| Basic Information | |
|---|---|
| Family ID | F096827 |
| Family Type | Metagenome |
| Number of Sequences | 104 |
| Average Sequence Length | 54 residues |
| Representative Sequence | MEREKEGFDARGFLDLLAEVVHHDVTGVVNVRIHVRDGMPWAVSVQFDDAAKRAA |
| Number of Associated Samples | 54 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 84.62 % |
| % of genes near scaffold ends (potentially truncated) | 27.88 % |
| % of genes from short scaffolds (< 2000 bps) | 84.62 % |
| Associated GOLD sequencing projects | 47 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (52.885 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil (31.731 % of family members) |
| Environment Ontology (ENVO) | Unclassified (66.346 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (69.231 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.69% β-sheet: 21.69% Coil/Unstructured: 56.63% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF01717 | Meth_synt_2 | 13.46 |
| PF04226 | Transgly_assoc | 6.73 |
| PF04126 | Cyclophil_like | 5.77 |
| PF13594 | Obsolete Pfam Family | 4.81 |
| PF01436 | NHL | 2.88 |
| PF00294 | PfkB | 1.92 |
| PF00923 | TAL_FSA | 1.92 |
| PF00528 | BPD_transp_1 | 1.92 |
| PF13193 | AMP-binding_C | 0.96 |
| PF07883 | Cupin_2 | 0.96 |
| PF13147 | Obsolete Pfam Family | 0.96 |
| PF00158 | Sigma54_activat | 0.96 |
| PF13416 | SBP_bac_8 | 0.96 |
| PF02265 | S1-P1_nuclease | 0.96 |
| PF12706 | Lactamase_B_2 | 0.96 |
| PF02743 | dCache_1 | 0.96 |
| PF00378 | ECH_1 | 0.96 |
| PF01575 | MaoC_dehydratas | 0.96 |
| PF01546 | Peptidase_M20 | 0.96 |
| PF04055 | Radical_SAM | 0.96 |
| PF04392 | ABC_sub_bind | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 13.46 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 6.73 |
| COG0176 | Transaldolase/fructose-6-phosphate aldolase | Carbohydrate transport and metabolism [G] | 1.92 |
| COG2972 | Sensor histidine kinase YesM | Signal transduction mechanisms [T] | 0.96 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 52.88 % |
| Unclassified | root | N/A | 47.12 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2032320006|FACEOR_FYWIORV02H1ZYY | Not Available | 504 | Open in IMG/M |
| 3300000559|F14TC_100468407 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10040032 | Not Available | 1243 | Open in IMG/M |
| 3300004268|Ga0066398_10029179 | Not Available | 996 | Open in IMG/M |
| 3300004268|Ga0066398_10189117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 537 | Open in IMG/M |
| 3300004281|Ga0066397_10006166 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1374 | Open in IMG/M |
| 3300004633|Ga0066395_10372228 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300004633|Ga0066395_10646791 | Not Available | 623 | Open in IMG/M |
| 3300005093|Ga0062594_102279394 | Not Available | 588 | Open in IMG/M |
| 3300005289|Ga0065704_10624319 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300005332|Ga0066388_100008223 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7784 | Open in IMG/M |
