| Basic Information | |
|---|---|
| Family ID | F096821 |
| Family Type | Metagenome |
| Number of Sequences | 104 |
| Average Sequence Length | 43 residues |
| Representative Sequence | SSKASGANGWRSSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.92 % |
| % of genes near scaffold ends (potentially truncated) | 60.58 % |
| % of genes from short scaffolds (< 2000 bps) | 91.35 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.308 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.154 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.038 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF09317 | ACDH_C | 56.73 |
| PF00108 | Thiolase_N | 19.23 |
| PF02803 | Thiolase_C | 5.77 |
| PF03401 | TctC | 0.96 |
| PF13808 | DDE_Tnp_1_assoc | 0.96 |
| PF13701 | DDE_Tnp_1_4 | 0.96 |
| PF04480 | DUF559 | 0.96 |
| PF00378 | ECH_1 | 0.96 |
| PF00462 | Glutaredoxin | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 25.00 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.08 % |
| Unclassified | root | N/A | 1.92 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10714441 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 577 | Open in IMG/M |
| 3300004480|Ga0062592_102576728 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300005172|Ga0066683_10231646 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
| 3300005332|Ga0066388_101276318 | All Organisms → cellular organisms → Bacteria | 1263 | Open in IMG/M |
| 3300005332|Ga0066388_101930243 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| 3300005332|Ga0066388_102478515 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 942 | Open in IMG/M |
| 3300005332|Ga0066388_105062182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 669 | Open in IMG/M |
| 3300005444|Ga0070694_100533307 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 938 | Open in IMG/M |
| 3300005445|Ga0070708_101840759 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300005456|Ga0070678_101125820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 726 | Open in IMG/M |
| 3300005471|Ga0070698_101265554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 687 | Open in IMG/M |
| 3300005535|Ga0070684_100382896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1296 | Open in IMG/M |
| 3300005554|Ga0066661_10167982 | All Organisms → cellular organisms → Eukaryota | 1349 | Open in IMG/M |
| 3300005557|Ga0066704_10134438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1650 | Open in IMG/M |
| 3300005559|Ga0066700_10288966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1153 | Open in IMG/M |
| 3300005602|Ga0070762_10096709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1703 | Open in IMG/M |
| 3300005713|Ga0066905_100429390 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
| 3300005713|Ga0066905_101557083 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300005764|Ga0066903_101065045 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1486 | Open in IMG/M |
| 3300005764|Ga0066903_101927384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1133 | Open in IMG/M |
| 3300005764|Ga0066903_102447426 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1010 | Open in IMG/M |
| 3300005764|Ga0066903_102503085 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 999 | Open in IMG/M |
| 3300005764|Ga0066903_103404333 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300005937|Ga0081455_10638582 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300006844|Ga0075428_102162822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 574 | Open in IMG/M |
| 3300006903|Ga0075426_11076127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 609 | Open in IMG/M |
| 3300007255|Ga0099791_10005249 | All Organisms → cellular organisms → Bacteria | 5330 | Open in IMG/M |
| 3300009523|Ga0116221_1024842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3062 | Open in IMG/M |
| 3300010046|Ga0126384_10839765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 825 | Open in IMG/M |
| 3300010047|Ga0126382_12513755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300010358|Ga0126370_11424520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 655 | Open in IMG/M |
