NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F096822

Metagenome / Metatranscriptome Family F096822

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F096822
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 193 residues
Representative Sequence EKDKPGGEKIVGGGPPALGAYASGVAYILHKEGGRGEDLKYLATVLDRYPWNEEGWWASTIDVATGEPKVPLTKPSIINKTAAIAMAAGIVSAYVRDIDPELSSRLKQKTDKCIYSQIIPAQEADGFWHYSLSDNDPNDKDVLGYFMLTTKELMDLQKFNAAYREEKLNAAVQKAQAFAFKCIAPM
Number of Associated Samples 93
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.96 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.84

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake
(12.500 % of family members)
Environment Ontology (ENVO) Unclassified
(24.038 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(27.885 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 51.87%    β-sheet: 2.80%    Coil/Unstructured: 45.33%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.84
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
a.102.1.0: automated matchesd4z4ja14z4j0.72616
a.102.1.6: Hypothetical protein YteRd2d8la_2d8l0.7178
a.102.1.0: automated matchesd3gt5a13gt50.71642
a.102.1.2: Cellulases catalytic domaind1ks8a11ks80.71274
a.102.3.1: Alginate lyase A1-IIId3evha13evh0.71268


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090007|LWFCAnN_GO09JKT01C0PDEAll Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6505Open in IMG/M
3300001213|JGIcombinedJ13530_102905686All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6522Open in IMG/M
3300001213|JGIcombinedJ13530_105700933All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6684Open in IMG/M
3300001213|JGIcombinedJ13530_108209292All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6548Open in IMG/M
3300003388|JGI25910J50241_10179277All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6540Open in IMG/M
3300003388|JGI25910J50241_10179456All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6540Open in IMG/M
3300003404|JGI25920J50251_10115638All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6604Open in IMG/M
3300003404|JGI25920J50251_10115800All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6604Open in IMG/M
3300003796|Ga0007865_1026614All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6528Open in IMG/M
3300004156|Ga0062589_102656299All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6520Open in IMG/M
3300004157|Ga0062590_101101957All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6765Open in IMG/M
3300004643|Ga0062591_101517447All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6671Open in IMG/M
3300004765|Ga0007745_1004116All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6597Open in IMG/M
3300004810|Ga0007757_10147649All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6646Open in IMG/M
3300004810|Ga0007757_10148301All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6646Open in IMG/M
3300004836|Ga0007759_10283579All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6625Open in IMG/M
3300005280|Ga0065696_1111807All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6511Open in IMG/M
3300005330|Ga0070690_101251541All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6593Open in IMG/M
3300005330|Ga0070690_101383158All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6566Open in IMG/M
3300005343|Ga0070687_100925877All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6627Open in IMG/M
3300005354|Ga0070675_102084037All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6523Open in IMG/M
3300005365|Ga0070688_101432498All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6561Open in IMG/M
3300005456|Ga0070678_101636032All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6605Open in IMG/M
3300005517|Ga0070374_10559688All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6568Open in IMG/M
3300005842|Ga0068858_102292383All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6534Open in IMG/M
3300006844|Ga0075428_102122568All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6581Open in IMG/M
3300006845|Ga0075421_101822128All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6654Open in IMG/M
3300007606|Ga0102923_1240112All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6560Open in IMG/M
3300007661|Ga0102866_1199726All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6515Open in IMG/M
3300009101|Ga0105247_11054686All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6638Open in IMG/M
3300009152|Ga0114980_10648761All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6594Open in IMG/M
3300009155|Ga0114968_10460395All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6687Open in IMG/M
3300009163|Ga0114970_10722795All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6528Open in IMG/M
3300009167|Ga0113563_13583421All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6526Open in IMG/M
3300009176|Ga0105242_12531904All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6562Open in IMG/M
3300009185|Ga0114971_10642287All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6584Open in IMG/M
3300010038|Ga0126315_11087891All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6539Open in IMG/M
3300010042|Ga0126314_11272002All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6551Open in IMG/M