| 3300005332|Ga0066388_100060451 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4008 | Open in IMG/M |
| 3300005332|Ga0066388_100125466 | All Organisms → cellular organisms → Bacteria | 3100 | Open in IMG/M |
| 3300005332|Ga0066388_102288894 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 977 | Open in IMG/M |
| 3300005332|Ga0066388_102452803 | Not Available | 947 | Open in IMG/M |
| 3300005332|Ga0066388_106221414 | Not Available | 602 | Open in IMG/M |
| 3300005332|Ga0066388_107380650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 552 | Open in IMG/M |
| 3300005332|Ga0066388_108169383 | Not Available | 523 | Open in IMG/M |
| 3300005332|Ga0066388_108571779 | Not Available | 509 | Open in IMG/M |
| 3300005347|Ga0070668_100549143 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300005444|Ga0070694_100249028 | All Organisms → cellular organisms → Bacteria | 1343 | Open in IMG/M |
| 3300005444|Ga0070694_100713733 | Not Available | 816 | Open in IMG/M |
| 3300005444|Ga0070694_101063050 | Not Available | 674 | Open in IMG/M |
| 3300005615|Ga0070702_100777699 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 738 | Open in IMG/M |
| 3300005713|Ga0066905_100009281 | All Organisms → cellular organisms → Bacteria | 4553 | Open in IMG/M |
| 3300005713|Ga0066905_100136604 | Not Available | 1741 | Open in IMG/M |
| 3300005713|Ga0066905_100232375 | Not Available | 1403 | Open in IMG/M |
| 3300005713|Ga0066905_100349113 | Not Available | 1181 | Open in IMG/M |
| 3300005713|Ga0066905_100381828 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
| 3300005713|Ga0066905_100554524 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300005713|Ga0066905_100775761 | Not Available | 829 | Open in IMG/M |
| 3300005713|Ga0066905_100886652 | Not Available | 779 | Open in IMG/M |
| 3300005713|Ga0066905_101137146 | Not Available | 695 | Open in IMG/M |
| 3300005713|Ga0066905_102162147 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300005764|Ga0066903_100245769 | All Organisms → cellular organisms → Bacteria | 2752 | Open in IMG/M |
| 3300005764|Ga0066903_101702563 | Not Available | 1201 | Open in IMG/M |
| 3300005764|Ga0066903_102369409 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| 3300005764|Ga0066903_102910222 | Not Available | 928 | Open in IMG/M |
| 3300005764|Ga0066903_103921760 | Not Available | 798 | Open in IMG/M |
| 3300005764|Ga0066903_104823528 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300005843|Ga0068860_100281616 | All Organisms → cellular organisms → Bacteria | 1625 | Open in IMG/M |
| 3300006049|Ga0075417_10014776 | All Organisms → cellular organisms → Bacteria | 3001 | Open in IMG/M |
| 3300006049|Ga0075417_10071388 | All Organisms → cellular organisms → Bacteria | 1537 | Open in IMG/M |
| 3300006058|Ga0075432_10086135 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1145 | Open in IMG/M |
| 3300006844|Ga0075428_101133539 | Not Available | 825 | Open in IMG/M |
