Basic Information | |
---|---|
Family ID | F096847 |
Family Type | Metagenome |
Number of Sequences | 104 |
Average Sequence Length | 41 residues |
Representative Sequence | SPSATDASTIASIVDSVMADLRPKIVEEIAKKLAGK |
Number of Associated Samples | 96 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 12.50 % |
% of genes near scaffold ends (potentially truncated) | 25.00 % |
% of genes from short scaffolds (< 2000 bps) | 25.00 % |
Associated GOLD sequencing projects | 92 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.50 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (78.846 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.308 % of family members) |
Environment Ontology (ENVO) | Unclassified (27.885 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.038 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.56% β-sheet: 0.00% Coil/Unstructured: 48.44% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF00133 | tRNA-synt_1 | 8.65 |
PF13620 | CarboxypepD_reg | 2.88 |
PF01186 | Lysyl_oxidase | 2.88 |
PF14026 | DUF4242 | 2.88 |
PF13561 | adh_short_C2 | 1.92 |
PF13103 | TonB_2 | 1.92 |
PF00109 | ketoacyl-synt | 1.92 |
PF00924 | MS_channel | 0.96 |
PF06155 | GBBH-like_N | 0.96 |
PF08327 | AHSA1 | 0.96 |
PF03404 | Mo-co_dimer | 0.96 |
PF06537 | DHOR | 0.96 |
PF13517 | FG-GAP_3 | 0.96 |
PF16264 | SatD | 0.96 |
PF13673 | Acetyltransf_10 | 0.96 |
PF12762 | DDE_Tnp_IS1595 | 0.96 |
PF00069 | Pkinase | 0.96 |
PF07883 | Cupin_2 | 0.96 |
PF07508 | Recombinase | 0.96 |
PF00216 | Bac_DNA_binding | 0.96 |
PF12895 | ANAPC3 | 0.96 |
PF07238 | PilZ | 0.96 |
PF03544 | TonB_C | 0.96 |
PF13180 | PDZ_2 | 0.96 |
PF01402 | RHH_1 | 0.96 |
PF01522 | Polysacc_deac_1 | 0.96 |
PF02578 | Cu-oxidase_4 | 0.96 |
PF13578 | Methyltransf_24 | 0.96 |
PF08264 | Anticodon_1 | 0.96 |
PF13432 | TPR_16 | 0.96 |
PF00873 | ACR_tran | 0.96 |
PF14119 | DUF4288 | 0.96 |
PF00072 | Response_reg | 0.96 |
COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
---|---|---|---|
COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 8.65 |
COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 8.65 |
COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 8.65 |
COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 8.65 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.85 |
COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.96 |
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
COG1496 | Copper oxidase (laccase) domain | Inorganic ion transport and metabolism [P] | 0.96 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.96 |
COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
COG3488 | Uncharacterized conserved protein with two CxxC motifs, DUF1111 family | General function prediction only [R] | 0.96 |
COG3536 | Uncharacterized conserved protein, DUF971 family | Function unknown [S] | 0.96 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 78.85 % |
