| Basic Information | |
|---|---|
| Family ID | F096995 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 42 residues |
| Representative Sequence | ALWQAKTSEDIVKNSVERVTNLPGIFKSETLLAYAPFFKA |
| Number of Associated Samples | 76 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Archaea |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 85.58 % |
| Associated GOLD sequencing projects | 61 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Archaea (83.654 % of family members) |
| NCBI Taxonomy ID | 2157 |
| Taxonomy | All Organisms → cellular organisms → Archaea |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (35.577 % of family members) |
| Environment Ontology (ENVO) | Unclassified (59.615 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (61.538 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.50% β-sheet: 0.00% Coil/Unstructured: 72.50% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF01909 | NTP_transf_2 | 7.69 |
| PF02627 | CMD | 6.73 |
| PF00583 | Acetyltransf_1 | 6.73 |
| PF14622 | Ribonucleas_3_3 | 4.81 |
| PF13508 | Acetyltransf_7 | 4.81 |
| PF08818 | DUF1801 | 3.85 |
| PF07992 | Pyr_redox_2 | 1.92 |
| PF10437 | Lip_prot_lig_C | 0.96 |
| PF03099 | BPL_LplA_LipB | 0.96 |
| PF13183 | Fer4_8 | 0.96 |
| PF02313 | Fumarate_red_D | 0.96 |
| PF13360 | PQQ_2 | 0.96 |
| PF02852 | Pyr_redox_dim | 0.96 |
| PF00202 | Aminotran_3 | 0.96 |
| PF04307 | YdjM | 0.96 |
| PF07282 | OrfB_Zn_ribbon | 0.96 |
| PF00118 | Cpn60_TCP1 | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 6.73 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 6.73 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 3.85 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 3.85 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 3.85 |
| COG0095 | Lipoate-protein ligase A | Coenzyme transport and metabolism [H] | 0.96 |
| COG0321 | Lipoate-protein ligase B | Coenzyme transport and metabolism [H] | 0.96 |
| COG0340 | Biotin-protein ligase | Coenzyme transport and metabolism [H] | 0.96 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.96 |
| COG1988 | Membrane-bound metal-dependent hydrolase YbcI, DUF457 family | General function prediction only [R] | 0.96 |
| COG3080 | Fumarate reductase subunit D | Energy production and conversion [C] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.27 % |
| Unclassified | root | N/A | 6.73 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002558|JGI25385J37094_10115619 | All Organisms → cellular organisms → Archaea | 773 | Open in IMG/M |
| 3300002560|JGI25383J37093_10088388 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300002562|JGI25382J37095_10050803 | All Organisms → cellular organisms → Archaea | 1596 | Open in IMG/M |
| 3300002908|JGI25382J43887_10214687 | All Organisms → cellular organisms → Archaea | 914 | Open in IMG/M |
| 3300002911|JGI25390J43892_10127267 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 585 | Open in IMG/M |