| 3300006845|Ga0075421_102348689 | Not Available | 559 | Open in IMG/M |
| 3300006853|Ga0075420_100371070 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
| 3300009100|Ga0075418_10812479 | Not Available | 1010 | Open in IMG/M |
| 3300009100|Ga0075418_11871858 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 653 | Open in IMG/M |
| 3300009553|Ga0105249_10531599 | Not Available | 1224 | Open in IMG/M |
| 3300009792|Ga0126374_10027147 | All Organisms → cellular organisms → Bacteria | 2620 | Open in IMG/M |
| 3300010043|Ga0126380_10102808 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1719 | Open in IMG/M |
| 3300010043|Ga0126380_10594878 | Not Available | 870 | Open in IMG/M |
| 3300010043|Ga0126380_11426868 | Not Available | 609 | Open in IMG/M |
| 3300010046|Ga0126384_10321006 | Not Available | 1281 | Open in IMG/M |
| 3300010046|Ga0126384_10636604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax | 938 | Open in IMG/M |
| 3300010046|Ga0126384_10705407 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300010047|Ga0126382_11302817 | Not Available | 657 | Open in IMG/M |
| 3300010047|Ga0126382_11322151 | Not Available | 653 | Open in IMG/M |
| 3300010047|Ga0126382_11965174 | Not Available | 555 | Open in IMG/M |
| 3300010047|Ga0126382_11979333 | Not Available | 554 | Open in IMG/M |
| 3300010048|Ga0126373_12808247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 543 | Open in IMG/M |
| 3300010361|Ga0126378_10977247 | Not Available | 951 | Open in IMG/M |
| 3300010362|Ga0126377_10820133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 990 | Open in IMG/M |
| 3300010362|Ga0126377_10963722 | Not Available | 918 | Open in IMG/M |
| 3300010366|Ga0126379_10006817 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7736 | Open in IMG/M |
| 3300010366|Ga0126379_10085630 | All Organisms → cellular organisms → Bacteria | 2749 | Open in IMG/M |
| 3300010366|Ga0126379_10165015 | All Organisms → cellular organisms → Bacteria | 2085 | Open in IMG/M |
| 3300010366|Ga0126379_10853261 | Not Available | 1012 | Open in IMG/M |
| 3300010366|Ga0126379_12711386 | Not Available | 592 | Open in IMG/M |
| 3300010366|Ga0126379_13486778 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300010366|Ga0126379_13564185 | Not Available | 521 | Open in IMG/M |
| 3300010398|Ga0126383_10157850 | All Organisms → cellular organisms → Bacteria | 2125 | Open in IMG/M |
| 3300010398|Ga0126383_10250671 | All Organisms → cellular organisms → Bacteria | 1737 | Open in IMG/M |
| 3300010398|Ga0126383_10859865 | Not Available | 992 | Open in IMG/M |
| 3300010399|Ga0134127_12848584 | Not Available | 563 | Open in IMG/M |
| 3300010403|Ga0134123_10461020 | Not Available | 1185 | Open in IMG/M |
| 3300012948|Ga0126375_10097508 | Not Available | 1731 | Open in IMG/M |
| 3300012948|Ga0126375_10467761 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300012948|Ga0126375_11004332 | Not Available | 679 | Open in IMG/M |