| 3300010360|Ga0126372_10999758 | Not Available | 848 | Open in IMG/M |
| 3300010361|Ga0126378_10912941 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 984 | Open in IMG/M |
| 3300010361|Ga0126378_11824991 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 692 | Open in IMG/M |
| 3300010399|Ga0134127_10328135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1485 | Open in IMG/M |
| 3300012204|Ga0137374_10025941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6526 | Open in IMG/M |
| 3300012206|Ga0137380_11568243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 543 | Open in IMG/M |
| 3300012356|Ga0137371_10248895 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 1388 | Open in IMG/M |
| 3300012582|Ga0137358_10533152 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 790 | Open in IMG/M |
| 3300012683|Ga0137398_10878008 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 626 | Open in IMG/M |
| 3300012937|Ga0162653_100018147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 925 | Open in IMG/M |
| 3300012960|Ga0164301_10522185 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 861 | Open in IMG/M |
| 3300012971|Ga0126369_10592077 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1178 | Open in IMG/M |
| 3300012985|Ga0164308_10625038 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 919 | Open in IMG/M |
| 3300014638|Ga0181536_10507878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300015089|Ga0167643_1051542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 623 | Open in IMG/M |
| 3300016319|Ga0182033_11597569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 590 | Open in IMG/M |
| 3300016319|Ga0182033_12153370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300016387|Ga0182040_10419164 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1054 | Open in IMG/M |
| 3300016404|Ga0182037_10236351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1438 | Open in IMG/M |
| 3300016422|Ga0182039_10544208 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1008 | Open in IMG/M |
| 3300017553|Ga0182744_1112260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1103 | Open in IMG/M |
| 3300017975|Ga0187782_10526744 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 905 | Open in IMG/M |
| 3300018028|Ga0184608_10026144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2164 | Open in IMG/M |
| 3300018067|Ga0184611_1243119 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 638 | Open in IMG/M |
| 3300018073|Ga0184624_10344892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 667 | Open in IMG/M |
| 3300018073|Ga0184624_10406841 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 603 | Open in IMG/M |
| 3300018085|Ga0187772_10006106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 6264 | Open in IMG/M |
| 3300018468|Ga0066662_12388616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300018481|Ga0190271_12321857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 641 | Open in IMG/M |
| 3300018482|Ga0066669_11232049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 676 | Open in IMG/M |
| 3300019356|Ga0173481_10451340 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 642 | Open in IMG/M |
| 3300019890|Ga0193728_1056918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1888 | Open in IMG/M |
| 3300020001|Ga0193731_1027877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1485 | Open in IMG/M |
| 3300020002|Ga0193730_1152532 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 609 | Open in IMG/M |
| 3300020016|Ga0193696_1041602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1220 | Open in IMG/M |
| 3300020579|Ga0210407_10763648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 747 | Open in IMG/M |
| 3300021086|Ga0179596_10071044 | All Organisms → cellular organisms → Eukaryota | 1510 | Open in IMG/M |
| 3300021404|Ga0210389_10423361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1047 | Open in IMG/M |