3300010399|Ga0134127_12893457All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6559Open in IMG/M
3300010403|Ga0134123_11902290All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6651Open in IMG/M
3300010403|Ga0134123_11961266All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6643Open in IMG/M
3300010403|Ga0134123_12564461All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6576Open in IMG/M
3300011402|Ga0137356_1066572All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6683Open in IMG/M
3300011409|Ga0137323_1097748All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6650Open in IMG/M
3300011417|Ga0137326_1168746All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6506Open in IMG/M
3300011445|Ga0137427_10325476All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6648Open in IMG/M
3300012039|Ga0137421_1225216All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6546Open in IMG/M
3300012166|Ga0137350_1108034All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6564Open in IMG/M
3300012175|Ga0137321_1134966All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6552Open in IMG/M
3300012232|Ga0137435_1187623All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6635Open in IMG/M
3300012469|Ga0150984_109361855All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6516Open in IMG/M
3300012469|Ga0150984_121317018All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6538Open in IMG/M
3300012893|Ga0157284_10322859All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6513Open in IMG/M
3300013092|Ga0163199_1408716All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6503Open in IMG/M
3300014866|Ga0180090_1084774All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6566Open in IMG/M
3300014968|Ga0157379_11219989All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6724Open in IMG/M
3300015200|Ga0173480_10702571All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6634Open in IMG/M
3300015374|Ga0132255_103847421All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6638Open in IMG/M
3300017965|Ga0190266_10758963All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6616Open in IMG/M
3300018429|Ga0190272_11587840All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6670Open in IMG/M
3300018469|Ga0190270_12176487All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6615Open in IMG/M
3300018481|Ga0190271_13066455All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6560Open in IMG/M
3300019361|Ga0173482_10430858All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6621Open in IMG/M
3300019362|Ga0173479_10591402All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6579Open in IMG/M
3300019362|Ga0173479_10666757All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6555Open in IMG/M
3300019377|Ga0190264_11561443All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6578Open in IMG/M
3300020158|Ga0194038_1225042All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6531Open in IMG/M
3300021078|Ga0210381_10328966All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6556Open in IMG/M
3300021520|Ga0194053_10317364All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6600Open in IMG/M
3300022886|Ga0247746_1169225All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6564Open in IMG/M
3300023168|Ga0247748_1073186All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6541Open in IMG/M
3300025900|Ga0207710_10489221All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6638Open in IMG/M
3300025918|Ga0207662_11184594All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6543Open in IMG/M
3300025930|Ga0207701_11029753All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6685Open in IMG/M
3300025942|Ga0207689_11668299All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6529Open in IMG/M
3300026067|Ga0207678_11821796All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6532Open in IMG/M
3300026118|Ga0207675_101884714All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6616Open in IMG/M
3300026121|Ga0207683_11899431All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6544Open in IMG/M
3300027193|Ga0208800_1041010All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6626Open in IMG/M
3300027196|Ga0208438_1076540All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6543Open in IMG/M
3300027656|Ga0209357_1162973All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6589Open in IMG/M
3300027756|Ga0209444_10293464All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6547Open in IMG/M
3300027760|Ga0209598_10268573All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6682Open in IMG/M
3300027892|Ga0209550_10671590All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6600Open in IMG/M
3300027892|Ga0209550_10671591All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6600Open in IMG/M
3300027909|Ga0209382_12081077All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6541Open in IMG/M
(restricted) 3300027970|Ga0247837_1306353All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6596Open in IMG/M
3300027971|Ga0209401_1252750All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6632Open in IMG/M
(restricted) 3300027977|Ga0247834_1336664All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6508Open in IMG/M