All Organisms | root | All Organisms | 21.15 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001471|JGI12712J15308_10053857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Corallococcus → Corallococcus coralloides | 1020 | Open in IMG/M |
3300005436|Ga0070713_100841489 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 881 | Open in IMG/M |
3300005591|Ga0070761_10765728 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
3300005591|Ga0070761_10822395 | Not Available | 585 | Open in IMG/M |
3300006041|Ga0075023_100541486 | Not Available | 531 | Open in IMG/M |
3300009552|Ga0116138_1234197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 508 | Open in IMG/M |
3300009645|Ga0116106_1047958 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 1430 | Open in IMG/M |
3300009839|Ga0116223_10387547 | Not Available | 823 | Open in IMG/M |
3300012923|Ga0137359_10049322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Alloacidobacterium → Alloacidobacterium dinghuense | 3659 | Open in IMG/M |
3300012944|Ga0137410_11060829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
3300014838|Ga0182030_10998898 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300015054|Ga0137420_1345690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4740 | Open in IMG/M |
3300017932|Ga0187814_10037866 | All Organisms → cellular organisms → Bacteria | 1786 | Open in IMG/M |
3300017934|Ga0187803_10484012 | Not Available | 505 | Open in IMG/M |
3300018012|Ga0187810_10099099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1143 | Open in IMG/M |
3300018090|Ga0187770_10615569 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Sumerlaeota → unclassified Candidatus Sumerlaeota → candidate division BRC1 bacterium ADurb.BinA292 | 864 | Open in IMG/M |
3300020579|Ga0210407_10005299 | All Organisms → cellular organisms → Bacteria | 9968 | Open in IMG/M |
3300020580|Ga0210403_10011438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7198 | Open in IMG/M |
3300020581|Ga0210399_10162887 | All Organisms → cellular organisms → Bacteria | 1847 | Open in IMG/M |
3300021088|Ga0210404_10465593 | Not Available | 712 | Open in IMG/M |
3300025579|Ga0207927_1110232 | Not Available | 614 | Open in IMG/M |
3300027643|Ga0209076_1189202 | Not Available | 567 | Open in IMG/M |
3300027674|Ga0209118_1082774 | Not Available | 917 | Open in IMG/M |
3300027853|Ga0209274_10540844 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
3300027853|Ga0209274_10564068 | Not Available | 589 | Open in IMG/M |
3300027903|Ga0209488_10535630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 855 | Open in IMG/M |
3300028800|Ga0265338_10078489 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2784 | Open in IMG/M |
3300030007|Ga0311338_11535293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
3300031236|Ga0302324_100061297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6662 | Open in IMG/M |
3300031962|Ga0307479_10989997 | Not Available | 810 | Open in IMG/M |
3300033405|Ga0326727_10352082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1395 | Open in IMG/M |