| 3300002916|JGI25389J43894_1066393 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300005172|Ga0066683_10776548 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 559 | Open in IMG/M |
| 3300005174|Ga0066680_10602551 | All Organisms → cellular organisms → Archaea | 687 | Open in IMG/M |
| 3300005180|Ga0066685_10834628 | All Organisms → cellular organisms → Archaea → TACK group | 621 | Open in IMG/M |
| 3300005181|Ga0066678_10152832 | All Organisms → cellular organisms → Bacteria | 1445 | Open in IMG/M |
| 3300005445|Ga0070708_100098239 | All Organisms → cellular organisms → Archaea | 2677 | Open in IMG/M |
| 3300005446|Ga0066686_10653931 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 713 | Open in IMG/M |
| 3300005447|Ga0066689_10879496 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 554 | Open in IMG/M |
| 3300005468|Ga0070707_100055469 | All Organisms → cellular organisms → Bacteria | 3799 | Open in IMG/M |
| 3300005554|Ga0066661_10579107 | All Organisms → cellular organisms → Archaea | 668 | Open in IMG/M |
| 3300005554|Ga0066661_10887539 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 521 | Open in IMG/M |
| 3300005557|Ga0066704_10060197 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2420 | Open in IMG/M |
| 3300005557|Ga0066704_10207747 | All Organisms → cellular organisms → Archaea | 1325 | Open in IMG/M |
| 3300005558|Ga0066698_10404868 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300005559|Ga0066700_10597576 | All Organisms → cellular organisms → Archaea | 769 | Open in IMG/M |
| 3300005559|Ga0066700_10933805 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 574 | Open in IMG/M |
| 3300005568|Ga0066703_10078269 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1908 | Open in IMG/M |
| 3300005586|Ga0066691_10613835 | All Organisms → cellular organisms → Archaea | 646 | Open in IMG/M |
| 3300006796|Ga0066665_10016631 | All Organisms → cellular organisms → Bacteria | 4482 | Open in IMG/M |
| 3300006796|Ga0066665_10109403 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2041 | Open in IMG/M |
| 3300006796|Ga0066665_10355334 | All Organisms → cellular organisms → Archaea | 1197 | Open in IMG/M |
| 3300006796|Ga0066665_10910871 | All Organisms → cellular organisms → Archaea | 680 | Open in IMG/M |
| 3300006797|Ga0066659_10108410 | All Organisms → cellular organisms → Archaea | 1904 | Open in IMG/M |
| 3300006797|Ga0066659_10396464 | All Organisms → cellular organisms → Archaea | 1084 | Open in IMG/M |
| 3300006797|Ga0066659_10596292 | All Organisms → cellular organisms → Archaea | 896 | Open in IMG/M |
| 3300006797|Ga0066659_10661864 | All Organisms → cellular organisms → Archaea | 851 | Open in IMG/M |
| 3300007265|Ga0099794_10099758 | All Organisms → cellular organisms → Archaea | 1449 | Open in IMG/M |
| 3300007265|Ga0099794_10293560 | All Organisms → cellular organisms → Archaea | 841 | Open in IMG/M |
| 3300009012|Ga0066710_100206851 | All Organisms → cellular organisms → Bacteria | 2799 | Open in IMG/M |