| 3300021510|Ga0222621_1002461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2921 | Open in IMG/M |
| 3300025935|Ga0207709_10517352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aurantimonadaceae → Jiella → Jiella endophytica | 934 | Open in IMG/M |
| 3300026121|Ga0207683_10034035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 4428 | Open in IMG/M |
| 3300026317|Ga0209154_1126341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1079 | Open in IMG/M |
| 3300027748|Ga0209689_1022340 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3892 | Open in IMG/M |
| 3300027874|Ga0209465_10156330 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1133 | Open in IMG/M |
| 3300027875|Ga0209283_10701407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 632 | Open in IMG/M |
| 3300027903|Ga0209488_10284493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1236 | Open in IMG/M |
| 3300028708|Ga0307295_10168521 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 613 | Open in IMG/M |
| 3300028711|Ga0307293_10118700 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 840 | Open in IMG/M |
| 3300028714|Ga0307309_10095241 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 705 | Open in IMG/M |
| 3300028782|Ga0307306_10041087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1128 | Open in IMG/M |
| 3300028880|Ga0307300_10118010 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 813 | Open in IMG/M |
| 3300031170|Ga0307498_10374556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 553 | Open in IMG/M |
| 3300031543|Ga0318516_10393001 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 799 | Open in IMG/M |
| 3300031545|Ga0318541_10103142 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 1533 | Open in IMG/M |
| 3300031573|Ga0310915_10169150 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1518 | Open in IMG/M |
| 3300031640|Ga0318555_10057032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1995 | Open in IMG/M |
| 3300031640|Ga0318555_10120840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1391 | Open in IMG/M |
| 3300031723|Ga0318493_10319149 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 841 | Open in IMG/M |
| 3300031770|Ga0318521_10109789 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1529 | Open in IMG/M |
| 3300031770|Ga0318521_10303678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 940 | Open in IMG/M |
| 3300031781|Ga0318547_10208476 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1169 | Open in IMG/M |
| 3300031792|Ga0318529_10415236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 626 | Open in IMG/M |
| 3300031795|Ga0318557_10052455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1719 | Open in IMG/M |
| 3300031821|Ga0318567_10408507 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 769 | Open in IMG/M |
| 3300031821|Ga0318567_10541384 | Not Available | 661 | Open in IMG/M |
| 3300031879|Ga0306919_11178582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aurantimonadaceae → Jiella → Jiella endophytica | 582 | Open in IMG/M |
| 3300031896|Ga0318551_10670712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 600 | Open in IMG/M |
| 3300031942|Ga0310916_10297421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1366 | Open in IMG/M |
| 3300032025|Ga0318507_10033569 | All Organisms → cellular organisms → Bacteria | 1933 | Open in IMG/M |
| 3300032035|Ga0310911_10718629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 578 | Open in IMG/M |
| 3300032059|Ga0318533_10239489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1307 | Open in IMG/M |
| 3300032094|Ga0318540_10087984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1448 | Open in IMG/M |
| 3300033289|Ga0310914_10012459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 6367 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 13.46% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 11.54% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.77% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.88% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.92% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.92% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.92% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.96% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.96% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.96% |