3300031250|Ga0265331_10431148All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6592Open in IMG/M
3300031525|Ga0302326_13120340All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6562Open in IMG/M
3300031726|Ga0302321_103555927All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6507Open in IMG/M
3300031857|Ga0315909_10873073All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6559Open in IMG/M
3300031858|Ga0310892_10585700All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6754Open in IMG/M
3300031892|Ga0310893_10440843All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6577Open in IMG/M
3300031902|Ga0302322_102677020All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6615Open in IMG/M
3300031908|Ga0310900_10731807All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6795Open in IMG/M
3300032157|Ga0315912_11210018All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6598Open in IMG/M
3300032174|Ga0307470_11336954All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6589Open in IMG/M
3300032177|Ga0315276_12462479All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6522Open in IMG/M
3300033414|Ga0316619_11660773All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6576Open in IMG/M
3300034062|Ga0334995_0773161All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6530Open in IMG/M
3300034106|Ga0335036_0606051All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6664Open in IMG/M
3300034151|Ga0364935_0318110All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6515Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake12.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.58%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil8.65%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake5.77%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater4.81%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere4.81%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine3.85%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.85%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland2.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.88%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.88%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater1.92%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.92%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.92%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere1.92%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.96%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.96%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Sediment0.96%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.96%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.96%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.96%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.96%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.96%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.96%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.96%
Switchgrass Rhizosphere Bulk SoilHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere Bulk Soil0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.96%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.96%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090007Freshwater sediment microbial communities from Lake Washington, Seattle, for methane and nitrogen Cycles - from flow sorted anaerobic plus nitrateEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300003388Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SNEnvironmentalOpen in IMG/M
3300003404Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMDEnvironmentalOpen in IMG/M
3300003796Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul09EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300004765Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004810Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004836Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005280Switchgrass rhizosphere microbial community from Michigan, USA - East Lansing bulk soilHost-AssociatedOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005517Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300007606Estuarine microbial communities from the Columbia River estuary - metaG 1569-02EnvironmentalOpen in IMG/M
3300007661Estuarine microbial communities from the Columbia River estuary - metaG 1546A-3EnvironmentalOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009152Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaGEnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009163Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaGEnvironmentalOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009185Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaGEnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011402Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT830_2EnvironmentalOpen in IMG/M
3300011409Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT423_2EnvironmentalOpen in IMG/M
3300011417Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT500_2EnvironmentalOpen in IMG/M
3300011445Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2EnvironmentalOpen in IMG/M
3300012039Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2EnvironmentalOpen in IMG/M
3300012166Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT660_2EnvironmentalOpen in IMG/M
