Basic Information | |
---|---|
Family ID | F096913 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 104 |
Average Sequence Length | 41 residues |
Representative Sequence | WDASTAGNCLWTGALSSSAAVTAGDTFQITSLTLSLD |
Number of Associated Samples | 89 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 85.58 % |
Associated GOLD sequencing projects | 82 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.28 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (47.115 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (29.808 % of family members) |
Environment Ontology (ENVO) | Unclassified (32.692 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (51.923 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 4.62% β-sheet: 0.00% Coil/Unstructured: 95.38% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF13392 | HNH_3 | 3.85 |
PF16778 | Phage_tail_APC | 2.88 |
PF13692 | Glyco_trans_1_4 | 1.92 |
PF07484 | Collar | 0.96 |
PF01391 | Collagen | 0.96 |
PF13884 | Peptidase_S74 | 0.96 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 79.81 % |
Unclassified | root | N/A | 20.19 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005583|Ga0049085_10118139 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
3300005583|Ga0049085_10175098 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 718 | Open in IMG/M |
3300006025|Ga0075474_10048308 | All Organisms → cellular organisms → Bacteria | 1445 | Open in IMG/M |
3300006025|Ga0075474_10101903 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
3300006802|Ga0070749_10159844 | All Organisms → cellular organisms → Bacteria | 1306 | Open in IMG/M |
3300006863|Ga0075459_1097438 | Not Available | 505 | Open in IMG/M |
3300006869|Ga0075477_10071772 | All Organisms → Viruses → Predicted Viral | 1512 | Open in IMG/M |
3300006919|Ga0070746_10245066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 839 | Open in IMG/M |
3300007344|Ga0070745_1074481 | All Organisms → Viruses → Predicted Viral | 1357 | Open in IMG/M |
3300007344|Ga0070745_1118087 | All Organisms → Viruses → Predicted Viral | 1024 | Open in IMG/M |
3300007344|Ga0070745_1153751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 870 | Open in IMG/M |
3300007345|Ga0070752_1226639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea → Bosea sp. BK604 | 735 | Open in IMG/M |
3300007363|Ga0075458_10190363 | Not Available | 631 | Open in IMG/M |
3300007538|Ga0099851_1020933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2644 | Open in IMG/M |
3300007538|Ga0099851_1144114 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C493 | 890 | Open in IMG/M |
3300007538|Ga0099851_1205765 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 715 | Open in IMG/M |
3300007538|Ga0099851_1361145 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
3300007541|Ga0099848_1111995 | Not Available | 1038 | Open in IMG/M |
3300007541|Ga0099848_1114153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosomonas → unclassified Nitrosomonas → Nitrosomonas sp. Nm166 | 1026 | Open in IMG/M |
3300007542|Ga0099846_1190747 | Not Available | 726 | Open in IMG/M |
3300007640|Ga0070751_1164569 | Not Available | 880 | Open in IMG/M |
3300007670|Ga0102862_1003663 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3169 | Open in IMG/M |
3300007972|Ga0105745_1001940 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4337 | Open in IMG/M |
3300007974|Ga0105747_1154738 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C449 | 742 | Open in IMG/M |
3300007992|Ga0105748_10225255 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C493 | 784 | Open in IMG/M |
