Metagenome / Metatranscriptome Family F096802

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F096802
Family Type	Metagenome / Metatranscriptome
Number of Sequences	104
Average Sequence Length	43 residues
Representative Sequence	MALCVRYLHRHPLELSHLPATAIVDLLALAAVEAELLADAEPL
Number of Associated Samples	43
Number of Associated Scaffolds	104

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	86.54 %
% of genes near scaffold ends (potentially truncated)	16.35 %
% of genes from short scaffolds (< 2000 bps)	79.81 %
Associated GOLD sequencing projects	38
AlphaFold2 3D model prediction	No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (90.385 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat (69.231 % of family members)
Environment Ontology (ENVO)	Unclassified (92.308 % of family members)
Earth Microbiome Project Ontology (EMPO)	Unclassified (71.154 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 53.49% β-sheet: 0.00% Coil/Unstructured: 46.51%
Feature Viewer

Powered by Feature Viewer

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 104 Family Scaffolds
PF06074	DUF935	5.77
PF04542	Sigma70_r2	1.92
PF01507	PAPS_reduct	0.96
PF05069	Phage_tail_S	0.96
PF01710	HTH_Tnp_IS630	0.96
PF10124	Mu-like_gpT	0.96

COG ID	Name	Functional Category	% Frequency in 104 Family Scaffolds
COG4383	Mu-like prophage protein gp29	Mobilome: prophages, transposons [X]	5.77
COG0568	DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)	Transcription [K]	1.92
COG1191	DNA-directed RNA polymerase specialized sigma subunit	Transcription [K]	1.92
COG1595	DNA-directed RNA polymerase specialized sigma subunit, sigma24 family	Transcription [K]	1.92
COG4941	Predicted RNA polymerase sigma factor, contains C-terminal TPR domain	Transcription [K]	1.92
COG3415	CRISPR-associated protein Csa3, CARF domain	Defense mechanisms [V]	0.96
COG5005	Mu-like prophage protein gpG	Mobilome: prophages, transposons [X]	0.96