| 3300009012|Ga0066710_100784911 | All Organisms → cellular organisms → Archaea | 1459 | Open in IMG/M |
| 3300009012|Ga0066710_101140825 | All Organisms → cellular organisms → Archaea | 1206 | Open in IMG/M |
| 3300009012|Ga0066710_103264709 | All Organisms → cellular organisms → Archaea → TACK group | 621 | Open in IMG/M |
| 3300009038|Ga0099829_11367075 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 585 | Open in IMG/M |
| 3300009089|Ga0099828_10131820 | All Organisms → cellular organisms → Archaea | 2195 | Open in IMG/M |
| 3300009090|Ga0099827_10215587 | All Organisms → cellular organisms → Archaea | 1602 | Open in IMG/M |
| 3300009137|Ga0066709_100042559 | All Organisms → cellular organisms → Bacteria | 5011 | Open in IMG/M |
| 3300009137|Ga0066709_101031660 | All Organisms → cellular organisms → Archaea | 1206 | Open in IMG/M |
| 3300009137|Ga0066709_104193866 | All Organisms → cellular organisms → Archaea | 525 | Open in IMG/M |
| 3300010087|Ga0127492_1089991 | All Organisms → cellular organisms → Archaea | 525 | Open in IMG/M |
| 3300010142|Ga0127483_1022036 | Not Available | 695 | Open in IMG/M |
| 3300011270|Ga0137391_10849251 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 750 | Open in IMG/M |
| 3300011270|Ga0137391_11014501 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 675 | Open in IMG/M |
| 3300011270|Ga0137391_11115201 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 637 | Open in IMG/M |
| 3300011271|Ga0137393_11181824 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 649 | Open in IMG/M |
| 3300012096|Ga0137389_10892800 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 763 | Open in IMG/M |
| 3300012198|Ga0137364_11140663 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 586 | Open in IMG/M |
| 3300012198|Ga0137364_11439254 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 509 | Open in IMG/M |
| 3300012199|Ga0137383_10135707 | All Organisms → cellular organisms → Archaea | 1798 | Open in IMG/M |
| 3300012199|Ga0137383_10952306 | Not Available | 627 | Open in IMG/M |
| 3300012199|Ga0137383_11150888 | Not Available | 560 | Open in IMG/M |
| 3300012201|Ga0137365_10595499 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8 | 810 | Open in IMG/M |
| 3300012203|Ga0137399_10847438 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 770 | Open in IMG/M |
| 3300012204|Ga0137374_11128325 | All Organisms → cellular organisms → Archaea | 555 | Open in IMG/M |
| 3300012206|Ga0137380_10755415 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 841 | Open in IMG/M |
| 3300012209|Ga0137379_10894643 | Not Available | 792 | Open in IMG/M |
| 3300012211|Ga0137377_10372114 | All Organisms → cellular organisms → Archaea | 1366 | Open in IMG/M |
| 3300012211|Ga0137377_11894059 | Not Available | 514 | Open in IMG/M |
| 3300012349|Ga0137387_11263994 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 518 | Open in IMG/M |