3300008450|Ga0114880_1026802 | All Organisms → Viruses → Predicted Viral | 2614 | Open in IMG/M |
3300009158|Ga0114977_10117776 | All Organisms → Viruses → Predicted Viral | 1602 | Open in IMG/M |
3300009165|Ga0105102_10618624 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C449 | 600 | Open in IMG/M |
3300009180|Ga0114979_10840564 | Not Available | 513 | Open in IMG/M |
3300009184|Ga0114976_10460248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 660 | Open in IMG/M |
3300009470|Ga0126447_1086473 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C493 | 766 | Open in IMG/M |
3300010354|Ga0129333_11556696 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
3300010370|Ga0129336_10735048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
3300010885|Ga0133913_10282902 | All Organisms → cellular organisms → Bacteria | 4398 | Open in IMG/M |
3300011189|Ga0136558_1088324 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ct2cs2 | 778 | Open in IMG/M |
3300012017|Ga0153801_1080086 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 575 | Open in IMG/M |
3300013087|Ga0163212_1264493 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
3300016791|Ga0182095_1845011 | Not Available | 504 | Open in IMG/M |
3300016797|Ga0182090_1097236 | Not Available | 556 | Open in IMG/M |
3300017736|Ga0181365_1004677 | All Organisms → Viruses → Predicted Viral | 3351 | Open in IMG/M |
3300017774|Ga0181358_1045613 | All Organisms → Viruses → Predicted Viral | 1671 | Open in IMG/M |
3300017777|Ga0181357_1083897 | All Organisms → Viruses → Predicted Viral | 1218 | Open in IMG/M |
3300017777|Ga0181357_1235370 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 641 | Open in IMG/M |
3300017777|Ga0181357_1267893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C493 | 589 | Open in IMG/M |
3300017778|Ga0181349_1141535 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 871 | Open in IMG/M |
3300017780|Ga0181346_1137259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C449 | 925 | Open in IMG/M |
3300017785|Ga0181355_1127886 | All Organisms → Viruses → Predicted Viral | 1036 | Open in IMG/M |
3300017949|Ga0181584_10074718 | All Organisms → Viruses → Predicted Viral | 2349 | Open in IMG/M |
3300017949|Ga0181584_10906476 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-B68 | 517 | Open in IMG/M |
3300017956|Ga0181580_10481276 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 814 | Open in IMG/M |
3300017989|Ga0180432_10900424 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 607 | Open in IMG/M |
3300018039|Ga0181579_10526124 | Not Available | 620 | Open in IMG/M |
3300018041|Ga0181601_10446093 | Not Available | 683 | Open in IMG/M |
3300018420|Ga0181563_10792619 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C429 | 519 | Open in IMG/M |
3300018421|Ga0181592_10304839 | Not Available | 1151 | Open in IMG/M |
3300018423|Ga0181593_10441540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 963 | Open in IMG/M |
3300019281|Ga0182077_1546714 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 629 | Open in IMG/M |
3300019282|Ga0182075_1371179 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 576 | Open in IMG/M |
3300019282|Ga0182075_1420126 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 885 | Open in IMG/M |
3300019283|Ga0182058_1537582 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
3300019784|Ga0181359_1073371 | All Organisms → Viruses → Predicted Viral | 1293 | Open in IMG/M |
3300020054|Ga0181594_10095548 | Not Available | 1732 | Open in IMG/M |