| 3300012948|Ga0126375_11170656 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300012971|Ga0126369_10490967 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
| 3300012971|Ga0126369_12390339 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300015371|Ga0132258_10138969 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5808 | Open in IMG/M |
| 3300015371|Ga0132258_11235420 | All Organisms → cellular organisms → Bacteria | 1889 | Open in IMG/M |
| 3300015372|Ga0132256_100458144 | Not Available | 1383 | Open in IMG/M |
| 3300015374|Ga0132255_106281417 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 503 | Open in IMG/M |
| 3300017792|Ga0163161_11629549 | Not Available | 570 | Open in IMG/M |
| 3300025918|Ga0207662_10176026 | All Organisms → cellular organisms → Bacteria | 1375 | Open in IMG/M |
| 3300027646|Ga0209466_1033667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1048 | Open in IMG/M |
| 3300027654|Ga0209799_1049233 | Not Available | 942 | Open in IMG/M |
| 3300027873|Ga0209814_10050062 | All Organisms → cellular organisms → Bacteria | 1743 | Open in IMG/M |
| 3300027874|Ga0209465_10590218 | Not Available | 551 | Open in IMG/M |
| 3300027907|Ga0207428_11290972 | Not Available | 506 | Open in IMG/M |
| 3300028381|Ga0268264_10234018 | All Organisms → cellular organisms → Bacteria | 1698 | Open in IMG/M |
| 3300028587|Ga0247828_10337532 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300031543|Ga0318516_10005664 | All Organisms → cellular organisms → Bacteria | 5704 | Open in IMG/M |
| 3300031720|Ga0307469_10224251 | Not Available | 1489 | Open in IMG/M |
| 3300031740|Ga0307468_100029633 | All Organisms → cellular organisms → Bacteria | 2585 | Open in IMG/M |
| 3300031740|Ga0307468_100067987 | All Organisms → cellular organisms → Bacteria | 1962 | Open in IMG/M |
| 3300031747|Ga0318502_10021018 | All Organisms → cellular organisms → Bacteria | 3165 | Open in IMG/M |
| 3300032001|Ga0306922_10035992 | All Organisms → cellular organisms → Bacteria | 5066 | Open in IMG/M |
| 3300032063|Ga0318504_10533991 | Not Available | 562 | Open in IMG/M |
| 3300032174|Ga0307470_10325237 | Not Available | 1055 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 31.73% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 29.81% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.62% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.88% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.88% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.96% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.96% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2032320006 | Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACEORE_722450 | 2032320006 | Soil | MEHKEVSMEHKKETFDAHEFLDLLGEVMDHDVTGVLNVRIHVRDGMAWAVSVQFNDAATRAA |
| F14TC_1004684072 | 3300000559 | Soil | MEHEKEAFDARAFLDLLDEVVHHDVTGVLNVRIHVRDGMPWAVSVQFDNTAKKAA* |
| AF_2010_repII_A1DRAFT_100400322 | 3300000597 | Forest Soil | MENEKEAFDGAGFFDLLGEVMTDHATGVVSVRIHVRDGMPWAVSVHFDKETEKAA* |