| 3300012351|Ga0137386_10600196 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 792 | Open in IMG/M |
| 3300012359|Ga0137385_10051818 | Not Available | 3668 | Open in IMG/M |
| 3300012361|Ga0137360_10486941 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1048 | Open in IMG/M |
| 3300012361|Ga0137360_10939199 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 746 | Open in IMG/M |
| 3300012363|Ga0137390_10404452 | All Organisms → cellular organisms → Archaea | 1343 | Open in IMG/M |
| 3300012379|Ga0134058_1209584 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 996 | Open in IMG/M |
| 3300012407|Ga0134050_1239903 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 504 | Open in IMG/M |
| 3300012918|Ga0137396_10124834 | All Organisms → cellular organisms → Archaea | 1857 | Open in IMG/M |
| 3300012918|Ga0137396_10390279 | All Organisms → cellular organisms → Archaea | 1032 | Open in IMG/M |
| 3300012927|Ga0137416_11444765 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 624 | Open in IMG/M |
| 3300012927|Ga0137416_11556291 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 601 | Open in IMG/M |
| 3300012976|Ga0134076_10330850 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 666 | Open in IMG/M |
| 3300012977|Ga0134087_10314228 | All Organisms → cellular organisms → Archaea → TACK group | 738 | Open in IMG/M |
| 3300012977|Ga0134087_10519662 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 602 | Open in IMG/M |
| 3300014154|Ga0134075_10068987 | All Organisms → cellular organisms → Archaea | 1475 | Open in IMG/M |
| 3300015358|Ga0134089_10156112 | All Organisms → cellular organisms → Archaea | 903 | Open in IMG/M |
| 3300018433|Ga0066667_10029916 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 3046 | Open in IMG/M |
| 3300018433|Ga0066667_12256305 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 508 | Open in IMG/M |
| 3300018468|Ga0066662_11366408 | All Organisms → cellular organisms → Archaea | 731 | Open in IMG/M |
| 3300021046|Ga0215015_10074733 | All Organisms → cellular organisms → Archaea | 1312 | Open in IMG/M |
| 3300025922|Ga0207646_10633263 | All Organisms → cellular organisms → Archaea | 959 | Open in IMG/M |
| 3300026296|Ga0209235_1140327 | All Organisms → cellular organisms → Archaea | 981 | Open in IMG/M |
| 3300026298|Ga0209236_1191631 | All Organisms → cellular organisms → Archaea | 787 | Open in IMG/M |
| 3300026309|Ga0209055_1008259 | All Organisms → cellular organisms → Bacteria | 5703 | Open in IMG/M |
| 3300026309|Ga0209055_1035653 | All Organisms → cellular organisms → Archaea | 2235 | Open in IMG/M |
| 3300026310|Ga0209239_1187269 | All Organisms → cellular organisms → Archaea | 769 | Open in IMG/M |
| 3300026313|Ga0209761_1112859 | All Organisms → cellular organisms → Archaea | 1334 | Open in IMG/M |
| 3300026317|Ga0209154_1053146 | All Organisms → cellular organisms → Archaea | 1800 | Open in IMG/M |
| 3300026325|Ga0209152_10008392 | All Organisms → cellular organisms → Archaea | 3646 | Open in IMG/M |