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.38 %
All Organisms	root	All Organisms	9.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.38 %
cellular organisms	root	All Organisms → cellular organisms	7.69 %
Viruses	superkingdom	All Organisms → Viruses	1.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.38 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	7.69 %
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	1.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.38 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.88 %
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	1.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.38 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2.88 %
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	1.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.38 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2.88 %
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.38 %
unclassified Burkholderiales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales	2.88 %
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.38 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	2.88 %
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1.92 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2015219002\|YNP15_FYNB36693_g1	Not Available	798	Open in IMG/M
3300002493\|JGI24185J35167_1036287	Not Available	1127	Open in IMG/M
3300002510\|JGI24186J35511_1013197	Not Available	1724	Open in IMG/M
3300003605\|JGI26463J51803_1024210	Not Available	950	Open in IMG/M
3300003688\|Ga0061020_1057784	Not Available	901	Open in IMG/M
3300003688\|Ga0061020_1098662	Not Available	589	Open in IMG/M
3300005452\|Ga0068706_1061114	Not Available	674	Open in IMG/M
3300005452\|Ga0068706_1061122	Not Available	674	Open in IMG/M
3300005453\|Ga0068705_10069175	Not Available	1037	Open in IMG/M
3300005453\|Ga0068705_10108889	Not Available	730	Open in IMG/M
3300005495\|Ga0068666_1112144	Not Available	1029	Open in IMG/M
3300005638\|Ga0068669_1026760	Not Available	749	Open in IMG/M
3300005858\|Ga0079995_1039794	Not Available	846	Open in IMG/M
3300006849\|Ga0102029_1031068	Not Available	1099	Open in IMG/M
3300010289\|Ga0129299_1027465	Not Available	2752	Open in IMG/M
3300020153\|Ga0197142_1000729	All Organisms → cellular organisms → Bacteria	30590	Open in IMG/M
3300026237\|Ga0209750_1008321	Not Available	2647	Open in IMG/M
3300026237\|Ga0209750_1010424	Not Available	2271	Open in IMG/M
3300026237\|Ga0209750_1026618	Not Available	1180	Open in IMG/M
3300026237\|Ga0209750_1048096	Not Available	791	Open in IMG/M
3300026509\|Ga0209809_1007256	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	5744	Open in IMG/M
3300026509\|Ga0209809_1007777	Not Available	5438	Open in IMG/M
3300026509\|Ga0209809_1018931	Not Available	2773	Open in IMG/M
3300026509\|Ga0209809_1048654	Not Available	1318	Open in IMG/M
3300026509\|Ga0209809_1050108	Not Available	1287	Open in IMG/M
3300026509\|Ga0209809_1100411	Not Available	737	Open in IMG/M
3300027279\|Ga0209691_1004243	All Organisms → cellular organisms → Bacteria	6237	Open in IMG/M
3300027279\|Ga0209691_1012297	Not Available	2544	Open in IMG/M
3300027279\|Ga0209691_1028742	Not Available	1231	Open in IMG/M
3300028761\|Ga0272447_1008087	Not Available	3369	Open in IMG/M
3300029977\|Ga0272449_1003972	All Organisms → cellular organisms → Bacteria	12334	Open in IMG/M
3300031245\|Ga0308395_1112875	Not Available	611	Open in IMG/M
3300031508\|Ga0308394_1015556	All Organisms → cellular organisms → Bacteria	2361	Open in IMG/M
3300031509\|Ga0308399_1020613	Not Available	1674	Open in IMG/M
3300031509\|Ga0308399_1024221	Not Available	1506	Open in IMG/M
3300031509\|Ga0308399_1094315	Not Available	600	Open in IMG/M
3300031509\|Ga0308399_1097558	Not Available	587	Open in IMG/M
3300031513\|Ga0308412_1017461	Not Available	3096	Open in IMG/M
3300031513\|Ga0308412_1033293	Not Available	1950	Open in IMG/M
3300031513\|Ga0308412_1033343	Not Available	1948	Open in IMG/M
3300031513\|Ga0308412_1034047	Not Available	1919	Open in IMG/M
3300031513\|Ga0308412_1040528	Not Available	1691	Open in IMG/M