| Ga0066398_100291791 | 3300004268 | Tropical Forest Soil | MDNEKRAFDSAGFFDLLGQVMTRHNTGVLSLRIHIRDGLPWAVSV |
| Ga0066398_101891171 | 3300004268 | Tropical Forest Soil | MENEKKGFDGVAFFDLLGEVMTHHGTGVVSVRIHVRDGMPWAVSVHFDRETGKAA* |
| Ga0066397_100061661 | 3300004281 | Tropical Forest Soil | MESEKKAFDSAGFFDLLGQVMTRHNTGVVSLRIHVRDGLPWAVSVDFERETGKAA* |
| Ga0066395_103722282 | 3300004633 | Tropical Forest Soil | MDNEKRAFDSAGFFDLLGQVMTRHNTGVLSLRIHIRDGLPWAVSVDFDDTKEKAA* |
| Ga0066395_106467911 | 3300004633 | Tropical Forest Soil | MEHEKEAFDAHAFLDLLDEVVHHDVTGVVNVRIHIRDGMPWAVSVQFDQKAA* |
| Ga0062594_1022793941 | 3300005093 | Soil | MERKKEAFDAGGFLDLLSEVMDHEVTGVLNVQIHVRDGMAWAMSVHFNDAATRAA* |
| Ga0065704_106243191 | 3300005289 | Switchgrass Rhizosphere | MEREKEGFDARGFLDLLAEVVHHDVTGVVNVRIHVRDGMPWAVSVQFDDAAKRAA* |
| Ga0066388_1000082234 | 3300005332 | Tropical Forest Soil | MDNEKRAFDSAGFFDLLGQVMTRHNTGVLSLRIHIRDGLPWAVSVDFDGTKEKAA* |
| Ga0066388_1000604512 | 3300005332 | Tropical Forest Soil | MEPEKEAFDARAFLDLLGEVVHHEVTGVLNVRIHVRDGMPWAVSVQFDNTAKRAA* |
| Ga0066388_1001254663 | 3300005332 | Tropical Forest Soil | MENEKKGFDGVAFFDLLGEVMTHHGTGVVSVRIHVRDGLPWAVSVHFDKETGKAA* |
| Ga0066388_1022888942 | 3300005332 | Tropical Forest Soil | MEYETVAFDARGFLDLLTDVVHYEDTGVLNVRIHVRDGMPWAVSVQFDKAGKRAA* |
| Ga0066388_1024528032 | 3300005332 | Tropical Forest Soil | MDNENEAFDGAGFFDLLGEVMTHHGTGVVSVRIHVRDGMPWAVSVHFDREAEKAA* |
| Ga0066388_1062214142 | 3300005332 | Tropical Forest Soil | MENEKEAFDGAGFFDLLGEVMTYHATGVVSVRIHVRDGMPWAVSVHFDKEAEKAA* |
| Ga0066388_1073806502 | 3300005332 | Tropical Forest Soil | MENEKEAFDGAGFFDLLGEVMTHHGTGVVSVRIHVRDGMPWAVSVHFDREAEKAA* |
| Ga0066388_1081693831 | 3300005332 | Tropical Forest Soil | MDHENEAFDVHGFLDLLAEVVHHDVTGVVNVRIHVRDGLPWAVSVQFDDAGKRAA* |
| Ga0066388_1085717791 | 3300005332 | Tropical Forest Soil | MENEKDAFDGAGFFDLLGEVMTYHGTGVVSVRIHVRDGMPWAVSVHFDKEAEKAA* |
| Ga0070668_1005491433 | 3300005347 | Switchgrass Rhizosphere | MEREKEGFDARGFLDLLAEVVHHDVTGVVNVRIHVRDGMPWAVSVQFDDAARRAA* |
| Ga0070694_1002490281 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MEREKEGFDARGFLDLLAEVVHHDVTGVVNVRIHVRDGMPWAVSVQFDDA |
| Ga0070694_1007137332 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MEHEKEGFDARGFLDLLAEVAHHELTGVVNVRIHVRDGMPWALSVQFDNAAERAA* |
| Ga0070694_1010630501 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | VEHKEEAFDAHRFLDLLGEVMDHDVTGVLNVRIHVRDGMAWAVSVQFNDAAERAA* |
| Ga0070702_1007776992 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MEREQEGFDARGFLDLLAEVVHHDVTGVVNVRIHVRDGMPWAVSVQFDDATKRAA* |
| Ga0066905_1000092814 | 3300005713 | Tropical Forest Soil | MEHEKEGFDARGFLDLLGEVVHHDLTGVVNVRIHVRDGSPWAVSVQFDDERAA* |
| Ga0066905_1001366041 | 3300005713 | Tropical Forest Soil | MEHEKEFDARAFLDLLDEVVHHDVTGVVNIRIHIRDGMPWAMSVQFDNAAKKAA* |
| Ga0066905_1002323752 | 3300005713 | Tropical Forest Soil | MELEKEAFDPRAFLDLLGEVVHHDVTGVLNVRIHVRDGMPWAVSVQFDKRAA* |