| 3300026326|Ga0209801_1105115 | All Organisms → cellular organisms → Archaea | 1219 | Open in IMG/M |
| 3300026332|Ga0209803_1024898 | All Organisms → cellular organisms → Bacteria | 2905 | Open in IMG/M |
| 3300026529|Ga0209806_1058303 | All Organisms → cellular organisms → Archaea | 1784 | Open in IMG/M |
| 3300026532|Ga0209160_1158560 | All Organisms → cellular organisms → Archaea | 1016 | Open in IMG/M |
| 3300026540|Ga0209376_1372910 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 535 | Open in IMG/M |
| 3300027643|Ga0209076_1090066 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 872 | Open in IMG/M |
| 3300027748|Ga0209689_1357060 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 559 | Open in IMG/M |
| 3300027846|Ga0209180_10104052 | All Organisms → cellular organisms → Archaea | 1620 | Open in IMG/M |
| 3300027882|Ga0209590_10454587 | All Organisms → cellular organisms → Archaea | 828 | Open in IMG/M |
| 3300028536|Ga0137415_10120813 | All Organisms → cellular organisms → Archaea | 2465 | Open in IMG/M |
| 3300028536|Ga0137415_10349733 | All Organisms → cellular organisms → Archaea | 1281 | Open in IMG/M |
| 3300028792|Ga0307504_10353835 | Not Available | 567 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 35.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 31.73% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 19.23% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 8.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010087 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010142 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012379 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012407 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25385J37094_101156192 | 3300002558 | Grasslands Soil | ALWQAKTSEEIVKNSVERVTTLPGVFKSETLLAYAPFFKA* |
| JGI25383J37093_100883881 | 3300002560 | Grasslands Soil | GQFDIVALWQAKTSEDIVKNTVERVTTLPGIFKSETLLAYAPFFKA* |
| JGI25382J37095_100508032 | 3300002562 | Grasslands Soil | LWQAKTSEDIVKNSVERVTNLPGIFKSETLLAYAPFFKA* |
| JGI25382J43887_102146871 | 3300002908 | Grasslands Soil | PGQFDIVALWQAKTSEEIVKNSVERVTNLPGIFKSETLLAYAPFFKA* |
| JGI25390J43892_101272672 | 3300002911 | Grasslands Soil | QFDIVALWQARTSEDIVKNSFEKVTNLQGLFSSETLLAHLPFFNA* |
| JGI25389J43894_10663932 | 3300002916 | Grasslands Soil | VPGQFDIVALWQAKTSEEIVKNTVERVTTLPGIFKSETLLAYAPFFKA* |
| Ga0066683_107765482 | 3300005172 | Soil | DIVALWQARTSEDIVKNSFEKVTNLQGLFSSETLLAHLPFFNA* |
| Ga0066680_106025512 | 3300005174 | Soil | ALWQAKTSEDIVKNSVERVTNLPGIFKSETLLAYAPFFKA* |
| Ga0066685_108346281 | 3300005180 | Soil | LWQARTSEDIVKTSVERVSQLDGIFKSETLLAYAPFFKA* |
| Ga0066678_101528323 | 3300005181 | Soil | TVPGQFDIVALWQAKTSEEIVKNSVERVTTLPGVFKSETLLAYAPFFKA* |
| Ga0070708_1000982391 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | TVPGQFDIVALWQAKTSEDIVKNSVERVTNLQGIFKSETLLAYAPFFKA* |
| Ga0066686_106539312 | 3300005446 | Soil | VALWQARTSEDIVKTSVEKVSNLEGIFHSETLLAYAPFFKA* |
