NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F096886

Metagenome / Metatranscriptome Family F096886

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F096886
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 41 residues
Representative Sequence MKTILSALLALSVLAGIAAPASAFDSKTFWEQQDRSHY
Number of Associated Samples 73
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 0.96 %
% of genes from short scaffolds (< 2000 bps) 0.96 %
Associated GOLD sequencing projects 69
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (99.038 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil
(25.961 % of family members)
Environment Ontology (ENVO) Unclassified
(50.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(66.346 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 51.52%    β-sheet: 0.00%    Coil/Unstructured: 48.48%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF00300His_Phos_1 8.65
PF13531SBP_bac_11 3.85
PF01124MAPEG 1.92
PF13490zf-HC2 0.96
PF01068DNA_ligase_A_M 0.96
PF12840HTH_20 0.96
PF13508Acetyltransf_7 0.96
PF08592Anthrone_oxy 0.96
PF03092BT1 0.96
PF06897DUF1269 0.96
PF12852Cupin_6 0.96
PF00528BPD_transp_1 0.96
PF00067p450 0.96
PF13714PEP_mutase 0.96
PF14559TPR_19 0.96
PF00696AA_kinase 0.96
PF03167UDG 0.96
PF01734Patatin 0.96
PF00293NUDIX 0.96
PF01292Ni_hydr_CYTB 0.96
PF04392ABC_sub_bind 0.96
PF13085Fer2_3 0.96
PF00582Usp 0.96
PF03401TctC 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 0.96
COG4803Uncharacterized membrane proteinFunction unknown [S] 0.96
COG4667Predicted phospholipase, patatin/cPLA2 familyLipid transport and metabolism [I] 0.96
COG4117Thiosulfate reductase cytochrome b subunitInorganic ion transport and metabolism [P] 0.96
COG3663G:T/U-mismatch repair DNA glycosylaseReplication, recombination and repair [L] 0.96
COG3658Cytochrome b subunit of Ni2+-dependent hydrogenaseEnergy production and conversion [C] 0.96
COG3621Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotRGeneral function prediction only [R] 0.96
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.96
COG3038Cytochrome b561Energy production and conversion [C] 0.96
COG0692Uracil-DNA glycosylaseReplication, recombination and repair [L] 0.96
COG2864Cytochrome b subunit of formate dehydrogenaseEnergy production and conversion [C] 0.96
COG2124Cytochrome P450Defense mechanisms [V] 0.96
COG1969Ni,Fe-hydrogenase I cytochrome b subunitEnergy production and conversion [C] 0.96
COG1793ATP-dependent DNA ligaseReplication, recombination and repair [L] 0.96
COG1752Predicted acylesterase/phospholipase RssA, containd patatin domainGeneral function prediction only [R] 0.96
COG1573Uracil-DNA glycosylaseReplication, recombination and repair [L] 0.96
COG1423ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) familyReplication, recombination and repair [L] 0.96


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A99.04 %
All OrganismsrootAll Organisms0.96 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300031879|Ga0306919_10112665All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1934Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil25.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil14.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil10.58%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.62%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere7.69%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.81%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere4.81%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.92%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.96%
SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment0.96%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.96%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.96%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.96%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.96%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.96%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300004268Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBioEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010937Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300019254Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022507Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022508Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022531Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300034643Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034819Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1Host-AssociatedOpen in IMG/M
3300034965Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10568899543300000364SoilMQTLLSALLALTVLTGVAASASAFDSKTFFQEQDRARY*
Ga0066398_1017104423300004268Tropical Forest SoilMIMKTILSALLALSVLAGIAAPASAFDSKTFWEQQDRSHY*
Ga0062595_10253736923300004479SoilPDMKIIVASALIALSLLTTIAAPARAFDSKEFWEQQDRLHY*
Ga0062594_10027562823300005093SoilMKIIVASALIALSLLTTIAAPARAFDSKEFWEQQDRLHY*
Ga0066388_10350849813300005332Tropical Forest SoilMKNIVKNIVPALIALSVLAGIVGSAAAFDTKTFYEQQDRSHF*
Ga0066388_10491395613300005332Tropical Forest SoilMKIIVAFALITLSLLTTTAAPASAFDSKEFWEQQDRLHY*
Ga0070693_10017589523300005547Corn, Switchgrass And Miscanthus RhizosphereMKTIVKTIFASALIALSLLTTITAPASAFDSKQFWEQQDRSHY*
Ga0066905_10004385343300005713Tropical Forest SoilMKTILSALLALSVLAGIAAPASAFDSKTFWEQQDRSHY*
Ga0066905_10045344613300005713Tropical Forest SoilMQTIVKTIFASALIALSLLTTVAAPASAFDSKEFWEQQDRSHY*
Ga0066905_10135038033300005713Tropical Forest SoilLLSALLALSVLAGVTASAYAFDSKTFYQQQDREHY*
Ga0066905_10207047213300005713Tropical Forest SoilMKTLLSALLALTVLTGAAASASAFDSKTFYQEQDRSRY*
Ga0066903_10003054243300005764Tropical Forest SoilMKTLLSGLLALTILTGVAASATAFDSKTFYQDQDRSRY*
Ga0066903_10070859633300005764Tropical Forest SoilMKTILSTLLALSVLASIAAPASAFDSKTFWEQQDRSHY*
Ga0066903_10123911233300005764Tropical Forest SoilMKTLLSALLALTILTGVAASASAFDSKTFYQEQDRSRY*
Ga0066903_10227617233300005764Tropical Forest SoilMIMKAILAALIVVSAVAGAATSANAFDSKTFWEQQDRSHY*
Ga0066903_10261266613300005764Tropical Forest SoilMKTLLSALLALTVLTGVAASASAFDSKTFYQEQDRSRY*
Ga0066903_10359031013300005764Tropical Forest SoilTILSALLALSVLAGIAAPASAFDSKTFWEQQDRSHY*
Ga0066903_10493220823300005764Tropical Forest SoilMTMKTILSALLALSVLAGIAAPASAFDSKTFWEQQDRSHY*
Ga0066903_10883055723300005764Tropical Forest SoilILSALLALSVLAGIAAPASAFDSKTFWEQQDRSHY*
Ga0066652_10052010513300006046SoilMKIIISMLIALSLFAGIAGPASAFDGKTFWEQQSRAAY*
Ga0079221_1097545323300006804Agricultural SoilMQTIVKTIFASALIALSLLTTVAAPASAFDSKEFWDQQDRSHY*
Ga0075428_10011696043300006844Populus RhizosphereMKTIVAAALITLSLLTTLAAPAGAFDSKEFWEQQDRLH
Ga0075433_1062079723300006852Populus RhizosphereMKIIVASALIALSLLTTIAAPASAFDSKEFWEQQDRLHY*
Ga0075425_10000589283300006854Populus RhizosphereMQTLLSALLALTVLTGVAASASAFDSKTFFQEQDRSRY*
Ga0075426_1091352223300006903Populus RhizosphereMIMQTLLSALLALTVLTGVAASASAFDSKTFFQEQDRSRY*