| Ga0066905_1003491132 | 3300005713 | Tropical Forest Soil | MEHEKEAFDARAFLDLLGEVAHHEVTGVLNVRIHVRDGMPWAVSVQFDDTAKRAA* |
| Ga0066905_1003818282 | 3300005713 | Tropical Forest Soil | MEQEKEGFDPRGFLDLLAEVVHHDVTGVVNVRIHVRDGMPWAVSVQFDDAAKRAA* |
| Ga0066905_1005545243 | 3300005713 | Tropical Forest Soil | MEREKEGFDARGFLDLLAEVVRHDVTGVVNVRIHVRDGMPWAVSVQFDKAA* |
| Ga0066905_1007757611 | 3300005713 | Tropical Forest Soil | MEHEKEGFDARGFLDLLGEVVHHDLTGVVNVRIHVRDGMPWAVSVQFDNAAERAA* |
| Ga0066905_1008866521 | 3300005713 | Tropical Forest Soil | MEHDKEAFDAGGFLDLLSEVTDHEVTGVLYVRIHVRDGTAWAVSIQFDDAP |
| Ga0066905_1011371463 | 3300005713 | Tropical Forest Soil | GFLDLLAEVVHHGATGVMNVRLHVRDGMPWAVSVQFDDAGKRAA* |
| Ga0066905_1021621472 | 3300005713 | Tropical Forest Soil | MEPEKEGFDARAFLDLLGEVVHHEVTGVLNVRIHVRDGMPWAVSVQFDNTAKRAA* |
| Ga0066903_1002457693 | 3300005764 | Tropical Forest Soil | MDNEKKGFDGVAFFDLLGEVMTHHGTGVVSVRIHVRDGMPWAVSVHFDKETGKAA* |
| Ga0066903_1017025633 | 3300005764 | Tropical Forest Soil | MEHEKEEFDARGFLDLLGEVVHHDLTGVVNVRIHVRDGRPWAVSVQFDNAAERAA* |
| Ga0066903_1023694092 | 3300005764 | Tropical Forest Soil | MERETEGFDARGFLDLLAEVVHHDVTGVVNVRIHVRDGVPWAVSVQFDDAAKKAA* |
| Ga0066903_1029102222 | 3300005764 | Tropical Forest Soil | MEPEKEEFDARAFLDLLGEVVHHEVTGVLNVRIHVRDGMPWAVSVQFDNTAKRAA* |
| Ga0066903_1039217601 | 3300005764 | Tropical Forest Soil | HKAFDAAGFLELLGEVMFEHDTHTGVVSVRIHVRDGVPWAVSVQFDNAAKKTA* |
| Ga0066903_1048235281 | 3300005764 | Tropical Forest Soil | MEHEKEAFDVSGFLDLMGEVMDREVVPDNVICVVSVRIHVRDGMPWAVSVQFDDAGKRAA |
| Ga0068860_1002816164 | 3300005843 | Switchgrass Rhizosphere | MEREKEGFDARGFLDLLAEVVHHDVTGVVNVRIHVRDGMPWAVSVQFD |
| Ga0075417_100147762 | 3300006049 | Populus Rhizosphere | MEHEKEFDPRAFLDLLDEVVHHDVTGVVNIRIHIRDGMPWAMSVQFDNAAKKAA* |
| Ga0075417_100713883 | 3300006049 | Populus Rhizosphere | MEREKEGFDARGFLDLLAEVVHHDVTGVVNVRIHVRDGMPWAVSVQFDDATKRAA* |
| Ga0075432_100861351 | 3300006058 | Populus Rhizosphere | MEHEKEFDPRAFLDLLDEVVHHDVTGVVNIRIHIRDGM |
| Ga0075428_1011335393 | 3300006844 | Populus Rhizosphere | MENEKEGFDARGFLDLLAEVAHHELTGVVNVRIHVRDGMPWALSVQFDNAAERAA* |
| Ga0075421_1023486893 | 3300006845 | Populus Rhizosphere | FDAHGFLDLLAEVVHHDATGVVNVRIHVRDGMPWAVSVQFDDAGKRAA* |
| Ga0075420_1003710703 | 3300006853 | Populus Rhizosphere | MEREKEGFDARGFLDLLAEVVHHDVTGVVNVRIHVRDGMPWAVSV |
| Ga0075418_108124791 | 3300009100 | Populus Rhizosphere | MEHEKGALDAPGLLDLLGEVMDHEVTGVLNVRIHVRHGMAWAVSVQFNDAATRAA* |
| Ga0075418_118718581 | 3300009100 | Populus Rhizosphere | HGFLDLLGEVMTHDVTGVLNVRIHVRDGMAWAVSVQFNDAAKRAA* |
| Ga0105249_105315991 | 3300009553 | Switchgrass Rhizosphere | GFLDLLAEVAHHELTGVVNVRIHVRDGMPWALSVQFDNAAERAA* |
| Ga0126374_100271472 | 3300009792 | Tropical Forest Soil | MDNEKRAFDSAGFFDLLGQVMTRHNTGVVSLRIHIRDGLPWAVSVDFDDTKEKAA* |
| Ga0126380_101028082 | 3300010043 | Tropical Forest Soil | MDNEKKAFDGSGFFDLLGEVMTRHDTGVVSVRIHVRDGTPWAVSVQFDSAKEKAA* |
| Ga0126380_105948781 | 3300010043 | Tropical Forest Soil | MDNEKRAFDSAGFFDLLGQVMTRHNTGVVSLRIHIRDGLPWAVSVDFDGTKEKAA* |