3300033983|Ga0371488_0358086 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.31% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.62% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 9.62% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 6.73% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.77% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.77% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.81% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.85% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.85% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.85% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.88% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.92% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.92% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.92% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.92% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.92% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.92% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.96% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.96% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.96% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.96% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.96% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.96% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.96% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.96% |
Peat | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat | 0.96% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.96% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
3300025579 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
3300026360 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B | Environmental | Open in IMG/M |
3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300028740 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_3 | Environmental | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300029889 | Peat microbial communities from Marcell Experimental Forest bog in Minnesota, USA - MG_T3F_30cm | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12712J15308_100538571 | 3300001471 | Forest Soil | AAPKAMAAAASADGSGSVTDASTIASIVDSVMADLRPKIVEEIAKKLAGK* |
Ga0062592_1000329941 | 3300004480 | Soil | ASSTAAEAGAIANIVDSVLAELRPKIVEEIARKLGNDKKNQK* |
Ga0070713_1008414891 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | KPAAETASKAMAAAADSSVSADAKTIANIVDSVMADLRPRIVEEIARKLAGK* |
Ga0070761_107657282 | 3300005591 | Soil | MAAAAAEGSSASAPDAGTIASIVDSVMADLRPKIVEEIAKKLAGK* |
Ga0070761_108223951 | 3300005591 | Soil | MAAAAASTPASVTDASTIASIVDSVMADLRPKIVEEIAKKLAGK* |
Ga0075023_1001163611 | 3300006041 | Watersheds | VHAPATDPTAIANIVDSVLAELRPKIVEEIARKLADTKKD* |
Ga0075023_1005414862 | 3300006041 | Watersheds | MAAAAAKGAGSGSDASTIASIVDSVMADLRPKIVEEIAKKLAGK* |
Ga0079220_119999441 | 3300006806 | Agricultural Soil | NPTAAAEAGAIASIVESVLAELRPKIVEEITKKLGADKK* |