3300012175Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT399_2EnvironmentalOpen in IMG/M
3300012232Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300013092Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150mEnvironmentalOpen in IMG/M
3300014866Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT890_16_10DEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300020158Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L227-6mEnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021520Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L227-8mEnvironmentalOpen in IMG/M
3300022886Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5EnvironmentalOpen in IMG/M
3300023168Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S064-202C-5EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027193Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes)EnvironmentalOpen in IMG/M
3300027196Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 (SPAdes)EnvironmentalOpen in IMG/M
3300027656Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027756Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027760Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027892Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027970 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5mEnvironmentalOpen in IMG/M
3300027971Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027977 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12mEnvironmentalOpen in IMG/M
3300031250Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaGHost-AssociatedOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300033414Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_BEnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034151Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
LWFCAnN_058769402088090007Freshwater SedimentKFGVLPSQEKDKPGGTTIVGGGPPALGAYTSSVAYILHREGGRGDDLRYLATVLDRYAWSEEGWWAATIDVKTGESKLPMTKPSPINKTAAMAMAAGILSDYVKDIAPALSSSLKRKTDKCIYDQIIPAQLADGFWHYGLNENDPKDKDVLGYFMLTTKELMNLQRFN
JGIcombinedJ13530_10290568613300001213WetlandKPGGENIMGGGPPAFGYYTSRVAYILHKAGGRNDDLKYIATVIDKYPWSEGGWWSADIDVTTGESKVPIAKPSPINKTASVAMAAGMVSDYVRDIDPDLSASLKQKADKCIYDKIIAAQEADGFWHYSLSGNDPKNKDILGYFMLTTQVLMDLQKFNTAYRDEKLSDAVKKAQA
JGIcombinedJ13530_10570093313300001213WetlandITLADQVLKNMRATKHGVLPIKEKDKPGGKTIIGGGPPALGAYTSSVAYILHKEGGRNEDLKYIATVLDRYPWSEEGWWASTIDVDTGESKLPMTKPAIINKTAAIAMAAGIVSGYVRDIDPKLSESLKRKTDKCIYGQIIPAQEADGFWHYSLQDKDPKDKDVLGYFMLTTKELMNLQKFNPAYREKQLNAALRKAQAFALKHIAPMTDPNTGTSTSEHATRGTPK
JGIcombinedJ13530_10820929213300001213WetlandLQDMRATKFGVLPIKEKEKAGGTTIMGGGPPAMGFYAAAAAYILHREGGRNDDLKYLAKVIDDYPWNAEGWWSADIDIKTGESKVPLSKPSIINKSASVAMAAGMLSEAVRGADPELAARLRQKTDKCVYGQILPAQLPDGFWHYSLSGNDPKNKDVLGYFMLTTQVLMELQHFNPAYREPR
JGI25910J50241_1017927713300003388Freshwater LakeGVAYILHKEGGRSDDLKYIATVLDRYPWSEEGWFASTIDVDTGESKLPMTKPAIINKTAAVAMAAGIVSGYVREIAPELSASLKRKADKCIYSQLIPAQLEDGFWHYSLLDKNPKDKDVLGYFMLTTKELMDLQKFNPAYREEKLNTAVKKAQAFALKHIAPMTDPNTGTSTSEHATRGT
JGI25910J50241_1017945613300003388Freshwater LakeGVAYILHKEGGRSDDLKYIATVLDRYPWSEEGWFASTIDVDTGESKLPMTKPAIINKTAAVAMAAGIVSGYVGEIAPELSASLKRKADKCIYSQIIPAQLEDGFWHYSLLDKDPKDKDVLGYFMLTTKELMDLQKFNPTFREEKLTAAVKKAQAFALKHIAPMTDPNTGTSTSEHATRGT
JGI25920J50251_1011563813300003404Freshwater LakeDKPGGKTIIGGGPPALGAYTSGVAYILHKEGGRNDDLKYIATVLDRYPWSEEGWFASTIDVDTGESKLPMTKPAIINKTAAVAMAAGIVSGYVREIDPTLAASLKRKADKCIYSQIIPAQLEDGFWHYSLLDKDPKDKDVLGYFMLTTKELMDLQKFNPAYREEKLNTAVKKAQAFALKHIAPMTDPNTGTSTSEHATRGT
JGI25920J50251_1011580013300003404Freshwater LakeDKPGGKTIIGGGPPALGAYTSGVAYILHKEGGRSDDLKYIATVLDRYPWSEEGWXASTIDVXTGESKLPMTKPAIINKTAAVAMAAGIVSGYVGEIAPELSASLKRKADKCIYSQIIPAQLEDGFWHYSLLDKDPKDKDVLGYFMLTTKELMDLQKFNPTFREEKLTAAVKKAQAFALKHIAPMTDPNTGTSTSEHATRGT
Ga0007865_102661413300003796FreshwaterLKDMRAMKFGVLLIKEKEKPDSEMIMGGGPPALGFYVADIAYILHKEDGRKDDLKYLGKVIDQYPWNAAGWWSADIDVKTGESKVPLSKAAPINKTTAVAMAAGMLSEALRSIDPELSARLKQKTDKCIYDQIIPAQLEDGFWHYGLTGKDPKNKDILGYFMLTTQELMELQCFN
Ga0062589_10265629913300004156SoilILYREGGRGDDLKYVANVLDQYPWNESGWWSADIDVKTGESKVSLNKPSIINKSATMAMAAGMVSEYVRAIDPELADRLKHKVDKCIYGQIIPAQEADGFWHYSLSDKDPKNKDILGYFMLTTQVLMELQKFNPAYREPKLDAALKKAQSFALKCIAPMTDPNTGPACAEHTT
Ga0062590_10110195713300004157SoilMRATKFGVLPIKEKDKPGGEKIIGGGPPALGAYTTGLAYILHKEGGRNDDLLYIATVLDRYPWNEEGWWASTIDVATGESKLPMTKPTIINKTAAIAMAAGIVSAYVRDIDPELSARLKHKTDKCIYGQIIPAQEADGFWHYS
Ga0062591_10151744713300004643SoilTMKGKTAEGNCALAFYLMFETTGEPKFRKAAVDLANQVLREMRETKFGVLPIKEKDKPGGTTIVGGGPPALGAYASSVAYILHREGGRKDDLMYIANVIDRYPWNESGWWASTIDVKTGESKVPMSKPAIINKTAAMAMAAGIVSAFVRDIDADLSARLKQKTDRCIYSQIIPAQEADGFWHYSLTENDPKEKDVLGYFMLTTKELMMLQRFNAAYREEKLNA
Ga0007745_100411613300004765Freshwater LakeYILHKEGGRSDDLKYIATVLDRYPWSEEGWFASTIDVDTGESKLPMTKPAIINKTAAVAMAAGIVSGYVGEIAPELSASLKRKADKCIYSQIIPAQLEDGFWHYSLLDKDPKDKDVLGYFMLTTKELMDLQKFNPTFREEKLTAAVKKAQAFALKHIAPMTDPNTGTSTSEHATRGTPTHYAIKEDLKRSFQLGLVLI
Ga0007757_1014764913300004810Freshwater LakeVLPIKEKDKPGGKTIIGGGPPALGAYTSGVAYILHKEGGRNDDLKYIATVLDRYPWSEEGWFASTIDVDTGESKLPMTKPAIINKTAAVAMAAGIVSGYVREIDPTLAASLKRKADKCIYSQIIPAQLEDGFWHYSLLDKDPKDKDVLGYFMLTTKELMDLQKFNPAYREEKLNTAVKKAQAFALKHIAPMTDPNTGTSTSEHATRGTPTHYAIK
Ga0007757_1014830113300004810Freshwater LakeVLPIKEKDKPGGKTIIGGGPPALGAYTSGVAYILHKEGGRSDDLKYIATVLDRYPWSEEGWFASTIDVDTGESKLPMTKPAIINKTAAVAMAAGIVSGYVGEIAPELSASLKRKADKCIYSQIIPAQLEDGFWHYSLLDKDPKDKDVLGYFMLTTKELMDLQKFNPTFREEKLTAAVKKAQAFALKHIAPMTDPNTGTSTSEHATRGTPTHYAIK