3300020194|Ga0181597_10076741 | All Organisms → Viruses → Predicted Viral | 1941 | Open in IMG/M |
3300021961|Ga0222714_10161779 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1330 | Open in IMG/M |
3300022050|Ga0196883_1015611 | Not Available | 907 | Open in IMG/M |
3300022200|Ga0196901_1200202 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
3300022407|Ga0181351_1185854 | Not Available | 710 | Open in IMG/M |
3300023170|Ga0255761_10087733 | All Organisms → Viruses → Predicted Viral | 1986 | Open in IMG/M |
3300023176|Ga0255772_10287737 | Not Available | 878 | Open in IMG/M |
3300024533|Ga0256299_1088036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C493 | 617 | Open in IMG/M |
3300024569|Ga0255243_1079207 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 817 | Open in IMG/M |
3300025630|Ga0208004_1087430 | Not Available | 759 | Open in IMG/M |
3300025647|Ga0208160_1008182 | All Organisms → Viruses → Predicted Viral | 3638 | Open in IMG/M |
3300025647|Ga0208160_1070671 | All Organisms → Viruses | 952 | Open in IMG/M |
3300025671|Ga0208898_1057906 | All Organisms → Viruses → Predicted Viral | 1362 | Open in IMG/M |
3300025828|Ga0208547_1089624 | Not Available | 966 | Open in IMG/M |
3300025840|Ga0208917_1010673 | All Organisms → cellular organisms → Bacteria | 4063 | Open in IMG/M |
3300025853|Ga0208645_1143411 | Not Available | 918 | Open in IMG/M |
3300025896|Ga0208916_10147632 | All Organisms → Viruses → Predicted Viral | 1010 | Open in IMG/M |
3300027138|Ga0255064_1035219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 819 | Open in IMG/M |
3300027140|Ga0255080_1039136 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C493 | 742 | Open in IMG/M |
3300027155|Ga0255081_1028161 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C493 | 1246 | Open in IMG/M |
3300027659|Ga0208975_1022570 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2055 | Open in IMG/M |
3300027733|Ga0209297_1021258 | All Organisms → Viruses → Predicted Viral | 3085 | Open in IMG/M |
3300027763|Ga0209088_10365991 | Not Available | 565 | Open in IMG/M |
3300027782|Ga0209500_10133699 | All Organisms → Viruses → Predicted Viral | 1186 | Open in IMG/M |
3300027785|Ga0209246_10006544 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4311 | Open in IMG/M |
3300027808|Ga0209354_10006461 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4745 | Open in IMG/M |
3300028377|Ga0306869_1092292 | Not Available | 550 | Open in IMG/M |
3300029930|Ga0119944_1002452 | All Organisms → Viruses → Predicted Viral | 3197 | Open in IMG/M |
3300031857|Ga0315909_10161541 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1828 | Open in IMG/M |
3300031999|Ga0315274_11475312 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300032053|Ga0315284_12173192 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300032177|Ga0315276_11110669 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 837 | Open in IMG/M |
3300034012|Ga0334986_0186635 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C493 | 1170 | Open in IMG/M |
3300034060|Ga0334983_0489954 | Not Available | 691 | Open in IMG/M |
3300034095|Ga0335022_0561342 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C449 | 584 | Open in IMG/M |
3300034117|Ga0335033_0280153 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C493 | 863 | Open in IMG/M |
3300034117|Ga0335033_0315104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C493 | 797 | Open in IMG/M |
3300034118|Ga0335053_0242045 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C493 | 1162 | Open in IMG/M |