Ga0066793_104276381 | 3300009029 | Prmafrost Soil | ASASATDASTIASIVDSVMADLRPKIVEEIARKLAKRD* |
Ga0099828_117123632 | 3300009089 | Vadose Zone Soil | AEGAASASATDASTIARIVDSVMADLRPKIVEEIAKKLAGR* |
Ga0116218_12943301 | 3300009522 | Peatlands Soil | AASIPDASTIAIIVDSIMADLRPKIVEEIARKLAGK* |
Ga0116138_12341972 | 3300009552 | Peatland | MAAAAAEGSSSSSATDASTIASIVDSVMADLRPKIVEEIAKKLAGK* |
Ga0116114_11739342 | 3300009630 | Peatland | AATDASTIASIVDSIMADLRPKIVEEITKKLAGK* |
Ga0116102_10049754 | 3300009632 | Peatland | ASVPDASTIASIVDSIMADLRPKIVEEIAKKLAGK* |
Ga0116118_10550412 | 3300009637 | Peatland | AASVPDASTIASIVDSIMADLRPKIVEEIAKKLAGK* |
Ga0116106_10479583 | 3300009645 | Peatland | AAADGGRASAPATDASTIASIVDSIMADLRPKIVEEIAKKLAKRD* |
Ga0116132_12034932 | 3300009646 | Peatland | SATDASTIASIVDSVMADLRPKIVEEIARKLAGK* |
Ga0126374_100998971 | 3300009792 | Tropical Forest Soil | DQPAAKLKASDPTAIANIVDSVLAELRPKIVEEIARKLADPKKE* |
Ga0116223_100220713 | 3300009839 | Peatlands Soil | SPAASVPDASTIASIVDSIMADLRPKIVEEIARKLAGK* |
Ga0116223_103875471 | 3300009839 | Peatlands Soil | AAADGGTAFASATDASTIASIVDSVLADLRPKIVEEIARKLAGK* |
Ga0074044_111328751 | 3300010343 | Bog Forest Soil | SSPAASVPDASTIASIVDSIMADLRPKIVEEIAKKLAGK* |
Ga0137391_102336871 | 3300011270 | Vadose Zone Soil | ASASATDASTIARIVDSVMADLRPKIVEEIARKLAGR* |
Ga0137359_100493226 | 3300012923 | Vadose Zone Soil | AAAEGSASPSATDASTIASIVDSVMADLRPKIVEEIAKKLAGK* |
Ga0137416_105076081 | 3300012927 | Vadose Zone Soil | SATDASTIASIVDSVMADLRPKIVEEIAKKLAGK* |
Ga0137410_110608291 | 3300012944 | Vadose Zone Soil | AAASADSATASSIASIVDSVLADLRPKIVEEIAKQLAKK* |
Ga0181539_11741382 | 3300014151 | Bog | AAKGAASTSAPDASAIASIVDSVLADLRPKIVEEIARKLAGK* |
Ga0181521_105986001 | 3300014158 | Bog | PAASVPDASTIASIVDSIMADLRPKIVEEIAKKLAGK* |
Ga0182010_102244421 | 3300014490 | Fen | EGAASGSATDVSEIASIVDTMLAELKPKLMQEIAKKLAKK* |
Ga0182030_109988982 | 3300014838 | Bog | SSASSSTSTTTDAGTIASIVDSVMADLRPRIVEEIAKKLAGK* |
Ga0137420_13456904 | 3300015054 | Vadose Zone Soil | MAAAASADGATDASSIASIVDSVLADLRPKIVEEIAKQLAKK* |
Ga0132256_1026153541 | 3300015372 | Arabidopsis Rhizosphere | ASGAADPRAIANIVDSVLAELRPKIVEEIAKKLADPKKS* |
Ga0187814_100378661 | 3300017932 | Freshwater Sediment | AAEGSSSASTPAFVPDASTIASIVDSVMADLRPKIVEEIAKKLAGK |
Ga0187803_104840121 | 3300017934 | Freshwater Sediment | AAADSAPAASAAATDPNTIASIVDSVLADLRPKIVEEIAKKLAGK |
Ga0187778_101141743 | 3300017961 | Tropical Peatland | APDPRAIAHIVDSVLAELRPKIVEEIAKKLADPKKE |
Ga0187810_100990993 | 3300018012 | Freshwater Sediment | AADSALAAVAASDPSTIASIVDSVLADLRPKIVEEIAKKLAGK |
Ga0187889_101801772 | 3300018023 | Peatland | GGSSAPDASTIASIVDRVLADLRPKLVEEIARKLAGK |
Ga0187857_101166023 | 3300018026 | Peatland | SATDASTIASIVDSVMADLRPKIVEEIAKKLAKRD |
Ga0187788_102981651 | 3300018032 | Tropical Peatland | APAPTDPKAIASIVDSVLAELRPKIVEEIAKKLAGDGKKE |
Ga0187867_101888851 | 3300018033 | Peatland | GSATSSPAASVPDASTIASIVDSIMADLRPKIVEEIAKKLAGK |
Ga0187855_100225615 | 3300018038 | Peatland | AASAPASAPDASTIASIVDSVMADLRPKIVEEIAKRLAGK |