Ga0007759_1028357913300004836Freshwater LakeDKPGGKTIIGGGPPALGAYTSGVAYILHKEGGRNDDLKYIATVLDRYPWSEEGWFASTIDVDTGESKLPMTKPAIINKTAAVAMAAGIVSGYVREIDPTLAASLKRKADKCIYSQIIPAQLEDGFWHYSLLDKDPKDKDVLGYFMLTTKELMDLQKFNPAYREEKLNTAVKKAQAFALKHIAPMTDPNTGTSTSEHATRGTPTHYAIK
Ga0065696_111180713300005280Switchgrass Rhizosphere Bulk SoilEVRRAANQERTSRAARRSSVGVRPALGAYASGVAYILHKEGGRGEDLKYLATVLDRYPWNEEGWWASTIDVATGEPKVPLTKPSIINKTAAIAMASGIVSAYVRDIDPELSSRLKQKTDKCIYNQIIPAQEADGFWHYSLSDNDPNDKDVLGYFMLTTKELMDLQKFNPA
Ga0070690_10125154113300005330Switchgrass RhizosphereGVLPIKEKDKPGGEKIIGGGPPALGAYTAAVAHILHKEGGRNEDLKYLATVLDRYPWNEAGWWASTIDVHTGEPKVPITNPSIINKTAAIAMAAGIVSAYVRDIDPDLSSRLKKKTDKCIYAQILPAQEADGFWHYSLSDNDPMDKDVLGYFMLTTTELMDLQKFNPAYREEKLNAAVRKAQAFALKHIAPMTDPDS
Ga0070690_10138315813300005330Switchgrass RhizosphereFYLMFEITGEQKFRRAAISLADQVLKDMRATKFGVLPIKEKDKPGGEKIVGGGPPALGAYASGVAYILQKEGGRSEDLKYIATVLDRYPWNEEGWWASTIDVATGESKVPMTNPSIINKTAAVAMAAGIVSAYVRDIDPELSARLKHKTDKCIYGQIIPAQEADGFWHYSLSDKDPQDKDVLGYFMLT
Ga0070687_10092587713300005343Switchgrass RhizosphereIVGGGPPALGAYTSGVAYILHKEGGRGEDLRYLATVLDRYPWNEEGWWASTIDVATGESKVPLTKPSIINKTAAIAMAAGIISAYVRDTHPELSSRLKQKTDKCIYSQIIPAQEADGFWHYSLSDNDPNDKDVLGYFMLTTKELMDLQKFNPAYREEKLNAAVQRAQAFAFKCIAPMTDPNSGPPCMEHATRGTPSHYSLKEDSKRGF
Ga0070675_10208403713300005354Miscanthus RhizosphereGFYAARTAYVLHREGGRSEDLRYLAGVIDRFPWNEKGWWASTIDIKTGESKEPMSKPSIINKTASMAMAAAILSKYVADVAPELSARLRQKADKCIYDQILPAQEADGFWHYSLTGNDPKDKDVFGYFMLTTNALMDVQGFCDGYRTERLDSAIRRAQAFAARCLAPMTEPNT
Ga0070688_10143249813300005365Switchgrass RhizosphereEKDKPGGEKIVGGGPPALGAYASGVAYILHKEGGRGEDLKYLATVLDRYPWNEEGWWASTIDVATGEPKVPLTKPSIINKTAAIAMAAGIVSAYVRDIDPELSSRLKQKTDKCIYSQIIPAQEADGFWHYSLSDNDPNDKDVLGYFMLTTKELMDLQKFNAAYREEKLNAAVQKAQAFAFKCIAPM
Ga0070678_10163603213300005456Miscanthus RhizosphereVQSMRATKFGVLPIKEKDKSDGETILGGGPPALGFYAARTAYVLHREGGRSEDLRYLAGVIDRFPWNEKGWWASTIDIKTGESKEPMSKPSIINKTASMAMAAAILSKYVADVAPELSARLRQKADKCIYDQILPAQEADGFWHYSLTGNDPKDKDVFGYFMLTTNALMDVQGFCDGYRTERLDSAIRRAQAFAARCLAPM
Ga0070374_1055968813300005517Freshwater LakeGGPPALGAYTSGVAYILHKEGGRSDDLKYIATVLDRYPWSEEGWFASTIDVDTGESKLPMTKPAIINKTAAVAMAAGIVSGYVGEIAPELSASLKRKADKCIYSQIIPAQLEDGFWHYSLLDKDPKDKDVLGYFMLTTKELMDLQKFNPTFREEKLTAAVKKAQAFALKHIAPMTDPNTGTSTSEHAT
Ga0068858_10229238313300005842Switchgrass RhizosphereYILHKEGSRIEDLKYIATVLDRYPWNEDGWWASTIDVATGESKVPLTKPSIINKTAAIAMASGIVSAYVRDIAPELSSQLKQKTDKCIYGQIIPAQEADGFWHYSLSDNDPNGKDVLGYFMLTTKELMDLQKFNPAYREEKLNAAVQRAQAFAFKCIAPMTDPNSGPPCMEHATRGT
Ga0075428_10212256813300006844Populus RhizosphereLSLADQVLKDMRATKFGVLPIKEKDKPGGEKIIGGGPPALGAYTAGVAYILQKEGGRSEDLKYIATVLDRYPWNEEGWWASTIDVATGESKVPMTKPSIINKTAAIAMAAGIVSAYVRNIDLELSSRLKQKTDKCIYSQIIPAQEADGFWHYSLSDNDPNDKDVLGYFMLTTKELMDLQKFNPAYREEKLNAA
Ga0075421_10182212813300006845Populus RhizosphereKPGGEKIIGGGPPALGAYVSGVAYILHKEGGRSEDLKYLATVLDRYPWNEEGWWASTIDVATGEPKVPLTKPSIINKTAAIAMAAGIVSAYVRNIDLELSSRLKQKTDKCIYSQIIPAQEADGFWHYSLSDNDPMDKDVLGYFMLTTKELMDLQKFNPAYREAKLNTAVQRAQAFASKCIAPMTDPNSGPPCMEHATRGPPFHYSVKEDSKRGFQLGL
Ga0102923_124011213300007606EstuarinePIKEKDKPGGTTIVGGGPPALGAYTSSVAYILHKEGGRSDDLRYLATVLDRYAWNESGWWAATIDVKTGESKLPMTKPSIINKTAAMAMAAGIVSGYVRDIDPVLSASLKRKTDTCIYEQIIPAQLADGFWHYGLNENDPKNKDVYGYFMLTTKELMNLQRFNPAYHEDRLNAALKKAQTFALQQI
Ga0102866_119972613300007661EstuarineLATVLDRYAWNESGWWAATIDVKTGESKLPMTKPSIINKTAAMAMAAGIVSGYVRDIDPVLSASLKRKTDTCIYEQIIPAQLADGFWHYGLNENDPKNKDVYGYFMLTTKELMNLQRFNPAYHEDRLNAALKKAQTFALQQIAPTTEPNTGSGPRPHATAGTPKRYSVQDE
Ga0105247_1105468613300009101Switchgrass RhizosphereALAFYLMFEITGEQKFRKAAISLADQVLKDMRETKFGVLPIKEKDKPGGEKIIGGGPPALGAYASGVAYILQKEGGRSEDLKYIATVLDRYPWNEEGWWASTIDVATGEPKIPLNKPSIINKTAAIAMAAGIISAYVRDTHPELSSRLKQKTDKCIYSQIIPAQEADGFWHYSLSDNDPNDKDVLGYFMLTTKELMDLQKFNPAYREEKLNA
Ga0114980_1064876113300009152Freshwater LakeDMRATKHGVLPIKEKDKPGGTIIIGGGPPALGAYTSAVAYILHKEGGRAEDLKYIASVLDRYPWSEEGWWASTIDVETGESKLPMTKPAIINKTAAVAMAAGIVSGLVREIDPALSASLKRKTDKCIYGQILPAQLEDGFWHYSLLGKDPKDKDVLGYFMLTTKELMDLQRFNPEYREEKLNAALQKAQGFALKHIAP
Ga0114968_1046039513300009155Freshwater LakeYHQAALSLADQVLKDMRATKFGVLPIKEKDKPGGTTIVGGGPPALGAYTSSVAYILHKEGGRSDDLRYLATVLDRYAWNESGWWAATIDVKTGESKLPMTKPSIINKTAAMAMAAGILSGYVRDIDPVLSASLKRKTDKCIYEQIIPAQLADGFWHYGLNENDPKDKDVFGYFMLTTKELMSLQRFNPVYREDRLNAALQKAQAFALQQIAPMTEPNTGPAPRPHATV
Ga0114970_1072279513300009163Freshwater LakeVLKDMRATKFGVLPIKEKDKPGGTTIVGGGPPALGAYASSVAYILHKEGGRSDDLRYLATVLDRYAWNESGWWAATIDVKTGESKLPMTKPSIINKTAAMAMAAGILSGYVRDIDPALSASLKRKTDKCIYDQIIPAQLADGFWHYGLNENDPKDKDVFGYFMLTTKELMNLQRFN
Ga0113563_1358342113300009167Freshwater WetlandsPWNENGWWASTIDVQTGESKEPISKASIINKTAAIAMAAGLLSKYVRDTAPELSARLQHKTDKCIYDRIIPAQEADGFWHYSLSGNDPKDKDVFGYFMLTTNVLMDLQMFNDAYRNERMNAAVQRAQAFALRCIAPMSDPNRGAGCRERATPGTPLHYTMPEDVKRGFALGRILM
Ga0105242_1253190413300009176Miscanthus RhizosphereLPIKEKDKPGGEKIIGGGPPALGAYTSGVAYILHKERGRSEDLKYIATVLDSYPWNEEGWWASTIDVATGEPKVPLTKPSIINKTAAIAMAAGIVSAYVRDIAPELSSRLKQKTDKCIYSQIIPAQEADGFWHYSLSDNDPNDKDVLGYFMLTTKELMDLQKFNPAYREEKLNAAVQRAQAFAFKC
Ga0114971_1064228713300009185Freshwater LakeALGAYTSGVAYILHKEGGRSDDLKYIATVLDRYPWSEEGWFASTIDVDTGESKLPMTKPAIINKTAAVAMAAGIVSGYVGEIAPELSASLKRKADKCIYSQIIPAQLEDGFWHYSLLDKDPKDKDVLGYFMLTTKELMDLQKFNPTYREEKLTAAVKKAQAFALKHIAPMTDPNTGTSTSEHATRGTPTHYAIK
Ga0126315_1108789113300010038Serpentine SoilQVLREMRGTKFGVLPIKEKDKAGVTIILGGGPPALGAYTSSIAYILHQEGGRKEDLKYIATVLDRYPWNESGWWASTIDVKTGESKVPMSKPAIINKTAAVAMAAGIVSAYVRDIDPELSERLKQKTDRCIYSQIIPQQEADGFWHYSLSDNDPKEKDVLGYFMLTTKELMTLQRFNPA