3300034121|Ga0335058_0247954 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1037 | Open in IMG/M |
3300034356|Ga0335048_0129271 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1475 | Open in IMG/M |
3300034374|Ga0348335_020616 | All Organisms → Viruses → Predicted Viral | 3185 | Open in IMG/M |
3300034374|Ga0348335_081274 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1091 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 29.81% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 17.31% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 11.54% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.65% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.73% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 4.81% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.88% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.88% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 2.88% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.92% |
Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 1.92% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.96% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.96% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.96% |
Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.96% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.96% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.96% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.96% |
Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.96% |
Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006863 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA | Environmental | Open in IMG/M |
3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
3300007670 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 | Environmental | Open in IMG/M |
3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009470 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, surface; DNA IDBA-UD | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011189 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Torckler E6 #833 | Environmental | Open in IMG/M |
3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
3300016791 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041412BS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016797 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041408BS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017989 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_2 metaG | Environmental | Open in IMG/M |
3300018039 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071402CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018041 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018423 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019281 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071409AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019282 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071407BT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019283 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101404CT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020054 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413BT metaG (spades assembly) | Environmental | Open in IMG/M |
3300020194 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041403US metaG (spades assembly) | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300022050 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3) | Environmental | Open in IMG/M |
3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300023170 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG | Environmental | Open in IMG/M |