| Ga0126380_114268681 | 3300010043 | Tropical Forest Soil | MENEKEAFDGAGFFDLLGEVMTHHATGVVSVRIHVRDGLPWAVSVHFDKEAEKAA* |
| Ga0126384_103210061 | 3300010046 | Tropical Forest Soil | QKGSAMENEKKAFDSAGFFDLLGQVMTRHNTGVVSLRIHVRDGLPWAVSVDFERETGKAA |
| Ga0126384_106366042 | 3300010046 | Tropical Forest Soil | MDHENEAFNAHGFLDLLAEVVHHGATGVMNVRLHVRDGMPWAVSVQFDDAGKRAA* |
| Ga0126384_107054073 | 3300010046 | Tropical Forest Soil | MENEKKGFDGVAFFDLLGEVMTHHGTGVVSVRIHVRDGMPWAVSVHFDKETGKAA* |
| Ga0126382_113028171 | 3300010047 | Tropical Forest Soil | MEKEKEAFDGAGFFDLLGEVMTHHATGVVSVRIRVRDGTPWAVSVQFDSAKEKAA* |
| Ga0126382_113221512 | 3300010047 | Tropical Forest Soil | MENEKKAFDSAGFFDLLGQVMTRHNTGVVSLRIHVRDGLPWAVSVHFERETGKAA* |
| Ga0126382_119651741 | 3300010047 | Tropical Forest Soil | MDDKKEAFDVRGFLNLLAEVAHHDVTGVVNVRIHVRGGMPWAVSFQFDDEARAA* |
| Ga0126382_119793332 | 3300010047 | Tropical Forest Soil | MEPEKEAFDARAFLDLLGEVVHHEVTGVLNVRIHVRDGMPWAVSVQFDDTAKRAA* |
| Ga0126373_128082471 | 3300010048 | Tropical Forest Soil | MENEKEAFDGAGFFDLLGEVMTYHATGVVSVRIHVRDGMPWAVSVHFDREAEKAA* |
| Ga0126378_109772472 | 3300010361 | Tropical Forest Soil | MENEKEAFDGAGFFDLLGEVMTHHGTGVVSVRIHVRDGLPWAVSVHFDKEAEKAA* |
| Ga0126377_108201332 | 3300010362 | Tropical Forest Soil | MDNEKKAFDGSGFFDLLGEVMTRHDTGVVSVRIRIRDGTPWAVSVQFDSAKEKAA* |
| Ga0126377_109637222 | 3300010362 | Tropical Forest Soil | MEHEKEAFEARGFLDLLAEVAHHDVTGVLNVRIHVRDGMAWAVSVQFDNTTKRAA* |
| Ga0126379_100068171 | 3300010366 | Tropical Forest Soil | NEKKAFDSAGFFDLLGQVMTRHNTGVVSLRIHIRDGLPWAVSVDFDDTKEKAA* |
| Ga0126379_100856304 | 3300010366 | Tropical Forest Soil | MENEKEAFDGAGFFDLLGEVMTDHATGVVSVRIHVRDGMPWAVSVHFDKEAEKAA* |
| Ga0126379_101650152 | 3300010366 | Tropical Forest Soil | MEHEKEGFDARGFLDLLGEVVHHDLTGVVNVRIHVRDGRPWAVSVQFDNAAERAA* |
| Ga0126379_108532611 | 3300010366 | Tropical Forest Soil | NEKKGFDGVAFFDLLGEVMTHHGTGVVSVRIHVRDGMPWAVSVHFDKETGKAA* |
| Ga0126379_127113861 | 3300010366 | Tropical Forest Soil | MDHEKEAFDPRGFLDLLAEVVHHDATGVLNVRIHVRDGRAWAVSVQFDNAAKRAAA* |
| Ga0126379_134867783 | 3300010366 | Tropical Forest Soil | MEHEKVAFDARGFLDLLTDVVHHEDTGVLNVRIHVRDGMPWAVSVQFDNAGKRAA* |
| Ga0126379_135641851 | 3300010366 | Tropical Forest Soil | MEHEKEAFDAHAFLDLLDEVVHHDVTGVVNIRIHIRDGMPWAMSVQFDHAAKKAA* |
| Ga0126383_101578501 | 3300010398 | Tropical Forest Soil | MEREKEGFDARGFLDLLAEVVHHDVTGVVNVRIHVRDGMPWAVSVQFDEAA* |
| Ga0126383_102506713 | 3300010398 | Tropical Forest Soil | MENEKEAFDGAGFFDLLGEVMTYHATGVVSVRIHVRDGMPWAVSV |
| Ga0126383_108598651 | 3300010398 | Tropical Forest Soil | MDNENEAFDGAGFFDLLGEVMTHHGTGVVSVRIHVRDGLPWAVSVHFDKEAEKAA* |
| Ga0134127_128485841 | 3300010399 | Terrestrial Soil | LALLEVSVEHKEEAFDAHGFLDLLGEVMDHDVTGVLNVRIHVRDGMAWAVSVQFNDAAERAA |
| Ga0134123_104610201 | 3300010403 | Terrestrial Soil | KEGFDARGFLDLLAEVAHHELTGVVNVRIHVRDGMPWALSVQFDNAAERAA* |
| Ga0126375_100975082 | 3300012948 | Tropical Forest Soil | MDHENEAFNAHGFLDLLAEVVHHGATGVMNVRIHVRDGIPWAVSVQFDDAGKRAA* |