Ga0126314_1127200213300010042Serpentine SoilEGGRSGDLKYIGDVLDRYPWNDSGWWASTIDVKTGESKEPMSKPAIINKTAAVAMAAGAVSAFLRDIDPELSARLKQKTDRCIYSQIIPAQEPDGFWHYSLTGNDPKEKDVLGYFMLTTKELMTLQRLNPAYREAKLNTALEKAQAFAVNFIAPTTEPNIGSAARPHATPGTPSHYSVAEDPK
Ga0134127_1289345713300010399Terrestrial SoilKYIATVLDRYPWNEEGWWASTIDVATGEPKVPLTKPSIINKTAAIAMAAGIVSAYVRDIDPELSSRLKQKTDKCIYSQIIPAQEADGFWHYSLTGNDPKDKDVFGYFMLTTNVLMDVQEFCDGYRTERLDSAIRRAQTFAVRCLAPMTEPNAGAGCRERATSGTPTHYTMRDDVKRGFALARILIG
Ga0134123_1190229013300010403Terrestrial SoilPGGKTILGGGPPALGAYTSAAAYILHQEGGRNDDLKYIATVLDRYPWNEDGWWASTIDVAIGEFKVPITKEGIINKSAAIAMAAGTVSGFVAEIDPALSARLKHKADKCIYGKIIPAQEADGFWHYSLQDKDPKNKDILGYFMLTTGELMNLQKFNSAYREEKLNAALQKAQAFALKCIAPMTEPNTGSACAEHRTPSTPAHYAVADDLKRSFQLG
Ga0134123_1196126613300010403Terrestrial SoilALAFYLMFEITGEQKFRKAALSLADQVLKDMRATKFGVLPIKEKDKPGGEKIIGGGPPALGAYAAGVAYILHKEGGRGEDLKYIATVLDRYPWNEDGWWASTIDVATGESKVPLTKPSIINKTAAIAMAAGIISAYVRDTHPELSSRLKQKTDKCIYSQIIPAQEADGFWHYSLSDNDPNDKDVLGYFMLTTKELMDLQKFNPAYREEKLNAAV
Ga0134123_1256446113300010403Terrestrial SoilQKFRKAALSLADQVLKDMRETKFGVLPIKEKDKPGGEKIVGGGPPALGAYASGVAYILHKEGGRGEDLKYLATVLDRYPWNEEGWWASTIDVATGESKVPLTKPSIINKTAAIAMAAGIVSEYVRNIDPALSSRLKQKTDKCIYSQIIPAQEADGFWHYSLSDNDPNDKDVLGYFMLTTKELMDLQKFNPAY
Ga0137356_106657213300011402SoilINGEQKFRKAALSLADQVLKDMRATKFGVLPIKEKDKPGGEKIIGGGPPALGAYASGVAYILHKEGGRSEDLKYLATVLDRYPWNEEGWWASTIDVATGELKVPVTKPSIINKTAAIAMSAGIVIAYVRDIDPDLSWRLKQKTDKCIYSQIIPAQEADGFWHYSLSDRDPKDKDVLGYFMLTTKELMDLQKFNPVYREEKLNAAVQKAQAFAFKCIAPMTDPNSGPP
Ga0137323_109774813300011409SoilGGPPALGAYTAGVAHILHKEGGRNEDLKYIATVLDRYPWNEEGWWASTIDVATGESKVPLTKPSIINKTAAIAMAAGMVSPYVRDIDPDLSSRLKQKTDKCIYTQIIPAQEADGFWHYSLSDRDPKDKDVLGYFMLTTKELMDLQKFNSAYREEKLNAAVQRAQAFAFRCIAPMTDPNSGPPCAEHATRGTPSHYSLKEDSKRGFQLALILIGGRH
Ga0137326_116874613300011417SoilGVAYILHKEGGRNEDLKYLANVLDHYPWNEEGWWASTIDVATGESKVPLTKPSIINKTAAVAMAAGIISAYVRDIDPELSSRLKQKTDKCIYSQIIPAQEADGFWHYSLSDNDPNDKDVLGYCMLTTKELMDLQKFNSAYREEKLNAAVQRAQAFAFRCIAPMTDPNS
Ga0137427_1032547613300011445SoilKDMRATKFGVLPIKEKDKPGGGKIIGGGPPALGAYASGVAHILHKEGGRSDNLKYIATVLDRYPWNEEGWWASTIDVATGESKEPMSKPAIINKTAAIAMAAGIVSAYVRDIDPELSSRLKQKTDKCIYSQIIPAQEADGFWHYSLSDRDPKDKDVLGYFMLTTKELMDLQKFNPAYREEKLNAAVQRAQAFALKCIAPMTDPNSGPPCAEHATR
Ga0137421_122521613300012039SoilFRKAALSLADQVLKDMRATKFGVLPIKEKDKPGGEKIIGGGPPALGAYTAGVAHILHKEGGRNEDLKYIATVLDRYPWNEEGWWASTIDVATGEPKVPITKPSIINKTAAIAMAAGMVSPYVRDIDPDLSSRLKQKTDKCIYTQIIPAQEADGFWHYSLSENDPNDKDVLGYFMLTTKELMD
Ga0137350_110803413300012166SoilHKEGGRNEDLKYLATVLDRYPWNEEGWWASTIDVATGESKVPLTKPSIINKTAAVAMAAGIICAYVRDIDPELSSRLKQKTDKCIYSQIIPAQEADGFWHYSLSDNDPNEKDVLGYFMLTTKELMDLQKFNPTYREEKLNAAVQKAQAFALKCIAPMTDPNSGPPSAEHATRGTPSHYSLKDDSKRGF
Ga0137321_113496613300012175SoilPALGAYTAGVAHILHKEGGRNEDLKYIATVLDRYPWNEEGWWASTIDVATGEPKVPVTKPSIINKTAAIAMSAGIVIAYVRDIDPDLSWRLKQKTDKCIYTQIIPAQEADGFWHYSLSDNDPMDKDVLGYFMLTTKELMDLQKFNPAYREAKLNAVVQKAQAFALKRIAPMTDPNSGPPCAEHA
Ga0137435_118762313300012232SoilPPALGAYAVGVAHILHKEGGRSDDLKYIATVLDRYPWNEEGWWASTIDVATGESKVPLTKPSIINKTAAIAMAAGIVSAYVRDIDPELTSRLKQKTDKCIYSQIIPAQEADGFWHYSLSDNDPNDKDVLGYFMLTTKELMDLQKFNPAYREEKLNAAVQRAQAFAFKCIAPMTDPNSGPPCKEYATRGTPSHYSLKEDSKRGFQLGLILIG
Ga0150984_10936185513300012469Avena Fatua RhizosphereAYILHKEGARGEDLKYLATVLNRYPWNEEGWWASTIDVATGEPKVPLTKPSIINKTAAIAMATGIVSVYVRDIDPDLSSRLKQKTDKCIYTQIIPAQEADGFWHYSLSDNDPMDKDVLGYFMLTTKELMDLQRFNPAYREEKLNAAVQRAQAFAFKCIAPMTDPNSGAPCTE
Ga0150984_12131701813300012469Avena Fatua RhizosphereIIGGGPPALGAYTVGVAYILHKEGDRNEDLKYIAKVLDRYPWNEGGWWASTIDVATGESKVPLTKPSIINKTAAMAMAAGIVSAYMRNIDPELSSRLKQKTDRCIYSQIIPAQEADGFWHYSLSDNDPNDKDVLCYFMLTTKELMDLQKFNPAYREDKLNAAVRKAQAFAFKRIAPMTD
Ga0157284_1032285913300012893SoilGGGPPALGAYACGVAYILHKEGGRGEDLKYLATVLDRYPWNEEGWWASTIDVATGEPKVPLTKPSIINKTAAIAMAAGIVSAYVRDIDPELSSRLKQKTDKCIYTQIIPAQEADGFWHYSLSDNDPNDKDVLGYFMLTTKELMDLQKFNPAYREEKLNAAVHKAQAFAFK
Ga0163199_140871613300013092FreshwaterYVATVIDRYPWNEAGWWAATIDVTTGEPKEPLSKPSPVNKSAAIAMAAGMISAFVHDADPALAARLKQKADKCIYSQLIPAQLADGFWHYGLTGNDPGNKDILGYFMLTTEELMKLQQFNPAYREEKLNAAVRKAQTFAFKNISPMTEPNHGPACKEHATRETPVHY
Ga0180090_108477413300014866SoilSGEKIIGGGPPALGAYAAGVAYILHKEGGRNEDLRYVATVLDRYPWNEEGWWASTIDVATGEPKVPITKPSIINKTAAIAMAAGIVSAYVRDIDPELCSRLKQKTDRCIYSQIIPAQEADGFWHYSLSDNDPMDKDVLGYFMLTTKELMDLQRFNPMYREEKLNAAVQKAQAFALKCIAPMTDPNSGP
Ga0157379_1121998913300014968Switchgrass RhizosphereGALAFYLMFEITGEQKFSKAALSLADQVLQDMRATKFGVLPIKEKDKPGGEKIIGGGPPALGAYASGVAYILQKEGGRSDDLKYIATVLDRYPWNEEGWWASTIDVATGESKVPLTKPSIINKTAAIAMAAGIVSAYVREIDPELSSRLKQKTDKCIYSQIIPAQEADGFWHYSLSANDPNDKDVLGYFMLTTKELMDLQKFNPAYREEKLNAAVRRAQAFAFKCIAPMTDPNSGPPCAE
Ga0173480_1070257113300015200SoilGVAYILHKEGGRGEDLKYLATVLDRYPWNEEGWWASTIDVATGEPKVPLTKPSIINKTAAIAMAAGIVSAYVRDIDPELSSRLKQKTDKCIYTQIIPAQEADGFWHYSLSDNDPNDKDVLGYFMLTTKELMDLQKFNPAYREEKLNAAVQKAQAFAFKCIAPMTDPNTGPPCAEHATRGTPSHYSLKEDSKRGFQLGLILIGGRHTDEGI
Ga0132255_10384742113300015374Arabidopsis RhizosphereKFIGGGPPALGAYASGIAYILHKEGGRSEDLKYLASVLDRYPWNEEGWWASTIDVTTGEPKVPLTKPSIINKTAAIAMAAGIVSAYVSDIEPALSSRLKQKTDKCIYTQIIPAQEADGFWHYSLSDNDPNDKDVIGYFMLTTKELMDLQKFNPAHREERLNAAVQRAQAFAFKCIAPMTDPNSGPRCVEHATRGTPSHYSLKADSKRGFQLS
Ga0190266_1075896313300017965SoilGDEVRCAADQGKRQAGGEKIIGGGPPALGAYASGVAYILHKEGGRSEDLKYLATVLDRYPWNEEGWWASTIDVATGESKVPLTKPSIINKTAAIAMAAGIVSAYVRNIDPELSSRLKQKTDRCIYSQIIPAQEADGFWHYSLSDNDPNDKDVLGYFMLTTKELMDLQKFNPAYREEKLNAAVQKAQAFAFRCIAPMTDPNSGSP