| Compost | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Compost | 0.96% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.96% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.96% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.96% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.96% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.96% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012937 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300015089 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8A, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017553 | Enriched Miracle-Growth compost microbial communities from Emeryville, California, USA - eDNA 3rd pass 30_C Kraft MG (version 2) | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_107144412 | 3300001593 | Forest Soil | MITSSKDSAPKGWRSSSGRPQATARSTGVNGPGRPRALMNGVREPSTI* |
| Ga0062592_1025767282 | 3300004480 | Soil | MTWSNASGANGWRSSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM* |
| Ga0066683_102316461 | 3300005172 | Soil | MTSSKASGANGWRSSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM* |
| Ga0066388_1012763181 | 3300005332 | Tropical Forest Soil | ASGGNGWRNSSGRPQATARSTGVNGPGRPRARMNGVRLPSVM* |
| Ga0066388_1019302432 | 3300005332 | Tropical Forest Soil | GNGWRSSSGRPQATARSTGENGPGRPRARMNGVRLPSTM* |
| Ga0066388_1024785153 | 3300005332 | Tropical Forest Soil | GNGWRNSSGRPHSTARSTGENGPGRPRARMNGVRLPSTM* |
| Ga0066388_1050621821 | 3300005332 | Tropical Forest Soil | KASGANGWRSSSGLPQATVRSTGVNGPGRPRARMNGVRLPSTI* |
| Ga0070694_1005333072 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSSKASGANGWRSRSGLPQATVRSTGVNGPGRPRARMNGVRLPSTM* |
| Ga0070708_1018407592 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSSKASGGNGWRKSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM* |
| Ga0070678_1011258202 | 3300005456 | Miscanthus Rhizosphere | MTWSKASDLNGWRSSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM* |
| Ga0070698_1012655541 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSSNASGGNGWRKSSGRPHSTARSTGENGPGRPRARMNGVRLPSTM* |
| Ga0070684_1003828962 | 3300005535 | Corn Rhizosphere | MTWSKASGLNGWRSSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM* |
| Ga0066661_101679822 | 3300005554 | Soil | MTSSKASGGNDWRKSSGRPHSTARSTGVNGPGRPRARMNGVRLPSTM* |
| Ga0066704_101344382 | 3300005557 | Soil | MTSSKASGGNGWRKSSGRPHSTARSTGVNGPGRPRARMNGVRLPSTM* |
| Ga0066700_102889662 | 3300005559 | Soil | MTSSKASGGNGWRKSSGRPHSTARSTGENGPGRPRARMNGVRLPSTM* |
| Ga0070762_100967091 | 3300005602 | Soil | WRSNSGRPHCTARSTGVNGPGAPRALMKGVRLPSTI* |
| Ga0066905_1004293901 | 3300005713 | Tropical Forest Soil | GNGWRSSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM* |
| Ga0066905_1015570832 | 3300005713 | Tropical Forest Soil | MTSSKASGANGWRKSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM* |
| Ga0066903_1010650451 | 3300005764 | Tropical Forest Soil | WRSSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM* |
| Ga0066903_1019273842 | 3300005764 | Tropical Forest Soil | MTWSKASGANGWRSSSGRPQATARSTGVNGPGRPRARMKGVRLPSTI* |
| Ga0066903_1024474262 | 3300005764 | Tropical Forest Soil | MTSSKASGANGWRSSSGLPQATVRSTGVNGPGRPRARMNGVRLPSTM* |
| Ga0066903_1025030852 | 3300005764 | Tropical Forest Soil | WRSSSGRPQATARSTGENGPGRPRARMNGVRLPSTM* |
| Ga0066903_1034043332 | 3300005764 | Tropical Forest Soil | TSSKASGGNGWRSSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM* |
| Ga0081455_106385822 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MTWSKASGANGCRSSSGRPQATARSTGVNGPGRPRARMNGVRLPSVM* |
| Ga0075428_1021628222 | 3300006844 | Populus Rhizosphere | ASGGNGWRSSSGRPQATARSTGENGPGRPRARRNGVRLPSMM* |
| Ga0075426_110761271 | 3300006903 | Populus Rhizosphere | MTSSKASGANGWRRSSGLPQATVRSTGVNGPGRPRARMNGVRLPSTM* |
| Ga0099791_100052492 | 3300007255 | Vadose Zone Soil | MTSSKASGANGWRKSSGRPHSTARSTGVNGPGRPRARMNGVRLPSTM* |