| Ga0066689_108794961 | 3300005447 | Soil | VALWQAKTSEEIVKNTVERVTTLPGIFKSETLLAYSPFFKA* |
| Ga0070707_1000554697 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | STVPGQFDIVALWQAKTSEDIVKNSVERVTNLQGIFKSETLLAYAPFFKA* |
| Ga0066661_105791071 | 3300005554 | Soil | TSEDIVKNSFEKVTNLQGLFSSETLLAHLPFFNA* |
| Ga0066661_108875391 | 3300005554 | Soil | WQAKTSEEIVKNTVERVTTLPGIFKSETLLAYAPFFKA* |
| Ga0066704_100601971 | 3300005557 | Soil | ARTSEDIVKTSVERVSHLDGIFKSETLLAYAPFFKA* |
| Ga0066704_102077473 | 3300005557 | Soil | RTSEDIVKTSVERVSNLEGIFKSETLLAYAPFFKA* |
| Ga0066698_104048681 | 3300005558 | Soil | VPGQFDIVALWQAKTSEEIVKTSVERVSHLDGIFKSETILAYTPVFKA* |
| Ga0066700_105975761 | 3300005559 | Soil | GQFDIVALWQAKTSEEIVKNSVERVTTLPGVFKSETLLAYAPFFKA* |
| Ga0066700_109338051 | 3300005559 | Soil | QARTSEDIVKTSVERVSHLDGIFKSETLLAYAPFFKA* |
| Ga0066703_100782694 | 3300005568 | Soil | RTSEDIVKTSVERVSNLPGIFKSETLLAYAPFFKA* |
| Ga0066691_106138352 | 3300005586 | Soil | QFDIVALWQAKTSEEIVKNSVERVTTLPGVFKSETLLA* |
| Ga0066665_100166311 | 3300006796 | Soil | QFDIVALWQAKTSEEIVKNTVERVTTLPGIFKSETLLAYSPFFKA* |
| Ga0066665_101094035 | 3300006796 | Soil | WQAKTSEEIVKTSVERVSHLDGIFKSETILAYTPVFKA* |
| Ga0066665_103553343 | 3300006796 | Soil | ALWQAKTSEDIVKNTVERVTTLPGIFKSETLLAYAPFFKA* |
| Ga0066665_109108712 | 3300006796 | Soil | ALWQAKTSEEIVKNTVERVTTLPGIFKSETLLAYAPFFKA* |
| Ga0066659_101084105 | 3300006797 | Soil | WQARTSEDIVKTSVERVSNLPGIFKSETLLAYAPFFKA* |
| Ga0066659_103964642 | 3300006797 | Soil | TSEDIMKNSVERITNLPGLFHSETLLAYAPFFKA* |
| Ga0066659_105962922 | 3300006797 | Soil | TSEEIVKNTVERVTTLPGIFKSETLLAYAPFFKA* |
| Ga0066659_106618641 | 3300006797 | Soil | ALWQARTSEDIVKTSVERVSHLDGIFKSETLLAYAPFFKA* |
| Ga0099794_100997581 | 3300007265 | Vadose Zone Soil | TVPGQFDIVALWQAKTSEDIVKNSVERVTNLPGIFKSETLLAYAPFFKA* |
| Ga0099794_102935602 | 3300007265 | Vadose Zone Soil | WQARTSEDIVKTSVERVSNLEGIFKSETLLAYAPFFKA* |
| Ga0066710_1002068515 | 3300009012 | Grasslands Soil | WQAKTSEEIVKTSVERVSHLDGIFKSETILAYTPVFKA |
| Ga0066710_1007849111 | 3300009012 | Grasslands Soil | LWQARTSEDIVKTSIERVSNLEGIFKSETLLAYAPFFKA |
| Ga0066710_1011408251 | 3300009012 | Grasslands Soil | ALWQAKTSEEIVKNTVERVTTLPGIFKSETLLAYSPFFKA |
| Ga0066710_1032647092 | 3300009012 | Grasslands Soil | LWQARTSEDIVKTSVERVSQLDGIFKSETLLAYAPFFKA |
| Ga0099829_113670751 | 3300009038 | Vadose Zone Soil | WQARTSEDIVKTSVEKVSNLEGIFKSETLLAYAPFFKA* |
| Ga0099828_101318201 | 3300009089 | Vadose Zone Soil | WQAKTSEDIVKNSVERVTGLQGIFKSETLLAYAPFFKA* |
| Ga0099827_102155873 | 3300009090 | Vadose Zone Soil | QARTSEDIVKTSVERVSNLEGIFKSETLLAYAPFFKA* |
| Ga0066709_1000425597 | 3300009137 | Grasslands Soil | ALWQAKTSEEIVKNTVERVTTLPGVFKSETLLAYAPFFKA* |
| Ga0066709_1010316601 | 3300009137 | Grasslands Soil | ALWQAKTSEEIVKNTVERVTTLPGIFKSETLLAYSPFFKA* |
| Ga0066709_1041938662 | 3300009137 | Grasslands Soil | QAKTSEEIVKNTVERVTTLPGIFKSETLLAYAPFFKA* |
| Ga0127492_10899911 | 3300010087 | Grasslands Soil | TSEDIVKNSVERVTNLPGIFKSETLLAYAPFFKA* |