Ga0190272_1158784013300018429SoilKPGGEKIIGGGPPALGAYTAGVAYILHKEGGRNEDLKYLATVLDRYPWNEEGWWASTIDVATGESKVPLTKPAIINKTAAIAMAAGIVSAYVRNIDPELSSRLKQKTDRCIYSQIIPAQEADGFWHYSLSDNDPNDKDVLGYFMLTTKELMDLQKFNPAYREEKLNTAVQRAQAFAFKCIAPMTDPNTGAPCAQYATRGTPLHYSLKEDSKRGFQLGLILLGG
Ga0190270_1217648713300018469SoilQVLKDMRATKFGVLPIKEKDKPGGAVIIGGGPPALGAYASSVAYILHKEGARNDDLKYLADVLDRYPWNESGWWASTIDVKTGESKEPMSKPAIINKTAAVAMAAGIVSGYVREIDPELSARLKQKTDRCIYSQIIPAQETDGFWHYSLTGNDPKEKDVLGYFMLTTKELMRLQRFNPAYQEEKLNSALQKAHAFALKSIAPAT
Ga0190271_1306645513300018481SoilYRKVAVSLADRVLHDMRATKFGILAIKEKEKAGGETIIGGGPPALGFYASRIAYILHREGGRNDDLQYIASVLDRYPWNEQGWWASTIDVKTGESKEPMSKPSIINKTAAVAMAAGILSGYVRDIAPELSARLKQKADKCVFDQIIPAQERDGFWHYSLSGNDPKDKDVLGYFMLTTNVLMDLQKF
Ga0173482_1043085813300019361SoilVAYILHKEGGRGEDLKYIATVLDRYPWNEEGWWASTIDVATGQSKVPLTKPSIINKTAAIAMAAGIVSAYVRDIDPELSSRLKQKTDKCIYSQIIPAQEADGFWHYSLSDNDPNDKDVIGYFMLTTKELMDLQKFNPAYREEKLNAAVHKAQAFAFKCIAPMTDPNSGPPCMEHATRGTPSHYALKEDSKRGFQLGLILTGSGHTE
Ga0173479_1059140213300019362SoilVGYILQKKGGRNEDLNYIATVLEQYPWNDQGWWSSDIDVVTGESKVPLTKPSIINKNACVAMAAGALSSYVKEIDPALAERLRAKTDKFLYEQLLPAQEADGFWHYSLSDKDPKDKDILGYFMLTTQALMELQHFNPAYREPKLDAAVKKAQDFALKCIAPMTDPNTGTACPEHLTPSTPKHYTLADEPKRGF
Ga0173479_1066675713300019362SoilSGVAYILHKEGGRGEDLKYLATVLDRYPWNEEGWWASTIDVATGEPKVPLTKPSIINKTAAIAMAAGIVSAYVRDIDPELSSRLKQKTDKCIYSQIIPAQEADGFWHYSLSDNDPNDKDVLGYFMLTTKELMDLQKFNPAYREEKLNAAVQKAQAFAFNCIAPMTDPNSGSPCKEYATRGTPSH
Ga0190264_1156144313300019377SoilYVLHKEGGRNEDLKYIATVLDRYPWNEEGWWASTIDVATGESKVPLSKPSIINKTAAIAMAAGIVSAYVRDIDPEVSSRLKQKTDKCIYSQIIPAQEADGFWHYSLSGRDPNDKDVLGYFMLTTKALMDLQKFNPTYREEKLNAAVQRAQAFAFKCIAPMTDPNSGPPCAEHATRGTPSHYALKEDSKRGFQ
Ga0194038_122504213300020158Anoxic Zone FreshwaterALGFYTANVAYILHQEGGRNDDLKYLAKVIDEYPWNTNGWWSADIDVKTGESKNPMSKPSPNNKTAAVAMAAGMLSEALRNIDPQRAARLKQKTDQCIYHQVIPAQLEYGFWHYSLSGNDPKDKDILGYFMLTTQVLMELQHFNPAYREPKLDAAIHKAQAFALKSIAPMTDPNTN
Ga0210381_1032896613300021078Groundwater SedimentYLATVLDRYPWNEEGWWASTIDVATGEPKVPLTKPSIINKTAAIAMAAGIVSAYVRNIDPELSSRLKQKTDRCIYSQIIPAQEADGFWHYSLSDNDPNDKDVLGYFMLTTKELMDLQKFNPAYREEKLNAAVQKAQAFAFKCIAPMTDPNSGPPCKEYATRGTPSHYSLKEDSKRGFQLGLILIG
Ga0194053_1031736413300021520Anoxic Zone FreshwaterGPPALGFYTANVAYILHQEGGRNDDLKYLAKVIDEYPWNTNGWWSADIDVKTGESKNPMSKPSPNNKTAAVAMAAGMLSEALRNIDPQRAARLKQKTDQCIYHQVIPAQLEYGFWHYSLSGNDPKDKDILGYFMLTTQVLMELQHFNPAYREPKLDAAIHKAQAFALKSIAPMTDPNTNAACVAHTTPGTPRHYTLADE
Ga0247746_116922513300022886SoilMRATKFGVLPIKEKDKPGGEQIIGGGPPALGAYVSGIAYILQKEGGRSEDLKYLATVLDRYPWNEEGWWASTIDVATGESKVPLTKPSIINKTAAIAMAAGITSAYVRDTDPELSSRLKQKTDKCIYSQIIPAQEADGFWHYSLSDNDPNDKDVIGYFMLTTKELIDLQKFNPAYREERLNAAVQRAQ
Ga0247748_107318613300023168SoilYLATVLDRYPWNEEGWWASTIDVATGEPKVPLTKPSIINKTAAIAMAAGIVSAYVRDIDPELSSRLKQKTDKCIYTQIIPAQEADGFWHYSLSDNDPNDKDVLGYFMLTTKELMDLQKFNPAYREEKLNAAVHKAQAFAFKCIAPMTGPNSGPPCMEHATRGTPSHYSLKEDSKRGFQL
Ga0207710_1048922113300025900Switchgrass RhizosphereKIIGGGPPALGAYASGVAYILQKEGGRSEDLKYIATVLDRYPWNEEGWWASTIDVATGEPKIPLNKPSIINKTAAIAMAAGIISAYVRDTHPELSSRLKQKTDKCIYSQIIPAQEADGFWHYSLSDNDPNDKDVLGYFMLTTKELMDLQKFNPAYREEKLNAAVQRAQAFAFKCIAPITDPNSGPPCKEYATRGTPTHYSLKEDSKRGLQLG
Ga0207662_1118459413300025918Switchgrass RhizosphereEDLKYIATVLDRYPWNEEGWWASTIDVATGESKVPLTKPSIINKTAAIAMAAGIISAYVRDTHPELSSRLKQKTDKCIYSQIIPAQEADGFWHYSLSDNDPNDKDVLGYFMLTTKELMDLQKFNPAYREEKLNAAVQRAQAFAFKCIAPMTGPNSGPPCMEHATRGTPSHYSLKEDSKRG
Ga0207701_1102975313300025930Corn, Switchgrass And Miscanthus RhizosphereKDKSDGETILGGGPPALGFYAARVAYVLHRERGRSEDLRYLAGVIDQFPWNEKGWWASTIDIKTGESKEPMSKPSIINKTASMAMAAAILSKYVADVAPELSARLRQKADKCIYDQILPAQEADGFWHYSLTGNDPKDKDVFGYFMLTTNVLMDVQEFCDGYRTERLDSAIRRAQTFAVRCLAPMTEPNAGAGCREYPGPASNRRPAPLPVRRLRDRRARPAEAPWLV
Ga0207689_1166829913300025942Miscanthus RhizospherePPALGAYTAGVAYILHKEGGRMEDLKYIATVLDRYPWNEEGWWASTIDVATGEPKVPLTKPSIINKTAAIAMAAGIVSAYVRDIAPELSSRLKQKTDRCIYSQIIPAQEADGFWHYSLSDNDPNDKDVLGYFMLTTKELMDLQKFNPAYREEKLNAAVQRAQAFAFKCIAPMTDPN
Ga0207678_1182179613300026067Corn RhizosphereAIVLDRYPWNEEGWWASTIDVATGESKVPLTKPSIINKTAAIAMAAGIVSAYVRDIAPELSSRLKQKADKCIYGQIIPAQEADGFWHYSLSDNDPNDKDVLGYFMLTTKELMDLQKFNPAYREEKLNSAVQRAQAFAFKCIAPMTDPSSGPPCMEHATRGTPSHYALKEDSKRGFQL
Ga0207675_10188471413300026118Switchgrass RhizosphereDQVLKDMRETKFGVLPIKEKDKPGGEKIVGGGPPALGAYASGVAYILHKEGGRGDDLQYIATVLDRYPWNEEGWWASTIDVATGQSKVPLTKPSIINKTAAIAMAAGIVSAYVRDIAPELSSRLKLKTDKCIYSQIIPAQEADGFWHYSLSDNDPNDKDVLGYFMLTTKELMDLQKFNPAYREEKLNAAIQKAQAFAFKCIAPMT
Ga0207683_1189943113300026121Miscanthus RhizosphereETILGGGPPALGFYAARTAYVLHREGGRSEDLRYLAGVIDRFPWNEKGWWASTIDIKTGESKEPMSKPSIINKTASMAMAAAILSKYVADVAPELSARLRQKADKCIYDQILPAQEADGFWHYSLTGNDPKDKDVFGYFMLTTNALMDVQGFCDGYRTERLDSAIRRAQAFAARCLAPMT
Ga0208800_104101013300027193EstuarineRKAALSLADQVLKDMRATKFGVLPIKEKDKPGGTTIVGGGPPALGAYTSSVAYILHKEGGRSDDLRYLATVLDRYAWNESGWWAATIDVKTGESKLPMTKPSIINKTAAMAMAAGIVSGYVRDIDPVLSASLKRKTDTCIYEQIIPAQLADGFWHYGLNENDPKNKDVFGYFMLTTKELMSLQRFNPVYREDRLNAALQKAQAFALQQ
Ga0208438_107654013300027196EstuarineAYTSGVAYILHKEGGRSDDLKYIATVLDRYPWSEEGWFASTIDVDTGESKLPMTKPAIINKTAAVAMAAGIVSGYVREIAPELSASLKRKADKCIYSQLIPAQLEDGFWHYSLLDKNPKDKDVLGYFMLTTKELMNLQRFNPAYHEDRLNAAIKKAQSFALQQIAPTTEPNTGSGPRPHA
Ga0209357_116297313300027656Freshwater LakeKPGGKTIIGGGPPALGAYTSGVAYILHKEGGRSDDLKYIATVLDRYPWSEEGWFASTIDVDTGESKLPMTKPAIINKTAAVAMAAGIVSGYVGEIAPELSASLKRKADKCIYSQIIPAQLEDGFWHYSLLDKDPKDKDVLGYFMLTTKELMDLQKFNPTFREEKLTAAVKKAQAFALKHIAPMTDPNTGTSTSEH
Ga0209444_1029346413300027756Freshwater LakeEKDKPGGTTIVGGGPPALGAYTSSVAYILHKEGGRSDDLRYLATVLDRYAWNESGWWAATIDVKTGESKLPMTKPSIINKTAAMAMAAGIVSGYVRDIDPVLSASLKRKTDTCIYEQIIPAQLADGFWHYGLNENDPKNKDVYGYFMLTTKELMNLQRFNPAYREERLNAALQKAQTFALQQ