Ga0066710_10463763423300009012Grasslands SoilMKTILSALLALSVLAGFAATASAELDAKSFYEHADRYRY
Ga0111539_1009766833300009094Populus RhizosphereMQTIVKTIFASALIALSLLTTVAAPASAFDSKQFWDQQDRSHY*
Ga0114129_1107790923300009147Populus RhizosphereMKTIVTALIALSVLAGIAAPASAEFDAKAFWEQQDRYSH*
Ga0114129_1155528123300009147Populus RhizosphereMQIIFSVLIALSVLTTIAAPASAAFDAKAFWEQQDRYRH*
Ga0126374_1144865323300009792Tropical Forest SoilMIMKTLLSALLALTVLTGAAASASAFDSKTFYQEQDRSRY*
Ga0126380_1047387423300010043Tropical Forest SoilMIMKTLLSALLALTVLTGVVASASAFDTKTFYQDQGRSRY*
Ga0126380_1171658113300010043Tropical Forest SoilTTQIEKSRRMIMKAILAALIVVSALAGAATSASAFDSKTFWEQQDRSHY*
Ga0126380_1219334813300010043Tropical Forest SoilMIMKTILSALLALSVLAGIAGPASAFDSKTFWEQQDRSH
Ga0126384_1002607113300010046Tropical Forest SoilNTNTEEMIMKTILSALLALSVLAGIAAPASAFDSKTFWEQQDRSHY*
Ga0126384_1015547523300010046Tropical Forest SoilMIMKTILSALLALSVLAGIAGPASAFDSKTFWEQQDRSHY*
Ga0126384_1209096213300010046Tropical Forest SoilNTEEMIMKTILSALLALSVLAGIAAPASAFDSKTFWEQQDRSHY*
Ga0126382_1003381323300010047Tropical Forest SoilMKTIVKTIVASALIALSLLTTIAAPASAFDSKEFWEQQDRSHY*
Ga0126382_1026934913300010047Tropical Forest SoilMIMKTIVSALLALSVLAGIAAPASAFDSKTFWEQQDRSSY*
Ga0126382_1123753123300010047Tropical Forest SoilMKIIVASALIAVSLLTTMTAPASAFDSKEFWEQQDRLHY*
Ga0126370_1010784923300010358Tropical Forest SoilMKTIVSALIALSILGLVTAPASAFDSKTFWDQQDRSRY*
Ga0126370_1075319533300010358Tropical Forest SoilLSALLALSVLAGIAAPASAFDSKTFWEQQDRSHY*
Ga0126370_1113693823300010358Tropical Forest SoilMIMKTILSALLALAVLAGIAAPASAFDSKTFWEQQDHSHY*
Ga0126370_1239760213300010358Tropical Forest SoilMIMKTLLSALLALAVLTGVAASASAFGAKTFYQDQDRSRY*
Ga0126376_1135779913300010359Tropical Forest SoilMTMKTILSALLALSVLAGIAAPASAFDSKTFWEQQDRSSY*
Ga0126372_1201007223300010360Tropical Forest SoilGRHDSKNTNTEEMIMKTILSALLALSVLAGIAAPASAFDSKTFWEQQDRSHY*
Ga0126378_1197280523300010361Tropical Forest SoilMIMKTILWALLALSVLAGIAAPASAFDSKTFWEQQDRSHY*
Ga0126377_1006143233300010362Tropical Forest SoilMKTIVASALIALSLLTTVAAPASAFDSKEFWEQQDRSHY*
Ga0126377_1106757913300010362Tropical Forest SoilMKIIVASALIALSLLTTIAAPAGAFDSKEFWEQQDRSHY*
Ga0126379_1020163413300010366Tropical Forest SoilMKTLLSALLALTVLTGVAASASAFDSKSFYQEQDRSRY*
Ga0126379_1056078213300010366Tropical Forest SoilMTMKTILSALLALSVLAGIAAPARAFDSKTFWEQQDRSHY*
Ga0126379_1116145913300010366Tropical Forest SoilMIMKTILSALLALSVLASIAAPASAFDSKTFWEQQDRSHY*
Ga0126381_10406599713300010376Tropical Forest SoilMIMKTILSALLALSVLAGIAAPASAFDSKPFWEQQDRSHY*
Ga0137776_154408013300010937SedimentMAGRHNSKNTNTEEIVMKMIISALLALSVLAGIAAPASAFDSKTFWEQQDRSHY*
Ga0150983_1098025913300011120Forest SoilRRHNSKNRNTEEMIMKTILSALLALSVLVGIAAPASAFDSKTFWEQQDRSHY*
Ga0126375_1038821023300012948Tropical Forest SoilMIMKTIRSALLALSVLAGIAAPASAFDSKTFWEQQDRSHY*
Ga0126375_1136104013300012948Tropical Forest SoilMKTLLSALLALTVLTGVAVSASAFDSKTFYQEQDRSRY*
Ga0126369_1009784233300012971Tropical Forest SoilMKTLLSALFALTILTGVAASASAFDSKTFYQEQDRSRY*
Ga0132258_10003438213300015371Arabidopsis RhizosphereMKILIASALVALALIGAIAPPASAFDSKTFWEQQDRSHY*
Ga0132258_10020094123300015371Arabidopsis RhizosphereMIMKTILSVLLALSVLAGIAAPASAFDSKTFWEQQDRSHY*
Ga0132258_1052246633300015371Arabidopsis RhizosphereMAGRHNSKNTNTEEIVMKMIISALLALSVLAGIAAPASAFDSKTFWEQQDRSHF*
Ga0132258_1253834433300015371Arabidopsis RhizosphereMKTIVNSIFASALIALSLLTTIAAPASAFDSKQFWEQQDRSHY*
Ga0132256_10027172213300015372Arabidopsis RhizosphereAVVATARTNTEEMIMKTILSVLLALSVLAGIAAPASAFDSKTFWEQQDRSHY*