| Ga0127483_10220361 | 3300010142 | Grasslands Soil | ALWQARTSEEIVKTSVERVTNLPGIFKSETLLAYAPFFKA* |
| Ga0137391_108492511 | 3300011270 | Vadose Zone Soil | PGQFDIVALWQAKTSEDIVKNSVERVTSLQGIFKSETLLAYAPFFKA* |
| Ga0137391_110145011 | 3300011270 | Vadose Zone Soil | VPGQFDIVALWQAKTSEDIVKNSVERVTNLPGIFKSETLLAYSPFFKA* |
| Ga0137391_111152011 | 3300011270 | Vadose Zone Soil | PGQFDIVALWQAKTSEDIVKNSVERVTSLQGIFKSETLLAYSPFFKA* |
| Ga0137393_111818241 | 3300011271 | Vadose Zone Soil | GQFDIVALWQAKTSEDIVKNSAERATNLQGIFKSETLLAYSPFFKA* |
| Ga0137389_108928001 | 3300012096 | Vadose Zone Soil | VALWQAKTSEDIVKNSVERVTNLQGIFHSETLLAYAPFFKA* |
| Ga0137364_111406631 | 3300012198 | Vadose Zone Soil | QFDIVALWQAKTSEEIVKNSVERVTTLPGVFKSETLLAYAPFFKA* |
| Ga0137364_114392541 | 3300012198 | Vadose Zone Soil | QAKTSEEIVKNSVERVTTLPGVFKSETLLAYAPFFKA* |
| Ga0137383_101357071 | 3300012199 | Vadose Zone Soil | QFDIVALWQAKTSEEIVKNSVERVTTLPGVFKSETLLAYAPFFNA* |
| Ga0137383_109523061 | 3300012199 | Vadose Zone Soil | QARTSEDIVKNSFEKVTNLQGLFSSETLLAHLPFFNA* |
| Ga0137383_111508881 | 3300012199 | Vadose Zone Soil | TSEDIVKTSVEKVSNLEGIFHSETLLAYAPFFKA* |
| Ga0137365_105954991 | 3300012201 | Vadose Zone Soil | ALWQAKTSEEIVKTSVERVSHLDGIFKSETILAYTPVFKA* |
| Ga0137399_108474381 | 3300012203 | Vadose Zone Soil | PGQFDIVALWQARTSEDIVKTSVEKVSHLDGIFRSETLLAYAPFFKA* |
| Ga0137374_111283252 | 3300012204 | Vadose Zone Soil | DIVALWQARTSEEIMKNSVERFTNLQGLFHSETLLAFAPFFKA* |
| Ga0137380_107554151 | 3300012206 | Vadose Zone Soil | LWQARTSEDIVKTSVEKVSNLEGIFHSETLLAYAPFFKA* |
| Ga0137379_108946431 | 3300012209 | Vadose Zone Soil | ARTSEDIVKTSVEKVSNLEGIFHSETLLAYAPFFKA* |
| Ga0137377_103721141 | 3300012211 | Vadose Zone Soil | IVALWQAKTSEEIVKNSVERVTTLPGVFKSETLLAYAPFFNA* |
| Ga0137377_118940591 | 3300012211 | Vadose Zone Soil | WQARTSEDIVKNSFEKVTNLQGLFSSETLLAHLPFFNA* |
| Ga0137387_112639941 | 3300012349 | Vadose Zone Soil | GQFDIVALWQARTSEDIMKNSVERITNLPGLFHSETLLAYAPFFKA* |
| Ga0137386_106001962 | 3300012351 | Vadose Zone Soil | WQAKTSEDIVKNSVERVTTLPGIFKSETLLAYAPFFKA* |
| Ga0137385_100518188 | 3300012359 | Vadose Zone Soil | WQAKTSEEIVKTSVERVSHLDGIFKSETILAYTPVFNA* |
| Ga0137360_104869414 | 3300012361 | Vadose Zone Soil | QARTSEDIVKTSVERVSHLDGIFKSETILAYTPVFKA* |
| Ga0137360_109391991 | 3300012361 | Vadose Zone Soil | FDIVALWQAKTSEDIVKNSVERVTNLPGIFKSETLLAYSPFFKA* |
| Ga0137390_104044521 | 3300012363 | Vadose Zone Soil | VPGQFDIVALWQAKTSEDIVKNSVERVTNLQGIFKSETLLAYSPFFKA* |
| Ga0134058_12095841 | 3300012379 | Grasslands Soil | GQFDIVALWQARTSEDIVKQSVEKVSNLEGIFHGETLLAYAPFFKA* |
| Ga0134050_12399031 | 3300012407 | Grasslands Soil | TTVPGQFDIVALWQAKTSEEIVKNTVERVTTLPGVFKSETLLAYAPFFKA* |
| Ga0137396_101248344 | 3300012918 | Vadose Zone Soil | DIVALWQAKTSEDIVKNSVERVTNLQGIFHSETLLAYAPFFKA* |
| Ga0137396_103902791 | 3300012918 | Vadose Zone Soil | QFDIVALWQAKTSEDIVKNSVERVTNLPGIFKSETLLAYAPFFKA* |
| Ga0137416_114447651 | 3300012927 | Vadose Zone Soil | ARTSEDIVKTSVERVSNLEGIFKSETLLAYAPFFKA* |