Ga0209598_1026857313300027760Freshwater LakeNGALAFYLMFEVTSEQKFRKAALTLADQVLKDMRETKHGVLPIKEKDKPGGKTILGGGPPALGAYTSGVAYILHKEGGRSDDLKYIATVLDRYPWSEEGWFASTIDVDTGESKLPMTKPAIINKTAAVAMAAGIVSGYVCEIDPTLAASLKRKADKCIYSQIIPAQLEDGFWHYSLLDKDPNDKDVLGYFMLTTKELMDLQKFNPAYREEKLTAAVKKAQAFALKHI
Ga0209550_1067159013300027892Freshwater LakeKPGGKTIIGGGPPALGAYTSGVAYILHKEGGRSDDLKYIATVLDRYPWSEEGWFASTIDVDTGESKLPMTKPAIINKTAAVAMAAGIVSGYVGEIAPELSASLKRKADKCIYSQIIPAQLEDGFWHYSLLDKDPKDKDVLGYFMLTTKELMDLQKFNPTFREEKLTAAVKKAQAFALKHIAPMTDPNTGTSTSEHATRG
Ga0209550_1067159113300027892Freshwater LakeKPGGKTIIGGGPPALGAYTSGVAYILHKEGGRNDDLKYIATVLDRYPWSEEGWFASTIDVDTGESKLPMTKPAIINKTAAVAMAAGIVSGYVREIDPTLAASLKRKADKCIYSQIIPAQLEDGFWHYSLLDKDPKDKDVLGYFMLTTKELMDLQKFNPAYREEKLNTAVKKAQAFALKHIAPMTDPNTGTSTSEHATRG
Ga0209382_1208107713300027909Populus RhizosphereDLKYLATVLDRYPWNEEGWWASTIDVATGEPKVPLTKPSIINKTAAIAMAAGIVSAYVRNIDLELSSRLKQKTDKCIYSQIIPAQEADGFWHYSLSDNDPMDKDVLGYFMLTTKELMDLQKFNPAYREEKLNAAVQRAQAFAFKCIAPMTDPNSGPPCLEYATRGTPSHYSLKEDSKRGF
(restricted) Ga0247837_130635313300027970FreshwaterIKEKEKGGGKTIIGGGPPALGNYASGLAYILHKEGGRSDDLKYIATVLDRFPWSESGWWASTIDVATGEPKEPITKPGIINKTAAIAMAAGMVSLYVRDIDPALSASLKHKANKCIYGQILPAQLEDGFWHYSLLDKDPKDKDVLGYFMLTIEELMKLQRFNPAYREDKLNAAVQKAQAFALQHIAPMTDPNTGTGTI
Ga0209401_125275013300027971Freshwater LakeKHGVLPIKEKDKPGGKTILGGGPPALGAYTSGVAYILHKEGGRSDDLKYIATVLDRYPWSEEGWFASTIDVDTGESKLPMTKPAIINKTAAVAMAAGIVSGYVCEIDPTLAASLKRKADKCIYSQIIPAQLEDGFWHYSLLDKDPNDKDVLGYFMLTTKELMDLQKFNPAYREEKLTAAVKKAQAFALKHIAPMTDPNTGTSSSEHTTRG
(restricted) Ga0247834_133666413300027977FreshwaterMRATKHGVLPIKEKDKPGGATIIGGGPPALGAYSSAVAYILHKEGGRAEDLKYIATVLDRYPWNEEGWFASTIDVDTGESKLPMTKPAIINKTAAMAMAAGIVSGYLREIDPALAASLKHKADKCIYNQILPAQLADGFWHYSLLDKDPKDKDVLGYFMLTTKELMDLQ
Ga0265331_1043114813300031250RhizosphereMYEMTGDKAYRSAALSLADHILKDMRETKFGVLPIKEKEKPGGESIMGGGPPAFGFYTSRIAYILHKEGGRDEDLKYLAAIVDKYPWNEKGWWSADVDVTTGESKVPMSKPSPINKTASVAMAAGMISGYVRNLDADLSARLKKKADLCIYSQVIPAQEADGFWHYSLSGKDPNNKDILGYFMLTTEVLMDLQRYNE
Ga0302326_1312034013300031525PalsaFGVLPIKEKEKPGREEITGGGPPAFGIYTARIAWILHEEGGRNDDLKYIGGVLDRYAWNEEGWWSADIDINTGESKLPLTKPSPVNKTASVAMAAGILSGYLRGIDPGLSARLKQKADKCIYAKIIPAQGADGFWNYSLSGNDPKNKDILGYFMLTTELLMDLQEFNPAYRDEKLNTSLQKARAFAL
Ga0302321_10355592713300031726FenEKEKAGGKTILGGGAPALGNYAAGVAYILFKEGVRTNDLKYVATVIDRYPWNDAGWWAATIDVTTGEPKEPLSKPSPINKSAAIAMAAGMLSVYVRGADPALAARLQQKADKCIYSQLIPAQEADGFWHYSLSGNDPNNKDILGYFMLTTEELMKLQQFNPAYREEKL
Ga0315909_1087307313300031857FreshwaterKDMRATKHGVLPIKEKDKPGGKTIIGGGPPALGAYTSGVAYILHKEGGRNDDLKYIATVLDRYPWSEEGWWASTIDVDTGESKLPMTKPAIINKTAAVAMAAGIVSGYVGGIDPTLAASLKRKADKCLYSQIIPAQLEDGFWHYSLLDKDPKDKDVLGYFMLTTKELMDLQKFNPAYREEKLTAAV
Ga0310892_1058570013300031858SoilGSGALAFYLMFEITGEQKFRKAALGLADQVLKEMRATKFGVLPIKEKDKPGGEKIIGGGPPALGAYSAGVAYILHKEGGRNEDLKYLATVLDRYPWNEEGWWASTIDVATGEPKIPLNKPSIINKTAAIAMAAGIVSAYVRDIDPALSSRLKQKTDKCIYTQIIPAQEADGFWHYSLSDNDPNDKDVLGYFMLTTKELMDLQKFNPAYREEKLNAAVQKAQAFAFKCIAPMTDPNSGPPCKEYATRGTPSH
Ga0310893_1044084313300031892SoilLHKEGGRGEDLKYIATVLDRYPWNEEGWWASTIDVATGESKVPLTKPSIINKTAAIAMAAGMVSAYVRNIDPELSSRLKQKTDRCIYSQIIPAQEADGFWHYSLSDNDPNDKDVLGYFMLTTKELMDLQKFNPAYREEKLNAAVQKAQAFAFKYIAPMTDPNSGPPCKEYATRGTPSHYSLKEDSKRGFQL
Ga0302322_10267702013300031902FenSVVSLKGKGGDGEEALVFYRAFEMTGDQRFRTAAVALVDRVLKDMRGTKFGVLAIKEKEKPGGKSIMGGGPPALGFYAANVAYILHKEGGRGDDLKYVAKVIDDYPWNDAGWWSADIDVKTGESKVPITKPSPVNKTSAMAMAAGMLSDALRTIDPALSAKLKAKTDKCVYAQVIPAQLDDGFWHYGLTENDPNNKDVLGYFML
Ga0310900_1073180723300031908SoilQSMRATKFGVLPIKDKDKSDGETILGGGPPALGFYAARTAYVLHREGERTEDLRYLAGVIDRFPWNEEGWWASTIDVHTGASKEPMSKPSIINKTASMAMAAAVLGKYVADFEPELSARLRQKADKCIYEQILPAQEPDGFWHYMRAIARIKWIRPCAGRSPLPCVAWRQ
Ga0315912_1121001813300032157SoilIGGGPPAFGFYTANVAHILHREGGREDDLKYIAGVLDRYPWNEAGWWSADIDVKTGESKVPMTKPSIINKSATMAMAAGMVAEYVRAIDPPLAASLKQKTDKCIYGQIIPAQEPDGFWHYSLSGNDPKDKDVLGYFMLTTHVLMELQRFNPAYREHRLDTALAKAQAFALKCIAPMTDPNTGPACAERATPGTPSHYSL
Ga0307470_1133695413300032174Hardwood Forest SoilEQKFRRAAISLADQVLKDMRATKFGVLPIKEKDKPGGEKIIGGGPPALGAYATSVAYILHKEGGRNEDLKYLATVLDRYPWNEEGWWASTIDVATGESKVPLTKPSIINKTAAIAMAAGTVSAYVRDIDTELSSRLKQKTDKCIYSQIIPAQEADGFWHYSLSDNDPNDKDVLGYFMLTTKELMDLQKFNPAYRE
Ga0315276_1246247913300032177SedimentYASSVAYILHQEGGRNDDLKYIATVLDRYPWNEEGWWASTIDVATGESKEPMTKPSIINKTAAIGMAAGMLSQYVRDLDPELSARLKHKTDKCIYGQIIPAQEADGFWHYSLSDNDPKNKDIFGYFMLTTKELMDLQKFNPAYRDEKLNSAIQRAQAFALKCIAPMTEPNNRP
Ga0316619_1166077313300033414SoilKDKPGGETIIGGGPPALGAYASGVAYILHKEGGRNDDLKYIATVLDRYPWNENGWWAATIDVKTGESKEPMTKPSPINKNAAIAMAAGMVSQYVRDITPEISARLKQKTDKCIYTQIIPAQEVDGFWHYSLSDNDPKDKDILGYFMLTTKELMDLQRFNGAYRDAKLNSAVQKAQAFALKCIAPMTEPNNG
Ga0334995_0773161_1_5223300034062FreshwaterMRATKHGVLPIKEKDKPDGKTILGGGPPALGAYASSVAYILHREGGRTDDIKYIASVLDGYPWSEEGWFASTIDVDTGESKLPMTKPAIINKTAAVAMAAAIVSGYVAGIAPELAASLKRKADKCIYRQIIPAQLEDGFWHYSLTDSDPKDKDVLGYFMLTTKELMNLQRFNPA
Ga0335036_0606051_6_6623300034106FreshwaterMFELTGNPAYRRAAIEIADRILRDMRATRFGVLAIKEKEKSDGEVILGGGPPALGFYASRTAYILHREGGRSADLAYLAGVIDRYPWQEKGWWASTIDVKTGESKEPMSKPAIINKTAAMAMAAGILSGYVREIAPELSARLKRKTDQGVFAQILPAQEADGFWHYNLSGHDPKDKDVLGYFMLTTNVLMDLQRFNATYRLPQLDAALRRAQAFALRSI
Ga0364935_0318110_24_5153300034151SedimentMRETKFGVLPIKEKDKPGGGKIIGGGPPALGAYASGVAHILHKEGGRSDNLKYIATVLDRYPWNEEGWWASTIDVATGESKEPMSKPAIINKTAAIAMAAGIVSAYVRDIDPELSSRLKQKTDKCIYSQIIPAQEADGFWHYSLSDRDPKDKDVLGYFMLTTKE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.