Ga0132255_10134784523300015374Arabidopsis RhizosphereLEGDAVVATARTNTEEMIMKTILSVLLALSVLAGIAAPASAFDSKTFWEQQDRSHY*
Ga0182034_1028357713300016371SoilMTMKTILSALLALSVLAGIAAPASAFDSKTFWEQQDRSHF
Ga0182038_1065181423300016445SoilMKTILSALLALSVLAGIAAPASAFDSKTFREQQDRSHF
Ga0187783_10001082213300017970Tropical PeatlandMKVLLSALLALSVLTGVAASASAFDSKSFFEQQDRSHY
Ga0187783_1033759123300017970Tropical PeatlandMKTLLSAVLALSVLTAFAASASAFDTKTFYEQQDRSHY
Ga0187783_1141553813300017970Tropical PeatlandTALSALVALTVLIAAAASASAFDSKTFYQEQDRSHY
Ga0187777_1060659613300017974Tropical PeatlandMKVLLSALLALSVLTGIAASASAFDSKTFYEQQDRAHY
Ga0184634_1010427233300018031Groundwater SedimentMKTIASALIALSLLAVAAAPASAFDSKTYFQQLERNLP
Ga0184641_118402613300019254Groundwater SedimentMKTIISALIAISVIAGIAAPASAFDSKSLYDQLDRQSS
Ga0210407_1094653713300020579SoilMIMQTLLSALLALTVLTGVAASASAFDSKTFFQEQDRSRY
Ga0210402_1005748643300021478SoilMQTLLSALLALTVLTGVAASASAFDSKTFFQEQDRSRY
Ga0126371_1285924313300021560Tropical Forest SoilKNTNTEEMIMKTILSALLALSVLAGIAAPASAFDSKTFWEQQDRSHY
Ga0222729_103299313300022507SoilRHNSKNRNTEEMIMKTILSALLALSVLAGIAAPASAFDSKTFWEQQDRSHY
Ga0222728_105895723300022508SoilHNSKNRNTEEMIMKTILSALLALSVLAGIAAPASAFDSKTFWEQQDRSHY
Ga0242660_111977423300022531SoilRRHNSKNRNTEEMIMKTILSALLALSVLAGIAAPASAFDSKTFWEQQDRSHY
Ga0242654_1005632613300022726SoilMGTILSALLALSVLAGIAAPASAFDSKTFWEQQDRSHY
Ga0207668_1010310643300025972Switchgrass RhizosphereMKIIVASALIALSLLTTIAAPARAFDSKEFWEQQDRLHY
Ga0207428_1078168513300027907Populus RhizosphereMKILIASALVALALISAIAPPASAFDSKTFWEQQDRSHY
Ga0307499_1011412623300031184SoilTMTTVKTIVASALIALSLLTTLAAPAGAFDSKAFWEQQDRLHN
Ga0318541_1010596833300031545SoilMKTIVSALIALAVLGLVAPPASAFDSKSFWDRQDRSRY
Ga0310915_1014932523300031573SoilMKTILSAFLALSVLAGVAAPASAFDSKTFWEQQDRSHF
Ga0307469_1038554323300031720Hardwood Forest SoilMKIIVASGLIALSLLTTIAAPARAFDSKEFWEQQDRLHY
Ga0307468_10000819973300031740Hardwood Forest SoilMKTIVASALITLSLLTTLAAPAGAFDSKEFWEQQDRLHH
Ga0306918_1132659713300031744SoilMKVLLSALLVLSVLTGVAASASAFDTKTFFEQQDRSHY
Ga0318521_1084971213300031770SoilNTNTEEMMMKTILSALLALSVLAGIAAPASAFDSKTFWEQQDRSHY
Ga0310904_1081229313300031854SoilMITIKTVVASALIALSLLTTLAAPAGAFDSKAFWEQQDRLHN
Ga0306919_1011266533300031879SoilMMMKTILSALLALSVLAGIAAPASAFDSKTFWEQQDRSHY
Ga0306925_1036469613300031890SoilMKTILSALLALSVLAGIAAPASAFDSKTFWEQQDRSHF
Ga0310900_1075403823300031908SoilMKTIVKTIFASALIALSLLTTITAPASAFDSKQFWEQQDRSHY
Ga0306923_1135020923300031910SoilMIMKTLLSALLALTVLAGVAASASAFDSKTFYQEQDRSRY
Ga0306921_1005327133300031912SoilMKTLLSALLALTVLAGVAASASAFDSKTFYQEQDRSRY
Ga0306921_1207765113300031912SoilMKTILSALLALTVLAGIAAPASAFDSKTFWEQQDRSHF
Ga0310913_1083266123300031945SoilMIMKTLLSAFLALTVLAGVAASASAFDSKTFYQEQDRSRY
Ga0306922_1090668423300032001SoilTPRGTIMKTLLCAIVALTVFSAAAVSATAFDSKTFYQEQDRSRY
Ga0318533_1140744113300032059SoilEMMMKTILSALLALSVLAGIAAPASAFDSKTFWEQQDRSHY
Ga0307470_1015605023300032174Hardwood Forest SoilMKTIVASTLITLSLLTTLAAPAGAFDSKEFWEQQDRLHY
Ga0307471_10001377963300032180Hardwood Forest SoilMKTIVASALITLSLLTTLAAPAGAFDSKEFWEQQDRSHY
Ga0307472_10082227013300032205Hardwood Forest SoilMKILIASALVALALIGAIAPPASAFDSKTFWEQQDRSHY
Ga0306920_10028006243300032261SoilMKTLLSAVLALAVLTGVAASAGAFDSKTFYEQQDRSRY
Ga0370545_162366_41_1633300034643SoilMIMRTLLSALLALSFLTGVAASASAFDSKTFWEQQERQAQ
Ga0373958_0172139_50_1813300034819Rhizosphere SoilMKTIVKTIFASALIALSLFTTITAPASAFDSKQFWEQQDRSHY
Ga0370497_0203752_346_4623300034965Untreated Peat SoilMKIIASALIALSLIASIAAPASAFDARSFFESQQNVLP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.