3300023176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG | Environmental | Open in IMG/M |
3300024533 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024569 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
3300025828 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027138 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0h | Environmental | Open in IMG/M |
3300027140 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8h | Environmental | Open in IMG/M |
3300027155 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8h | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300028377 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Torckler E6 #833 (v2) | Environmental | Open in IMG/M |
3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034060 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016 | Environmental | Open in IMG/M |
3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0049085_101181391 | 3300005583 | Freshwater Lentic | TYTHWSLWDALTAGNALWSGALSSSAAVTAGDTFQITSLTLSLD* |
Ga0049085_101750981 | 3300005583 | Freshwater Lentic | DLTAGNALWTGALSTSAAVTAGDTFQITTLTLSLD* |
Ga0075474_100483084 | 3300006025 | Aqueous | DASTAGNCLWTGSLASSASVDAGDTFQITSLTLTLD* |
Ga0075474_101019033 | 3300006025 | Aqueous | DASSAGNCLWTGALTSSASLEAGDTFQITSLTLTLD* |
Ga0070749_101598444 | 3300006802 | Aqueous | ASAGNCLWSGALSASAAVVAGDTFQITTSTLTLD* |
Ga0075459_10974381 | 3300006863 | Aqueous | NASAGNCLWKGALSSSAAVTAGDTFQITSLTLTLD* |
Ga0075477_100717721 | 3300006869 | Aqueous | THWSMWDASTAGNCLWTGSLASSASVDAGDTFQITSLTLTLD* |
Ga0070746_102450662 | 3300006919 | Aqueous | LWDALSSGNALWSGALASSAAVVAGDTFQITSLTLTLE* |
Ga0070745_10744811 | 3300007344 | Aqueous | TYTHWSMWDASTAGNCLWTGSLASSASVDAGDTFQITSLTLTLD* |
Ga0070745_11180873 | 3300007344 | Aqueous | ETYTHWSLWDALSSGNALWSGALASSAAVVAGDTFQITSLTLTLE* |
Ga0070745_11537511 | 3300007344 | Aqueous | TFTHWSLWDAASSGNCLWSGSLASSAVVVAGDSFSISLLTLALD* |
Ga0070752_12266391 | 3300007345 | Aqueous | HWSMWDASTGGNCLWYGSLSSSAALQAGDTFQITTLTLTLD* |
Ga0075458_101903633 | 3300007363 | Aqueous | DASTGGNALWSGALSSSASVTAGDTFQITSLTLTLD* |
Ga0099851_10209336 | 3300007538 | Aqueous | WDAASAGNCLWSGALSASAAVVAGDTFQITSLTLTLD* |
Ga0099851_11441141 | 3300007538 | Aqueous | SLWDASTGGNALWTGALSASAAVTAGDTFQITSLTLSLD* |
Ga0099851_12057652 | 3300007538 | Aqueous | AWDASTAGNALWYGALSSSASVTAGDTFQITSLTLTLD* |
Ga0099851_13611451 | 3300007538 | Aqueous | ETYTHWSAWDASTAGNALWYGALSSSASVTAGDTFQITSLTLTLD* |
Ga0099848_11119953 | 3300007541 | Aqueous | WSAWDASSAGNCLWTGALTSSASLEAGDTFQITSLTLTLD* |
Ga0099848_11141531 | 3300007541 | Aqueous | LWVSFSTGNCLWTGQFSAPAAVVAGDTFQVTSLTLTLD* |
Ga0099846_11907472 | 3300007542 | Aqueous | STGGNALWTGALSASAAVTAGDTFQITSLTLSLD* |
Ga0070751_11645692 | 3300007640 | Aqueous | HWSLWDASTGGNALWSGALSSSAAVTAGDTFQITALTLSLD* |
Ga0102862_10036639 | 3300007670 | Estuarine | YTHWSLWDASTAGNALWSGALSASAAVTAGDTFQITTLTLSLD* |
Ga0105745_10019401 | 3300007972 | Estuary Water | HWSLWDASTAGNALWSGALSASAAVTAGDTFQITTLTLSLD* |
Ga0105747_11547381 | 3300007974 | Estuary Water | WSLWDASTSGNALWTGALSSSAAVTAGDTFQITSLTLSLD* |
Ga0105748_102252551 | 3300007992 | Estuary Water | STAGNALWSGALSASAAVTAGDTFQITSLTLSLD* |
Ga0114880_10268026 | 3300008450 | Freshwater Lake | HWSAWDNATTGNCLWSGALSASASVAAGDTFQITSLTLTLD* |
Ga0114977_101177761 | 3300009158 | Freshwater Lake | ASTAGNALWTGALSSSAAVTAGDTFQITSLTLSLD* |
Ga0105102_106186241 | 3300009165 | Freshwater Sediment | MWDASTAGNCLWTGALSSSAAVTAGDTFQITSLTLSLD* |
Ga0114979_108405642 | 3300009180 | Freshwater Lake | DASTAGNCLWSGAFSSSAAVTAGDTFQITSLTLTLD* |
