006032SoilTWFKILNREYSQKDGREELFERERHQEPVAGWHSCELACAGVGG*
Ga0066696_1109278113300006032SoilEREHSTWYKILNRGYSQKDGREELFERERHSEPVAGRHVCELACADL*
Ga0066658_1006217843300006794SoilWFKILNRGYSQKQGREELFERERHKEPVPGWHRCAIVCADAGVNV*
Ga0066658_1090673313300006794SoilLNRGYSQKDGREELFERERHSEPVAGWHVCVLACEATAE*
Ga0066665_1061992813300006796SoilTTWYKILNPGYSQRLGREELFERDRHKQPVPGWHRCALACAESEEMNA*
Ga0066665_1062515813300006796SoilWYKILNREYSQKDGREELFERERHSEPVAGWHSCSLACAGVEGY*
Ga0066659_1084275123300006797SoilKILNREYSQKDGREDLFERERHSEPVPGWHSCAIACAELEEVSG*
Ga0066659_1161371923300006797SoilFKILNRKYSQKDGREELFERERHSEPVPGWHSCAVACEELNPEELNPNVRT*
Ga0066660_1044108913300006800SoilWYKILNRGYSQKDGREELFERERHSEPVAGWHVCDLVCVDL*
Ga0075425_10148222313300006854Populus RhizosphereWFKILNREYSQKDGREDLFERERHSEPVPGWHDCVLACEALSER*
Ga0075435_10023189353300007076Populus RhizosphereTWFKIKNRNYSQMAGREKLFERDRHREPVPGWHCCELACAEVEYAES*
Ga0066710_10353899723300009012Grasslands SoilEREHSTWFKILNREYSQKDGREDLFERERHSEPVPGWHLCDLACAELEEGAA
Ga0066710_10376597713300009012Grasslands SoilFKILNREYSQKDGREELFERERHSEPVAGWHSCALACADS
Ga0066710_10389534013300009012Grasslands SoilKILNREYSQKDGREELFERERHSEPVAGWHVCVLACAELERLRR
Ga0099829_1091688413300009038Vadose Zone SoilGRTTWFKIKNRAYSQMEGREKLFERERHREPVPGWHSCELACADV*
Ga0066709_10071681113300009137Grasslands SoilYSQKDGREELFDRERHQEPVAGWHSCTIACASLEAADN*
Ga0066709_10457867613300009137Grasslands SoilRSQTTSGAKEGREELFERERHSEPVPGWHSCVLACAELGVNR*
Ga0105248_1330415513300009177Switchgrass RhizosphereFKIKNRNYSQMQGREELFERERHGEPVAGWHSCELACAEVENELSD*
Ga0105237_1120660413300009545Corn RhizosphereIKNRNYSQMQGREELFERERHREPVAGWHSCELACAEVENELSD*
Ga0126372_1039796913300010360Tropical Forest SoilIRNRSYSQMAGREELFERERHSEPMPGWHSSDIACALLEVLS*
Ga0126372_1131590333300010360Tropical Forest SoilWIKILNREYSQKQGREELFERERHKEPVAGWHSCVLTSAELEKAS*
Ga0126379_1166862513300010366Tropical Forest SoilILNPNYSQRVGREERFERDRHQEPVAGWRSCAVACAELEEAVEPNLSKS*
Ga0126381_10482874813300010376Tropical Forest SoilNREYSQKQGREELFERERHREPVAGWHSCVVACEELAK*
Ga0126383_1364389613300010398Tropical Forest SoilYSQIIGREELFERERGSDPVPGWPSCAIASAESK*
Ga0137389_1161165213300012096Vadose Zone SoilSTWFKILNRRYSQIQGREELFDRERHNEPVPGWHSCDLACASLEAVN*
Ga0137383_1027837023300012199Vadose Zone SoilWFKILNRKYSQMQGREKLFERERHQEPVAGWHACALACASLEAADN*
Ga0137381_1029220313300012207Vadose Zone SoilKILNREYSQKDGREELFERERHSEPVPGWDSCALACARAEGG*
Ga0137377_1148095223300012211Vadose Zone SoilFKILNREYSQKDGREDLFERERHSEPVPGWRSCELACAELEERST*
Ga0137377_1178729813300012211Vadose Zone SoilWFKILNREYSQKDGREELFERERHQEPVPGWHSCVLACTRAEG*
Ga0137387_1043019013300012349Vadose Zone SoilNREYSQKDGREELFEREQHSEPVAGWHVCAISCAELEEAS*
Ga0137386_1012089013300012351Vadose Zone SoilKILNREYSQKDGREELFERERHSEPVPGWHACVLACEALSE*
Ga0137386_1042333333300012351Vadose Zone SoilWFKILNRKYSQMQGREELFDRERHQEPVAGWHSCDLACVRAEAG*
Ga0137384_1108476713300012357Vadose Zone SoilREQSTWFKIRNRNYSQMVGREEMFERDRHSEPVAGWHVCDLACAGVEG*
Ga0137385_1139242723300012359Vadose Zone SoilWFKILNRKYSQMQGREELFNREEPVPGWHSCDLACAESES*
Ga0137360_1113101113300012361Vadose Zone SoilWFKIKNRAYSQMEGREKLFERERHREPVPGWHSCELACAEVEQ*