Ga0187887_107629612 | 3300018043 | Peatland | ASAAAPDASTIASIVDSVMADLRPKIVEEIAKKLSGK |
Ga0187890_102303021 | 3300018044 | Peatland | ASATDASTIASIVDRVMADLRPKIVEEITKKLGRK |
Ga0187769_105319473 | 3300018086 | Tropical Peatland | MAAAATTDSVPAVVPDPAAIASIVESVLADLRPKIVEEITKKLMGR |
Ga0187770_106155691 | 3300018090 | Tropical Peatland | KAMAAAAAEGSPSASTPAFVPDASTIASIVDSVMADLRPKIVEEIAKKLAGK |
Ga0182031_11661562 | 3300019787 | Bog | WSSAPDASTIASIVDRVLADLRPKLVEEIARKLAGK |
Ga0193722_10801862 | 3300019877 | Soil | MGATDPTAIANIVESVLAELRPKIVEEIARKLADPKKT |
Ga0193724_11210931 | 3300020062 | Soil | PERHGSMGATDPTAIANIVESVLAELRPKIVEEIARKLADPKKT |
Ga0210407_100052995 | 3300020579 | Soil | MAAATAAEGSESPSATDASTIVSIVDSIIADLRPKIVEEIAKKLAEK |
Ga0210403_100114384 | 3300020580 | Soil | VSQAEESPKAMAAATAAEGSESPSATDASTIVSIVDSIIADLRPKIVEEIAKKLAEK |
Ga0210399_101628874 | 3300020581 | Soil | MAAATAAEGSASPSATDASTIVSIVDSIIADLRPKIVEEIAKKLAEK |
Ga0210401_105595481 | 3300020583 | Soil | SACSPMPATAPDPRAIASIVDSVLAELRPKIVEEIAKKLADPNK |
Ga0210404_104655932 | 3300021088 | Soil | QAEESPKAMAAATAAEGSESPSATDASTIVSIVDSIIADLRPKIVEEIAKKLAEK |
Ga0210406_100172796 | 3300021168 | Soil | PMPATAPDPRAIASIVDSVLAELRPKIVEEIAKKLADPNK |
Ga0210387_103286791 | 3300021405 | Soil | GSTSASGTDAGTIASIVDSVMADLRPKIVEEIAKKLAGK |
Ga0210386_116869132 | 3300021406 | Soil | AQGPAPSPASDPKAIASIVDSVLAELRPKIVEEIARKLADTKKE |
Ga0210383_111860342 | 3300021407 | Soil | VASASSAETDIASIVEKVMADLRPKIVEEIARKLAGK |
Ga0210394_105884991 | 3300021420 | Soil | VTDARAIASIVDSVLAELRPKIVEEIARKLGDSKKD |
Ga0210390_109375451 | 3300021474 | Soil | SSSTSASDASTIAGIVDSVMADLRPKIVEEIAKRLAGK |
Ga0210398_113497271 | 3300021477 | Soil | AGVASASSAETDIASIVEKVMADLRPKIVEEIARKLAGK |
Ga0210410_103528531 | 3300021479 | Soil | ITPAPSEKTPVTDARAIASIVDSVLAELRPKIVEEIARKLGEPKKD |
Ga0210410_110839071 | 3300021479 | Soil | RGPSASDPKAIASIVDSVLAELRPRIVEEIARKLADSRKE |
Ga0210409_102947362 | 3300021559 | Soil | ATDPQAIASIVESVLAELRPKIVEEIARKIAESKKE |
Ga0137417_13882825 | 3300024330 | Vadose Zone Soil | LGSADPKAIASIVEGVLAELRPKIVEEIARRLAEPKKG |
Ga0208194_10421772 | 3300025412 | Peatland | AAATAAPTSVPDASTIASIVDSVMADLRPKIVEEIAKKLAGK |
Ga0207927_11102321 | 3300025579 | Arctic Peat Soil | AAAAEGSASASTADASTIASIVDRVMADLRPKIVEEIAKKLAGK |
Ga0207699_104536802 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | AASEKAAATDPQAIASIVESVLAELRPKIVEEIARKIAESKKE |
Ga0257163_10179841 | 3300026359 | Soil | GSAFPSATDARTIASIVDSVMADLRPKIVEEIAKKLAGK |
Ga0257173_10452072 | 3300026360 | Soil | AEGAASASATDARTIASIVDSVMADLRPKIVEEIAKKLAGR |
Ga0208365_10400211 | 3300027070 | Forest Soil | EKAAATDPQAIASIVESVLAELRPKIVEEIARKIAESKKE |
Ga0209622_10234902 | 3300027502 | Forest Soil | EKAHTASGATDPSAIASIVDSVLAELRPKIVEEIAKKLGDTKKG |
Ga0208984_11162562 | 3300027546 | Forest Soil | ASPSATDARTIASIVDSVMADLRPKIVEEIAKKLAGK |
Ga0209735_10323123 | 3300027562 | Forest Soil | ASLGATDPTAIANIVESVLAELRPKIVEEIARKLADPKKS |