Ga0114976_104602481 | 3300009184 | Freshwater Lake | NVSTTETYSHWSLWDDVTAGNALWTGALSTSAAVTAGDTFQITTLTLSLD* |
Ga0126447_10864731 | 3300009470 | Meromictic Pond | MWDASTSGNPLWSGALSASAAVTSGDTFQITSLTLSLD* |
Ga0129333_115566962 | 3300010354 | Freshwater To Marine Saline Gradient | YSHWSLWDNLTAGNCIWTGALSSSAAVTAGDTFEITSLTLSLD* |
Ga0129336_107350482 | 3300010370 | Freshwater To Marine Saline Gradient | DNATTGNCLWTGGLSSSAAVTAGDTFQITSITLSLD* |
Ga0133913_102829021 | 3300010885 | Freshwater Lake | ETLTHWSAWDASTAGNALWTGALSSSAAVTAGDTFQITTLTLSLD* |
Ga0136558_10883241 | 3300011189 | Saline Lake | SATGTPVAEWTSVSTTETYSHFSIWDAATVGNCLGSGALGASAAMTAGDTFQLTALTWTLD* |
Ga0153801_10800862 | 3300012017 | Freshwater | WDASTAGNALWTGALSASAAVTAGDTFQITTLTLSLD* |
Ga0163212_12644932 | 3300013087 | Freshwater | YTHWSAWDASTAGNNLWSGALSASASVAAGDTFQITSLTLTLD* |
Ga0182095_18450112 | 3300016791 | Salt Marsh | SDTGGTAIWYGALSGSATVAVGDTFQITSLTLTLD |
Ga0182090_10972362 | 3300016797 | Salt Marsh | WDASTAGNCLWSGALASSAAVTAGDTFQITSLTLSLD |
Ga0181365_10046778 | 3300017736 | Freshwater Lake | SHWSMWDDLTAGNALWSGALATSAAVTAGDTFQITSLTLSLD |
Ga0181358_10456135 | 3300017774 | Freshwater Lake | IVTSATMEWTNVSTTETYSQWSMWDDLTAGNVLWSGALATSAAVTAGDTFQITSLTLSLD |
Ga0181357_10838972 | 3300017777 | Freshwater Lake | EWTNVSTTETYSHWSMWDDLTAGNALWSGALATSAAVTAGDTFQITSLTLSLD |
Ga0181357_12353702 | 3300017777 | Freshwater Lake | SHWSLWDALTAGNALWTGALSTSAAVTAGDTFQITTLTLSLD |
Ga0181357_12678932 | 3300017777 | Freshwater Lake | HWSLWDASTAGNALWSGALSASAAVTAGDTFQITTLTLSLD |
Ga0181349_11415352 | 3300017778 | Freshwater Lake | LWDALTAGNALWTGALSTSAAVTAGDTFQITTLTLSLD |
Ga0181346_11372593 | 3300017780 | Freshwater Lake | NVASTETLTHWSLWDNLTAGNALWTGALSSSAAVTAGDTFQITTLTLSLD |
Ga0181355_11278862 | 3300017785 | Freshwater Lake | SLWDAVTAGNALWTGALSTSAAVTAGDTFQITTLTLSLD |
Ga0181584_100747185 | 3300017949 | Salt Marsh | AWDASTSGNALWYGALSSSASVTAGDTFQITSLTLTLD |
Ga0181584_109064761 | 3300017949 | Salt Marsh | HWSAWDASSAGNCLWTGALTSSASLEAGDTFQITSLTLTLD |
Ga0181580_104812763 | 3300017956 | Salt Marsh | SAWDASTAGNALWYGALSSSASVTAGDTFQITSLTLTLD |
Ga0180432_109004242 | 3300017989 | Hypersaline Lake Sediment | GSMASSAAVTWTDVAANETYTHWSMWDASSAGNALWYGALSSSATVTAGDTFQITSLTLTLN |
Ga0181579_105261242 | 3300018039 | Salt Marsh | ASSAGNCLWTGALTSSASLEAGDTFQITSLTLTLD |
Ga0181601_104460932 | 3300018041 | Salt Marsh | ADTSGTAIWYGALSGSATVAVGDTFQITSLTLTLD |
Ga0181563_107926192 | 3300018420 | Salt Marsh | THWSLWDALTAGNPLWSGALSTSASVTAGDTFQITSLTLSLD |
Ga0181592_103048394 | 3300018421 | Salt Marsh | LWDAASSGNCLWTGALSASAAVVAGDTFQITSLTLTLD |
Ga0181593_104415401 | 3300018423 | Salt Marsh | THWSAWDASTSGNALWYGALSSSASVTAGDTFQITSLTLTLD |
Ga0182077_15467141 | 3300019281 | Salt Marsh | YTHWSAWDASTSGNALWYGALSSSASVTAGDTFQITSLTLTLD |
Ga0182075_13711792 | 3300019282 | Salt Marsh | ATETYTHWSLWDALSSGNALWSGALASSAAVVAGDTFQITSLTLTLD |
Ga0182075_14201263 | 3300019282 | Salt Marsh | AWDASTAGNALWYGALSSSASVTAGDTFQITSLTLTLD |
Ga0182058_15375821 | 3300019283 | Salt Marsh | SMHDASTSGNCLCYGALSSSASVTAGDTFQRTSLPLTLD |
Ga0181359_10733711 | 3300019784 | Freshwater Lake | EMWDDVTAGNALWTGALSTSAAVTAGDTFQITTLTLSLD |
Ga0181594_100955481 | 3300020054 | Salt Marsh | SWWDAASAGNCLWSGALSASAAVVAGDTFQITSLTLTLD |
Ga0181597_100767411 | 3300020194 | Salt Marsh | THWSLWSSDTGGTAIWYGALSGSATVAVGDTFQITSLTLTLD |
Ga0222714_101617791 | 3300021961 | Estuarine Water | LWDASTGGNALWSGALSSSAAVTAGDTFQITNLTLSLD |
Ga0196883_10156113 | 3300022050 | Aqueous | LWTDPSAGDPLWSGALASSAAVTAGDTFQITSLTLTLD |
Ga0196901_12002021 | 3300022200 | Aqueous | HWSAWDASTSGNALWYGALSSSASVTAGDTFQITSLTLTLD |