3300031513\|Ga0308412_1060389	Not Available	1261	Open in IMG/M
3300031513\|Ga0308412_1063829	Not Available	1210	Open in IMG/M
3300031513\|Ga0308412_1066518	Not Available	1174	Open in IMG/M
3300031513\|Ga0308412_1073859	Not Available	1086	Open in IMG/M
3300031513\|Ga0308412_1086960	Not Available	964	Open in IMG/M
3300031513\|Ga0308412_1092934	Not Available	919	Open in IMG/M
3300031513\|Ga0308412_1141457	Not Available	683	Open in IMG/M
3300031513\|Ga0308412_1211393	Not Available	521	Open in IMG/M
3300031514\|Ga0308390_1129078	Not Available	514	Open in IMG/M
3300031517\|Ga0308392_1051857	Not Available	941	Open in IMG/M
3300031567\|Ga0308391_1008726	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	2854	Open in IMG/M
3300031567\|Ga0308391_1032396	Not Available	1230	Open in IMG/M
3300031767\|Ga0308401_1014861	Not Available	1819	Open in IMG/M
3300031767\|Ga0308401_1016885	All Organisms → cellular organisms → Bacteria	1677	Open in IMG/M
3300031767\|Ga0308401_1103712	Not Available	543	Open in IMG/M
3300031776\|Ga0308415_1033329	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1357	Open in IMG/M
3300031776\|Ga0308415_1074900	Not Available	733	Open in IMG/M
3300031776\|Ga0308415_1108394	Not Available	547	Open in IMG/M
3300031783\|Ga0308418_1049215	Not Available	1037	Open in IMG/M
3300031812\|Ga0308411_10028599	Not Available	2911	Open in IMG/M
3300031812\|Ga0308411_10046870	Not Available	2004	Open in IMG/M
3300031812\|Ga0308411_10060006	Not Available	1653	Open in IMG/M
3300031812\|Ga0308411_10135092	Not Available	892	Open in IMG/M
3300031812\|Ga0308411_10135448	Not Available	891	Open in IMG/M
3300031812\|Ga0308411_10161452	Not Available	785	Open in IMG/M
3300031812\|Ga0308411_10193852	Not Available	691	Open in IMG/M
3300031812\|Ga0308411_10243235	Not Available	592	Open in IMG/M
3300031830\|Ga0308409_1018591	Not Available	2026	Open in IMG/M
3300031865\|Ga0308408_1019954	Not Available	1885	Open in IMG/M
3300031875\|Ga0308405_1094739	Not Available	733	Open in IMG/M
3300031878\|Ga0308404_1021595	Not Available	1419	Open in IMG/M
3300031878\|Ga0308404_1027996	Not Available	1211	Open in IMG/M
3300031878\|Ga0308404_1032348	Not Available	1109	Open in IMG/M
3300031878\|Ga0308404_1049992	Not Available	850	Open in IMG/M
3300031878\|Ga0308404_1110548	Not Available	531	Open in IMG/M
3300031950\|Ga0308417_1009936	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	5346	Open in IMG/M
3300031950\|Ga0308417_1045170	Not Available	1874	Open in IMG/M
3300031950\|Ga0308417_1069727	Not Available	1352	Open in IMG/M
3300031950\|Ga0308417_1072037	Not Available	1320	Open in IMG/M
3300031950\|Ga0308417_1083095	Not Available	1185	Open in IMG/M
3300031950\|Ga0308417_1102503	Not Available	1015	Open in IMG/M
3300031950\|Ga0308417_1111036	Not Available	958	Open in IMG/M
3300031950\|Ga0308417_1137997	Not Available	816	Open in IMG/M
3300031950\|Ga0308417_1139123	Not Available	811	Open in IMG/M
3300031950\|Ga0308417_1156366	Not Available	745	Open in IMG/M
3300031950\|Ga0308417_1218416	Not Available	587	Open in IMG/M
3300031958\|Ga0308410_1071647	Not Available	1039	Open in IMG/M
3300031958\|Ga0308410_1089910	Not Available	879	Open in IMG/M
3300032034\|Ga0308407_1119323	Not Available	525	Open in IMG/M
3300032045\|Ga0308400_1009007	Not Available	2692	Open in IMG/M
3300032045\|Ga0308400_1051063	Not Available	920	Open in IMG/M
3300032045\|Ga0308400_1057423	Not Available	850	Open in IMG/M
3300032045\|Ga0308400_1065358	Not Available	780	Open in IMG/M
3300032049\|Ga0308416_1007942	Not Available	2958	Open in IMG/M
3300032049\|Ga0308416_1025175	Not Available	1401	Open in IMG/M
3300032049\|Ga0308416_1049536	Not Available	864	Open in IMG/M
3300032056\|Ga0308310_1081990	Not Available	808	Open in IMG/M
3300032058\|Ga0308419_1106398	Not Available	794	Open in IMG/M
3300032356\|Ga0308414_1061042	Not Available	1511	Open in IMG/M
3300033886\|Ga0308413_043331	Not Available	1330	Open in IMG/M
3300033886\|Ga0308413_070318	Not Available	933	Open in IMG/M
3300034696\|Ga0370516_000543	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	19104	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	100.00%