| Ga0116221_10248421 | 3300009523 | Peatlands Soil | SGENGWRSNSGRPHCTARSTGVNGPGLPRALMNGVRLPSTM* |
| Ga0126384_108397652 | 3300010046 | Tropical Forest Soil | SGGNGWRSSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM* |
| Ga0126382_125137551 | 3300010047 | Tropical Forest Soil | RMTSSKASGGNGWRNSSGRPQATARSTGVNGPGRPRARMNGVRLPSVM* |
| Ga0126370_114245201 | 3300010358 | Tropical Forest Soil | PRMTSSKASGGNGWRSSSGRPQATARSTGENGPGRPRARMNGVRLPSTI* |
| Ga0126372_109997582 | 3300010360 | Tropical Forest Soil | SSKASGANGWRSSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM* |
| Ga0126378_109129412 | 3300010361 | Tropical Forest Soil | ANGWRSSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM* |
| Ga0126378_118249912 | 3300010361 | Tropical Forest Soil | MSNASGANGWRSSSGRPHWTARSTGVKGPGLPRALRKGVRLPSMM* |
| Ga0134127_103281352 | 3300010399 | Terrestrial Soil | SGLNGWRSSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM* |
| Ga0137374_100259415 | 3300012204 | Vadose Zone Soil | MTSSKASGGNGWRSSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM* |
| Ga0137380_115682432 | 3300012206 | Vadose Zone Soil | MTWSKASGANGWRSSSGRPQATARSTGVNGPGRPRARMKGVRLPSMM* |
| Ga0137371_102488951 | 3300012356 | Vadose Zone Soil | MTSSKASGGNGWRRSSGRPQATARSTGVNGPGRPRARMNGVRLPSMM* |
| Ga0137358_105331521 | 3300012582 | Vadose Zone Soil | RKSSGRPHSTARSTGVNGPGRPRARMNGVRLPSTM* |
| Ga0137398_108780082 | 3300012683 | Vadose Zone Soil | MTRSNASGANGWRSSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM* |
| Ga0162653_1000181472 | 3300012937 | Soil | MTKSNASGANGWRSSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM* |
| Ga0164301_105221852 | 3300012960 | Soil | NGWRSSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM* |
| Ga0126369_105920771 | 3300012971 | Tropical Forest Soil | ASGANGWRSSSGLPQATVRSTGVNGPGRPRARMNGVRLPSTI* |
| Ga0164308_106250381 | 3300012985 | Soil | MTSSKASGANGWRSSSGRPQATARSTGVNGPGRPRARMKGVRLPSTM* |
| Ga0181536_105078781 | 3300014638 | Bog | ASGANGWRSKSGRPHCTARSTGVNGPGLPRALMNGVRLPSTI* |
| Ga0167643_10515421 | 3300015089 | Glacier Forefield Soil | ASGANGWRSNSGRPHCTARSTGVNGPGLPRALMNGVRLPSMM* |
| Ga0182033_115975692 | 3300016319 | Soil | GWRSSSGRPQATARSTGENGPGRPRARMNGVRLPSTM |
| Ga0182033_121533702 | 3300016319 | Soil | WRNSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM |
| Ga0182040_104191641 | 3300016387 | Soil | RMTSSKASGGNGWRNSSGRPQATARSTGVKGPGRPRARMNGVRLPSTM |
| Ga0182037_102363511 | 3300016404 | Soil | GWRKSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM |
| Ga0182039_105442082 | 3300016422 | Soil | WRSSSGRPQATARSTGENGPGRPRARMNGVRLPSTM |
| Ga0182744_11122602 | 3300017553 | Compost | ANGWRSSSGRPHCTARSTGVNGPGLPRALMKGVRLPSTI |
| Ga0187782_105267442 | 3300017975 | Tropical Peatland | TWSKASGAKGWRSSSGRPHCTARSTGVNGPGLPRALMNGVRLPSTM |
| Ga0184608_100261443 | 3300018028 | Groundwater Sediment | MTWSNASGANGWRSSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM |
| Ga0184611_12431191 | 3300018067 | Groundwater Sediment | GWRSSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM |
| Ga0184624_103448922 | 3300018073 | Groundwater Sediment | MTWSKVSGGNGWRSSSGLPQATARSTGVNGPGRPRALMKGVRLPSMM |
| Ga0184624_104068412 | 3300018073 | Groundwater Sediment | ANGWRSSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM |
| Ga0187772_100061069 | 3300018085 | Tropical Peatland | GWRSSSGRPHSTARSTGVNGPGRPRALMKGVRLPSTM |
| Ga0066662_123886162 | 3300018468 | Grasslands Soil | MTSSKASGANGWRSSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM |
| Ga0190271_123218572 | 3300018481 | Soil | MTWSKAAGLSGWRSSSGRRQATARSTGVNGPGRPRARMNGVRLPSTM |
| Ga0066669_112320492 | 3300018482 | Grasslands Soil | MTSSKASGANGWRSSSGLPQATVRSTGVNGPGRPRARMNGVRLPSTM |
| Ga0173481_104513402 | 3300019356 | Soil | SGLNGWRSSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM |
| Ga0193728_10569182 | 3300019890 | Soil | MSNASGANGWRSSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM |
| Ga0193731_10278772 | 3300020001 | Soil | MTRSNASGANGWRSSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM |
| Ga0193730_11525322 | 3300020002 | Soil | MTWSKASGLNGWRSSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM |
| Ga0193696_10416021 | 3300020016 | Soil | RMTWSKASGLNGWRSSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM |
| Ga0210407_107636482 | 3300020579 | Soil | MTSSNASGANGWRSSSGLPQATVRSTGVNGPGRPRARMNGVRLPSTM |
| Ga0179596_100710442 | 3300021086 | Vadose Zone Soil | MTSSKASGANGWRKSSGRPHSTARSTGVNGPGRPRARMNGVRLPSTM |
| Ga0210389_104233611 | 3300021404 | Soil | WRSNSGRPHCTARSTGVNGPGLPRALMNGVRLPSMM |
| Ga0222621_10024613 | 3300021510 | Groundwater Sediment | MTKSNASGANGWRSSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM |
| Ga0207709_105173522 | 3300025935 | Miscanthus Rhizosphere | RSSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM |
| Ga0207683_100340352 | 3300026121 | Miscanthus Rhizosphere | MTWSKASDLNGWRSSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM |
| Ga0209154_11263412 | 3300026317 | Soil | MTSSKASGGNGWRKSSGRPHSTARSTGVNGPGRPRARMNGVRLPSTM |
| Ga0209689_10223402 | 3300027748 | Soil | MTSSKASGGNGWRKSSGRPHSTARSTGENGPGRPRARMNGVRLPSTM |
| Ga0209465_101563301 | 3300027874 | Tropical Forest Soil | SSKASGGNGWRSSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM |
| Ga0209283_107014071 | 3300027875 | Vadose Zone Soil | KASGGNGWRNSSGRPHSTARSTGVNGPGRPRARMNGVRLPSTM |
| Ga0209488_102844931 | 3300027903 | Vadose Zone Soil | GANGWRSSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM |
| Ga0307295_101685212 | 3300028708 | Soil | SGANGWRSSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM |
| Ga0307293_101187002 | 3300028711 | Soil | SNASGANGWRSSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM |
| Ga0307309_100952411 | 3300028714 | Soil | WRSSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM |
| Ga0307306_100410872 | 3300028782 | Soil | MTMSNASGANGWRSSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM |
| Ga0307300_101180101 | 3300028880 | Soil | ASGANGWRSSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM |
| Ga0307498_103745562 | 3300031170 | Soil | MTWSKASGANGWRSSSGRPQATARSTGVNGPGRPRARMKGVRLPSMM |
| Ga0318516_103930011 | 3300031543 | Soil | NGWRSSSGRPQATARSTGENGPGRPRARMNGVRLPSTM |
| Ga0318541_101031422 | 3300031545 | Soil | MTSSKASGGNGWRKSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM |
| Ga0310915_101691502 | 3300031573 | Soil | MTSSKASGANGWRSSSGRPQTTARSTGVNGPGRPRARMNGVRLPSTM |
| Ga0318555_100570322 | 3300031640 | Soil | NGCRSSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM |
| Ga0318555_101208401 | 3300031640 | Soil | MTSSKASGGNGWRSSSGRPQATARSTGENGPGRPRARMNGVRLPSTM |
| Ga0318493_103191492 | 3300031723 | Soil | SKASGGNGWRSSSGRPQATARSTGENGPGRPRARMNGVRLPSTM |
| Ga0318521_101097892 | 3300031770 | Soil | TQPRMTSSKASGANGWRSSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM |
| Ga0318521_103036782 | 3300031770 | Soil | RMTWSNASGENGWRSSRGRPHWTARSTGVNGPGLPRALRKGVRLPSTM |
| Ga0318547_102084762 | 3300031781 | Soil | NGWRKSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM |
| Ga0318529_104152362 | 3300031792 | Soil | TQPRMTSSKASGGNGWRSSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM |
| Ga0318557_100524551 | 3300031795 | Soil | NGWRSNSGRPHCTARSTGVNGPGLPRAFMKGVRLPSTI |
| Ga0318567_104085071 | 3300031821 | Soil | ASGGNGWRSSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM |
| Ga0318567_105413841 | 3300031821 | Soil | GNGWRSSSGRPQATARSTGENGPGRPRARMNGVRLPSTM |
| Ga0306919_111785822 | 3300031879 | Soil | NGWRSSRGRPHWTARSTGVNGPGLPRALRKGVRLPSMM |
| Ga0318551_106707121 | 3300031896 | Soil | SGGNGWRNSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM |
| Ga0310916_102974212 | 3300031942 | Soil | ASGGNGWRSSSGRPQATARSTGENGPGRPRARMNGVRLPSTM |
| Ga0318507_100335692 | 3300032025 | Soil | QPRMTSSKASGGNGWRNSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM |
| Ga0310911_107186291 | 3300032035 | Soil | NGWRNSSGRPQATARSTGVKGPGRPRARMNGVRLPSTM |
| Ga0318533_102394892 | 3300032059 | Soil | RKSSGRPQATARSTGVNGPGRPRARMNGVRLPSTM |
| Ga0318540_100879842 | 3300032094 | Soil | RMTSSKASGANGWRSSSGRPQTTARSTGVNGPGRPRARMNGVRLPSTM |
| Ga0310914_100124591 | 3300033289 | Soil | RITWSKSSGANGWRSRSGRPHCTARSTGVNGPGLPRALMKGVRLPSTI |
| ⦗Top⦘ |