Ga0208042_11150461 | 3300027568 | Peatlands Soil | SSPAASVPDASTIASIVDSIMADLRPKIVEEIARKLAGK |
Ga0209116_11425522 | 3300027590 | Forest Soil | STSTTDASTIASIVDSVMADLRPKIVEEIAKKLSGK |
Ga0209076_11892021 | 3300027643 | Vadose Zone Soil | AAAAEGSASPSATDASTIASIVDSVMADLRPKIVEEIAKKLAGK |
Ga0209736_10417021 | 3300027660 | Forest Soil | SPSATDASTIASIVDSVMADLRPKIVEEIAKKLAGK |
Ga0209118_10542512 | 3300027674 | Forest Soil | EGSASPSATDASTIASIVDSVMADLRPKIVEEIAKKLAGK |
Ga0209118_10827742 | 3300027674 | Forest Soil | AAAAAEGSAFLSATDASTIASIVDSVMADLRPKIVEEIAKKLAGK |
Ga0209333_10993642 | 3300027676 | Forest Soil | TTTSTTDASTIASIVDSVMADLRPRIVEEIAKKLSGK |
Ga0209039_104148981 | 3300027825 | Bog Forest Soil | AQSSASASATDASAIASIVDSVLAELRPKIVEEIAKKLAKRD |
Ga0209180_100679081 | 3300027846 | Vadose Zone Soil | EGAASASATDASTIARIVDSVMADLRPKIVEEIARKLAGR |
Ga0209274_105408442 | 3300027853 | Soil | PKAMAAAAAEGSSASAPDAGTIASIVDSVMADLRPKIVEEIAKKLAGK |
Ga0209274_105640682 | 3300027853 | Soil | AMAAAAASTPASVTDASTIASIVDSVMADLRPKIVEEIAKKLAGK |
Ga0209488_105356301 | 3300027903 | Vadose Zone Soil | AAASADGATDASSIASIVDSVLADLRPKIVEEIAKQLAKK |
Ga0209415_107179361 | 3300027905 | Peatlands Soil | AASVPDASTIASIVDSIMADLRPKIVEEIAKKLAGK |
Ga0302294_101747671 | 3300028740 | Fen | APLPTAASDAGSIANIVDSVLADLRPKIVEEIAKKLAGK |
Ga0265338_100784891 | 3300028800 | Rhizosphere | AAAAEGSGTASGSDANAIASIVDSVLADLRPKIVEEIAKKLGKK |
Ga0246001_10540161 | 3300029889 | Peat | AQGSATPSPAASVPDASTIASIVDSIMADLRPKIVEEIAKKLAGK |
Ga0311338_100458485 | 3300030007 | Palsa | FPSAADARTIASIVDSVMADLRPKIVEEITRKLAGK |
Ga0311338_115352931 | 3300030007 | Palsa | SEGSAPASTPASMPDASTIASIVDSVMADLRPKIVEEIARKLAGK |
Ga0302177_102193191 | 3300030053 | Palsa | ESSAPTPNPASSMPDASTIASIVDSVMADLRPKIVEEIARKLAGK |
Ga0170824_1068347332 | 3300031231 | Forest Soil | LTPAAPAPSASDPKAIASIVDSVLAELRPRIVEEIARKLADPKKE |
Ga0302324_1000612976 | 3300031236 | Palsa | AAAAAESSAPTPNPASSMPDASTIASIVDSVMADLRPKIVEEIARKLAGK |
Ga0170818_1075425762 | 3300031474 | Forest Soil | EGSSAGTDASTIASIVDSVMADLRPRIVEEIARKLAKK |
Ga0318561_102066851 | 3300031679 | Soil | TKPAATDPTAIANIVESVLAELRPKIVEEIARKLSEPKK |
Ga0307474_109774091 | 3300031718 | Hardwood Forest Soil | SASDPKAIASIVDSVLAELRPKIVEEIAKKLADSKKE |
Ga0307475_100884933 | 3300031754 | Hardwood Forest Soil | PHDTAPAGAADPKAIASIVDSVLAELRPRIVEEIAKKLSGDTKKD |
Ga0307479_100759535 | 3300031962 | Hardwood Forest Soil | AATDPQAIASIVESVLAELRPKIVEEIARKIAESKKE |
Ga0307479_109899972 | 3300031962 | Hardwood Forest Soil | MAAATAAEGSASPSATDASTIVSIVDSIMADLRPKIVEEIAKKLAEN |
Ga0307470_102718571 | 3300032174 | Hardwood Forest Soil | AGPESMPASGATDPRAIANIVDSVLAELRPKIVEEIAKKLADPKKS |
Ga0307471_1007869981 | 3300032180 | Hardwood Forest Soil | AGAADPKAIASIVDSVLAELRPRIVEEIAKKLSGDTKKD |
Ga0335081_101217726 | 3300032892 | Soil | ESTSASTTDPNQIASIVDSVLADLRPRIVEEIAKKLGKK |
Ga0326727_103520821 | 3300033405 | Peat Soil | AAAEGGRASASATDASTIASIVDSIMADLRPKIVEEIARKLAGK |
Ga0371488_0358086_8_154 | 3300033983 | Peat Soil | MAAAAAAEGGTAVTPATDARTIASIVDSVLADLRPKIVEEIARKLAGK |
⦗Top⦘ |