Ga0137404_1140116613300012929Vadose Zone SoilHPTSQSESSTGFKILNREYSQKVGREELFERERHSEPVAGWHACALACAELEHVNR*
Ga0164300_1104226023300012951SoilRTTWFKIKNRNYSHMQGREELFERERHKEPVAGWHACDLACAVVEQ*
Ga0164303_1027274513300012957SoilNRGYSQMQRREELFERERHRERVAGWHSCELDCAEVENA*
Ga0134077_1008977633300012972Grasslands SoilREQSTWFKILNREYSQKDGREELFERERHQEPVAGWHVCALACAELEHVNR*
Ga0157379_1047847413300014968Switchgrass RhizosphereRTTWFKIKNRNYSQMQGREELFNRERHSEPTPGWHTCDLACTEVAS*
Ga0134085_1002892513300015359Grasslands SoilKILNREYSQKDGREELFERERHNEPVAGWHVCAIACAELEEAS*
Ga0132255_10185345433300015374Arabidopsis RhizosphereWFKIKNPKYSQMEGREQLFDRERHQEPAPGWHSCELASAEAEQ*
Ga0182033_1101264113300016319SoilNRGYSQKQGREELFERERRKEPVAGWHSCVIACAELEAAS
Ga0187778_1005653173300017961Tropical PeatlandSNREETTWFKILNRGYSQKQGREELFERERQKEPVPGWHSCAIACAELEAS
Ga0066662_1024588413300018468Grasslands SoilKKSTWFKILNRKYSQKDGREEMFERERHQEPVAGWHACALACAELES
Ga0066662_1190553013300018468Grasslands SoilWFKVLNREYSQKQGREELFERERHKEPVPGWHRCVIACAEAGVGV
Ga0066669_1246233223300018482Grasslands SoilWFKILNRGYSQKDGREELFDRDRHQEPVAGWHSCTIACASLEAADN
Ga0213882_1049192713300021362Exposed RockFKIRNRSYSQWIGREQLFDRDRHQEPVAGWHNCTLAAAVVEG
Ga0126371_1063539913300021560Tropical Forest SoilKILNPNYSQRVGREELFERDRHKEPVAGWHSCAVARAELEEAV
Ga0207646_1069488023300025922Corn, Switchgrass And Miscanthus RhizosphereFKILNREYSQKDGREELFERERHQEPVAGWHCCAIGCTELES
Ga0209236_104007353300026298Grasslands SoilFKILNREYSQKDGREELFKRERHQEPVAGWHSCDLACASLEGVASMPERR
Ga0209686_107540733300026315SoilWFKILNREYSQKDGREELFERERHSEPVAGWHVCALACAELEHVNR
Ga0209472_105303133300026323SoilQSTWFKIRNKGYSQMVGREELLERDRHSEPVLGWHSCELACAGVEG
Ga0209375_120299433300026329SoilYKILNREYSQMQGREELFDRERHSEPVAGWHSCDLACVRAEAG
Ga0209804_108856133300026335SoilNRGYSQKDGREELFERERHQEPVAGWHSCELACAGVGG
Ga0209057_108959713300026342SoilNREYSQKDGREELFERERHNEPVAGWHVCDLACAGVEGN
Ga0209808_110125413300026523SoilIRNRGYSQMVWREELFDRERHQEPVAGWHVCVLACAELEML
Ga0209378_120166013300026528SoilSTWFKILNRGYSQMQGREELFERERHSEPVAGWHSWELACAELEHINAETRKLLL
Ga0209160_130903313300026532SoilNCKAKNSTWFKILNRKYSQKDGREEMFERERHQEPVAGWHACALACAELES
Ga0209056_1019675333300026538SoilLNREYSQKDGREELFERERHQEPVAGWHSCVLACGNAEQ
Ga0209376_136952123300026540SoilWYKILNREYSQKDGREELFERERHQEPVPGWHLCDLACVDL
Ga0209156_1038675513300026547SoilNREYSQKDGREELFERERHQEPVAGWHSCVLVCAGVEG
Ga0209577_1061711723300026552SoilWYKILNRGYSQKDGREELFERERHSEPVAGWHVCDLVCVDL
Ga0209328_1022114913300027727Forest SoilTWIKIKNRSYSQSVGLEKLFERERHREPVPGWHSCELACELEHA
Ga0209689_136115913300027748SoilTWFKILNREYSQKDGKEELFERERHQEPVPGWHSCVLACVGLEAATRTL
Ga0307474_1088421713300031718Hardwood Forest SoilNRDYSQMQGREELFERDRHEEPVPGWHTCELACAEMERAYA
Ga0306921_1036731033300031912SoilVARQFKIRNREYSQMAGREELFERERHQEPVAGWHACTVACAALEEAS
Ga0310912_1097167613300031941SoilMTVKILNRGYSQKQGREELFERDRHKEPVPGWHCCTIACAESESTA
Ga0310910_1047214633300031946SoilTWAKILNRGYSQKQGREELFERERRKEPVAGWHSCVIACAELEAAS
Ga0306922_1129278813300032001SoilMASYAARAGSSTWAKILNRGYSQKQGREELFERERRKEPVAGWHSCVIACAELEA
Ga0306922_1238605113300032001SoilNREYSQMVGREELFERKRHQEPVAGWHACILACVEAVALVREWPQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.