| Ga0137416_115562911 | 3300012927 | Vadose Zone Soil | FDIVALWQAKTSEDIVKNSVERVTNLQGIFKSETLLAYAPFFKA* |
| Ga0134076_103308502 | 3300012976 | Grasslands Soil | WQAKTSEDIVKNSLERVTNLPGIFKSETLLAYAPFFKA* |
| Ga0134087_103142281 | 3300012977 | Grasslands Soil | QARTSEDIVKTSVERVSQLDGIFKSETLLAYAPFFKA* |
| Ga0134087_105196622 | 3300012977 | Grasslands Soil | STVPGQFDIVALWQAKTSEEIVKTSVERVSHLDGIFKSETILAYTPVFKA* |
| Ga0134075_100689875 | 3300014154 | Grasslands Soil | GQFDIVALWQARTSEDIVKTSVERVSQLDGIFKSETLLAYAPFFKA* |
| Ga0134089_101561122 | 3300015358 | Grasslands Soil | RTSEDIVKTSVEKVTNLEGIFKSETLLAYAPFFKA* |
| Ga0066667_100299164 | 3300018433 | Grasslands Soil | WQAKTSEEIVKTSVERVSHLDGIFKSETVLAYTPVFKA |
| Ga0066667_122563051 | 3300018433 | Grasslands Soil | VALWQAKTSEEIVKNSVERVTTLPGVFKSETLLAYAPFFKA |
| Ga0066662_113664081 | 3300018468 | Grasslands Soil | QARTSEDIVKTSVERVSHLDGIFKSETLLAYAPFFKA |
| Ga0215015_100747333 | 3300021046 | Soil | AKTSEDIVKNSVERVTNLQGISKSETLLAYAPFFKA |
| Ga0207646_106332632 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | PGQFDIVALWQAKTSEDIVKNSVERVTNLQGIFKSETLLAYAPFFKA |
| Ga0209235_11403271 | 3300026296 | Grasslands Soil | ALWQARTSEDIVKTSVERVSNLEGIFKSETLLAYAPFFKA |
| Ga0209236_11916312 | 3300026298 | Grasslands Soil | VALWQARTSEDIVKTSIERVSNLQGIFKSETLLAYAPFFKA |
| Ga0209055_10082595 | 3300026309 | Soil | LWQAKTSEEIVKTSVERVSHLDGIFKSETILAYTPVFKA |
| Ga0209055_10356535 | 3300026309 | Soil | VALWQAKTSEEIVKNTVERVTTLPGIFKSETLLAYAPFFKA |
| Ga0209239_11872691 | 3300026310 | Grasslands Soil | IVALWQAKTSEEIVKNTVERVTTLPGIFKSETLLAYAPFFKA |
| Ga0209761_11128592 | 3300026313 | Grasslands Soil | VALWQARTSEDIVKNSFEKVTNLQGLFSSETLLAHLPFFNA |
| Ga0209154_10531464 | 3300026317 | Soil | VALWQAKTSEEIVKNSVERVTTLPGIFKSETLLAYAPFFKA |
| Ga0209152_100083925 | 3300026325 | Soil | TVPGQFDIVALWQAKTSEEIVKNSVERVTTLPGVFKSETLLAYAPFFKA |
| Ga0209801_11051152 | 3300026326 | Soil | ARTSEDIVKNSFERVTNLQGLFSSETLLAHLPFFNA |
| Ga0209803_10248981 | 3300026332 | Soil | QFDIVALWQAKTSEEIVKNTVERVTTLPGIFKSETLLAYAPFFKA |
| Ga0209806_10583031 | 3300026529 | Soil | GQFDIVALWQARTSEDIVKNSFEKVTNLQGLFSSETLLAHLPFFNA |
| Ga0209160_11585602 | 3300026532 | Soil | RTSEDIVKTSVERVSNLEGIFKSETLLAYAPFFKA |
| Ga0209376_13729101 | 3300026540 | Soil | VPGQFDIVALWQAKTSEEIVKTSVERVSHLDGIFKSETILAYTPVFKA |
| Ga0209076_10900661 | 3300027643 | Vadose Zone Soil | PGQFDIVALWQAKTSEDIVKNSVERVTNLPGIFKSETLLAYAPFFKA |
| Ga0209689_13570602 | 3300027748 | Soil | VPGQFDIVALWQAKTSEEIVKNSVERVTTLPGVFKSETLLAYAPFFKA |
| Ga0209180_101040521 | 3300027846 | Vadose Zone Soil | VALWQARTSEDIVKTSVERVSNLPGIFKSETLLAYAPFFKA |
| Ga0209590_104545872 | 3300027882 | Vadose Zone Soil | VPGQFDIVALWQARTSEDIVKTSVERVSNLPGIFKSETLLAYAPFFKA |
| Ga0137415_101208136 | 3300028536 | Vadose Zone Soil | IVALWQAKTSEDIVKNSVERVTNLPGIFKSETLLAYAPFFKA |
| Ga0137415_103497331 | 3300028536 | Vadose Zone Soil | IVALWQAKTSEDIVKNSVERVTNLPGIFKSETLLAYSPFFKA |
| Ga0307504_103538351 | 3300028792 | Soil | KTSEDIVKNSVERVTSLQGIFKSETLLAYSPFFKA |
| ⦗Top⦘ |