| Ga0126375_104677613 | 3300012948 | Tropical Forest Soil | MEREKEGFDARGFLDLLAEVVRHDVTGVVNVRIHVRDGMPWAVSVQFDEAA* |
| Ga0126375_110043322 | 3300012948 | Tropical Forest Soil | MENEKKTFDSGGFFDLLGEVMTRHNTGVVSLRIHVRDGLPW |
| Ga0126375_111706561 | 3300012948 | Tropical Forest Soil | MEHEKEAFDARAFLDLLGEVAHHEVTGVLNVRIHVRDGMPWAVSVQFDDTAKR |
| Ga0126369_104909672 | 3300012971 | Tropical Forest Soil | MEHEKEVFDARGFLDLLGEVVHHDLTGVVNVRIHVRDGRPWAVSVQFDNAAERAA* |
| Ga0126369_123903392 | 3300012971 | Tropical Forest Soil | MDHEKEAFDPHGFLHLLAEVVHHDATGVLNVRIHVRDGRAWAVSVQFDNAAKRAAA* |
| Ga0132258_101389696 | 3300015371 | Arabidopsis Rhizosphere | MEREKEEFDARGFLDLLAEVAHHDVTGVLNVRIHVRDGMPWAVSVQFDDAAKKAA* |
| Ga0132258_112354201 | 3300015371 | Arabidopsis Rhizosphere | KEAFDAHGFFDLLAEVVHHEATGVLSLRIHVRDGLPWAMSVQFDNAEESAA* |
| Ga0132256_1004581442 | 3300015372 | Arabidopsis Rhizosphere | MEREKEEFDARGFLDLLAEVVHHDVTGVVNVRIHVRDGMPWAVSVQFDDAAKKAA* |
| Ga0132255_1062814171 | 3300015374 | Arabidopsis Rhizosphere | MEHEKEAFDAHGFLDLLGEVMDHDVTGVLNVRIHVRDGMAWAVSVEFDDAAKRAA* |
| Ga0163161_116295492 | 3300017792 | Switchgrass Rhizosphere | MEREKEGFDARGFLDLLAEVVHHDVTGVVNVRIHVRDGMPWAVSVQFDDAAKRAA |
| Ga0207662_101760263 | 3300025918 | Switchgrass Rhizosphere | AFDAHGFLDLLGEVMDHDVTGVLNVRIHVRDGIAWAVSVEFDDAAKRAA |
| Ga0209466_10336672 | 3300027646 | Tropical Forest Soil | MENEKEAFDGAGFFDLLGEVMTHHATGVVSVRIHVRDGLPWAVSVDFERETGKAA |
| Ga0209799_10492332 | 3300027654 | Tropical Forest Soil | MENEKEAFDGAGFFDLLGEVMTHHGTGVVSVRIHVRDGMPWAVSVHFDRETGKAA |
| Ga0209814_100500622 | 3300027873 | Populus Rhizosphere | MEHEKEFDPRAFLDLLDEVVHHDVTGVVNIRIHIRDGMPWAMSVQFDNAAKKAA |
| Ga0209465_105902182 | 3300027874 | Tropical Forest Soil | MERETEGFDASGFLDLLAEVVHHDGTGVVNVRIHVRDGMPWAVSVQFDEAA |
| Ga0207428_112909722 | 3300027907 | Populus Rhizosphere | MEHEKEGFDARGFLDLLAEVAHHELTGVVNVRIHVRDGMPWALSVQFDNAAERAA |
| Ga0268264_102340181 | 3300028381 | Switchgrass Rhizosphere | MEREKEGFDARGFLDLLAEVVHHDVTGVVNVRIHVRDGMPWAVSVQFDD |
| Ga0247828_103375322 | 3300028587 | Soil | MEREKEGFDARGFLDLLAEVVHHDVTGVVNVRIHVRDGMPWAVSVQFDDAAKKAA |
| Ga0318516_100056647 | 3300031543 | Soil | MENEKEAFDGAGFFDLLGEVMTYHATGVVSVRIHVRDGMPWAVSVHFDKEAEKAA |
| Ga0307469_102242513 | 3300031720 | Hardwood Forest Soil | MDHEKEASFDARAFLDLLAEVVHHEVTGVVNVRIHVRDGMPWAVSVQFDDAAKRAA |
| Ga0307468_1000296334 | 3300031740 | Hardwood Forest Soil | MEREKEGFDARGFLDLLAEVVHHDVTGVVNVRIHVRDGMPWAVSVQFDDAARRAA |
| Ga0307468_1000679874 | 3300031740 | Hardwood Forest Soil | MDHEKEASFDARAFLDLLAEVVHHEVTGVVNVRIHVRDGMPWAVSVQFDDAAK |
| Ga0318502_100210181 | 3300031747 | Soil | MENEKEAFDGAGFFDLLGEVMTYHATGVVSVRIHVRDGMPWAVSVHF |
| Ga0306922_100359927 | 3300032001 | Soil | MENEKEAFDGAGFFDLLGEVMTYHATGVVSVRIHVRDGMPWAVSVHFDKEAEKA |
| Ga0318504_105339912 | 3300032063 | Soil | MENEKEAFDGAGFFDLLGEVMTYHATGVVSVRIHVRDGMPWAVSVHFDKEAEK |
| Ga0307470_103252372 | 3300032174 | Hardwood Forest Soil | HEKEFDPRAFLDLLDEVVHHDVTGVVNIRIHIRDGMPWAMSVQFDNAAKKAA |
| ⦗Top⦘ |