Ga0181351_11858542 | 3300022407 | Freshwater Lake | EKKENVAATEVYTHWSMWDAASGGTALWFGALSSSASVTAGDTFEITSLTLTLD |
Ga0255761_100877331 | 3300023170 | Salt Marsh | ASTAGNALWYGALSSSASVTAGDTFQITSLTLTLD |
Ga0255772_102877373 | 3300023176 | Salt Marsh | WDASTSGNALWYGALSSSASVTAGDTFQITSLTLTLD |
Ga0256299_10880361 | 3300024533 | Freshwater | THWSLWDASTAGNALWTGALSASAAVTAGDTFQITTLTLSLD |
Ga0255243_10792072 | 3300024569 | Freshwater | MWDASTAGNALWSGALSASAAVTAGDTFQITALTLS |
Ga0208004_10874302 | 3300025630 | Aqueous | DASTGGNALWSGALSSSAAVTAGDTFQITNLTLSLD |
Ga0208160_10081821 | 3300025647 | Aqueous | TNVSTSETYSHWSLWDASSAGNALWSGALASSAAVTAGDTFQITSLTLTLD |
Ga0208160_10706711 | 3300025647 | Aqueous | HWSAWDASTAGNCLWSGALSASASVAAGDTFQVTSLTLTLD |
Ga0208898_10579065 | 3300025671 | Aqueous | MWDASTAGNCLWTGSLASSASVDAGDTFQITSLTLTLD |
Ga0208547_10896241 | 3300025828 | Aqueous | DAATAGNCLWTGALTSSASLEAGDTFQITSLTLTLD |
Ga0208917_10106739 | 3300025840 | Aqueous | WDASTAGNCLWTGSLASSASVDAGDTFQITSLTLTLD |
Ga0208645_11434111 | 3300025853 | Aqueous | WDALSSGNALWSGALASSAAVVAGDTFQITSLTLTLE |
Ga0208916_101476321 | 3300025896 | Aqueous | WDASTAGNCLWTGALSSSAAVTAGDTFQITSLTLSLD |
Ga0255064_10352191 | 3300027138 | Freshwater | STTETYTHWSMWDAATAGNALWKGALSASAAVTAGDTFQITSLTLSLD |
Ga0255080_10391362 | 3300027140 | Freshwater | WSMWDAATAGNALWKGALSASAAVTAGDTFQITSLTLSLD |
Ga0255081_10281611 | 3300027155 | Freshwater | YTHWSMWDASTAGNALWKGALSASAAVTAGDTFQITSLTLSLD |
Ga0208975_10225701 | 3300027659 | Freshwater Lentic | HWSLWDNSTGGNALWTGALSASAAVTAGDTFQITSLTLSLD |
Ga0209297_10212581 | 3300027733 | Freshwater Lake | DNLTAGNCLWTGALSSSAAVTAGDTFQITALTLSLD |
Ga0209088_103659911 | 3300027763 | Freshwater Lake | DASTAGNCLWSGAFSSSAAVTAGDTFQITSLTLTLD |
Ga0209500_101336991 | 3300027782 | Freshwater Lake | NVASTETLTHWSAWDASTAGNALWTGALSSSAAVTAGDTFQITTLTLSLD |
Ga0209246_1000654412 | 3300027785 | Freshwater Lake | WTNVSTTETYSHWSMWDDLTAGNALWSGALATSAAVTAGDTFQITSLTLSLD |
Ga0209354_1000646114 | 3300027808 | Freshwater Lake | TMEWTNVSTTETYSHWSMWDDLTAGNALWSGALATSAAVTAGDTFQITSLTLSLD |
Ga0306869_10922922 | 3300028377 | Saline Lake | SVSTTETYSHFSIWDAATVGNCLGSGALGASAAMTAGDTFQLTALTWTLD |
Ga0119944_10024527 | 3300029930 | Aquatic | SLWDNSTAGNCLWKGALSASAAVTAGDTFQITSLTLTLD |
Ga0315909_101615411 | 3300031857 | Freshwater | MWDASTSGNPLWNGALSASAAVTSGDTFQITSLTLSLD |
Ga0315274_114753122 | 3300031999 | Sediment | HWSLWDASTAGNALWSGALSSSAAVTAGDTFQITALTLSLD |
Ga0315284_121731921 | 3300032053 | Sediment | STTETYSHWSMWDNLTAGNALWSGALATSAAVTAGDTFQITSLTLSLD |
Ga0315276_111106692 | 3300032177 | Sediment | WTNVSTTETYSHWSLWDDLTAGNALWTGALSTSAAVTAGDTFQITTLTLSLD |
Ga0334986_0186635_3_128 | 3300034012 | Freshwater | HWSMWDASTAGNALWTGALSASAAVTAGDTFQITSLTLSLD |
Ga0334983_0489954_3_119 | 3300034060 | Freshwater | LWDDVSAGNALWSGALATTAAVTAGDTFQITSLTLTLD |
Ga0335022_0561342_466_582 | 3300034095 | Freshwater | AWYASTGGNALWTGALSSSAAVTAGDTFQITTLTLSLD |
Ga0335033_0280153_2_148 | 3300034117 | Freshwater | STTETYTHWSMWDAATDGNALWKGALSASAAVTAGDTFQITSLTLSLD |
Ga0335033_0315104_2_109 | 3300034117 | Freshwater | AATAGNALWKGALSASAAVTAGDTFQITSLTLSLD |
Ga0335053_0242045_1037_1162 | 3300034118 | Freshwater | HWSMWDASTSGNPLWKGALSASAAVTAGDTFQITSLTLSLD |
Ga0335058_0247954_926_1036 | 3300034121 | Freshwater | DAVTAGNCLWTGALSSSAAVTAGDTFQITSLTLSLD |
Ga0335048_0129271_3_110 | 3300034356 | Freshwater | DVTAGNALWTGALSTSAAVTAGDTFQITTLTLSLD |
Ga0348335_020616_1_117 | 3300034374 | Aqueous | AWDASSAGNCLWTGALTSSASLEAGDTFQITSLTLTLD |
Ga0348335_081274_2_127 | 3300034374 | Aqueous | HWSAWDAATAGNCLWTGALTSSASLEAGDTFQITSLTLTLD |
⦗Top⦘ |