Habitat	Taxonomy	Distribution
Thermal Springs	Environmental → Aquatic → Thermal Springs	98.08%
Freshwater	Environmental → Aquatic → Freshwater	1.92%

Habitat	Taxonomy	Distribution
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	98.08%
Lotic	Environmental → Aquatic → Freshwater → Lotic	1.92%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified	94.23%
Sediment	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment	2.88%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	1.92%
Microbial Mats	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Microbial Mats	0.96%

Habitat	Taxonomy	Distribution
Hot Spring Phototrophic Mat	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat	69.23%
Anoxygenic And Chlorotrophic	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic	12.50%
Anoxygenic And Chlorotrophic Microbial Mat	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat	10.58%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	1.92%
Sediment	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment	1.92%
Hot Spring	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring	0.96%
Hot Spring Water	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Water	0.96%
Microbial Mat	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Microbial Mat	0.96%
Hot Spring Microbial Mat	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Microbial Mats → Hot Spring Microbial Mat	0.96%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2015219002	Hot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP15 Mushroom Spring	Environmental	Open in IMG/M
3300002493	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS undermat 2012	Environmental	Open in IMG/M
3300002510	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS upper layer 2012	Environmental	Open in IMG/M
3300003605	Freshwater microbial communities from Yellowstone National Park, Wyoming, USA - Fairy Falls C (FF_Mn_C)	Environmental	Open in IMG/M
3300003688	Coassembly of YNP Bryant MS undermat 2012 and YNP Bryant MS upper layer 2012	Environmental	Open in IMG/M
3300005452	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-B MetaG	Environmental	Open in IMG/M
3300005453	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-T MetaG	Environmental	Open in IMG/M
3300005495	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1400(2)_B MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005638	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1700(2)_B MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005858	Freshwater microbial communities from Yellowstone National Park, Wyoming, USA - Fairy Falls C (FF_Mn_C) (SPADES assembly)	Environmental	Open in IMG/M
3300006849	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1600(2)_T MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300010289	Hot spring microbial mat communities from California, USA to study Microbial Dark Matter (Phase II) - Cone Pool mat layer C metaG	Environmental	Open in IMG/M
3300020153	Sediment microbial communities from Great Boiling Springs, Gerlach, Nevada, United States - GBS 60_MetaG	Environmental	Open in IMG/M
3300026237	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS upper layer 2012 (SPAdes)	Environmental	Open in IMG/M
3300026509	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-T MetaG (SPAdes)	Environmental	Open in IMG/M
3300027279	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-B MetaG (SPAdes)	Environmental	Open in IMG/M
3300028761	Hot spring microbial mat communities from Yellowstone National Park, WY, United States - YNP-CB-013-3	Environmental	Open in IMG/M
3300029977	Hot spring sediment microbial communities from Yellowstone National Park, WY, United States - YNP-CB-024-1	Environmental	Open in IMG/M
3300031245	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050930_P4	Environmental	Open in IMG/M
3300031508	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_me2	Environmental	Open in IMG/M
3300031509	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS12-60	Environmental	Open in IMG/M
3300031513	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20070728_OST1-BottomLayer	Environmental	Open in IMG/M
3300031514	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20040719_149	Environmental	Open in IMG/M
3300031517	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20050624_m2	Environmental	Open in IMG/M
3300031567	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20050623_t1	Environmental	Open in IMG/M
3300031767	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060913_OS-M1	Environmental	Open in IMG/M
3300031776	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS55	Environmental	Open in IMG/M
3300031783	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090729_R4cd	Environmental	Open in IMG/M
3300031812	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20070728_OST2-BottomLayer	Environmental	Open in IMG/M
3300031830	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060912_MSe4	Environmental	Open in IMG/M
3300031865	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060912_MSe3	Environmental	Open in IMG/M
3300031875	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060912_MS13	Environmental	Open in IMG/M
3300031878	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS-M4	Environmental	Open in IMG/M
3300031950	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS65	Environmental	Open in IMG/M
3300031958	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20070728_OST2-MatCore	Environmental	Open in IMG/M
3300032034	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060911_MSe2	Environmental	Open in IMG/M
3300032045	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS12-65	Environmental	Open in IMG/M
3300032049	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS60	Environmental	Open in IMG/M
3300032056	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS65	Environmental	Open in IMG/M
3300032058	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS50	Environmental	Open in IMG/M
3300032356	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS50	Environmental	Open in IMG/M
3300033886	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090729_t10cd	Environmental	Open in IMG/M
3300034696	Hot spring water microbial communities from Yellowstone National Park, WY, United States - YNP_Buffalopool_103118	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
YNP15667080	2015219002	Hot Spring	MALCVRYLHRHPLELSHLPAAALADLIALASAEADAYAEALP
JGI24185J35167_10362871	3300002493	Anoxygenic And Chlorotrophic Microbial Mat	MTLCVRYLHRHPLELTHLPATAIVDLLALAAVEAELLADAQPL*
JGI24186J35511_10131972	3300002510	Anoxygenic And Chlorotrophic Microbial Mat	MALCVRXLHRHPLELTHLPATAIVDXLALAAVEAELLADAQPL*
JGI26463J51803_10242101	3300003605	Freshwater	MALCVRYLHRHPLELSHLPAAALADLIALASAEADAYAEALP*
Ga0061020_10577841	3300003688	Anoxygenic And Chlorotrophic Microbial Mat	VALCLRYLHRHPLELSHLPATAIEDLLALAAVEAELLADAHPL*
Ga0061020_10986622	3300003688	Anoxygenic And Chlorotrophic Microbial Mat	MALCVRYLHRHPLELSHLPATALADLIALASAEADAYAEALP*
Ga0068706_10611142	3300005452	Anoxygenic And Chlorotrophic	MALCVRYLHRHPLELTHLPATAIVDLLALAAVEAELLADAEPL*
Ga0068706_10611222	3300005452	Anoxygenic And Chlorotrophic	MALCLRYLHRHPLELSHLPATAIVDLLAIAAVEAELLADAEPL*
Ga0068705_100691751	3300005453	Anoxygenic And Chlorotrophic	MALCLRYLHRHPLELSHLPATAIVDLLALAAVEAELLADAEPL*
Ga0068705_101088891	3300005453	Anoxygenic And Chlorotrophic	MALCVRYLHRHPLELTHLPATAIVDLLTLAAVEAELLADAEPL*
Ga0068666_11121441	3300005495	Anoxygenic And Chlorotrophic Microbial Mat	MALCVRYLHRHPLELSHLPATAIVDLLALAAVEAELLADA
Ga0068669_10267602	3300005638	Anoxygenic And Chlorotrophic Microbial Mat	MTLCVRYLHRHPLELSHLPATAIVDLLAIAAVEAELLADAQPL*
Ga0079995_10397942	3300005858	Freshwater	MALCVRYLHRHPLELSHLPAAVLADLIALASAEADAYAEALP*
Ga0102029_10310682	3300006849	Anoxygenic And Chlorotrophic Microbial Mat	MALCVRYLHRHPLELSHLPATAIVDLLALAAVEAELLADAEPL*
Ga0129299_10274655	3300010289	Hot Spring Microbial Mat	LRYLHRHPLELSHLPAEAFADLAALALAEAEAYEDAAAEL*
Ga0197142_100072943	3300020153	Sediment	LRYLHRHPLELSHLPAEAFIDLAALALAEAEAYEDAAGEL
Ga0209750_10083213	3300026237	Anoxygenic And Chlorotrophic Microbial Mat	MALCVRYLHRHPLELSHLPATALADLIALASAEADAYAEALP
Ga0209750_10104243	3300026237	Anoxygenic And Chlorotrophic Microbial Mat	MALCLRYLHRHPLELSHLPATAIVDLLAIAAVEAELLADAEPL
Ga0209750_10266182	3300026237	Anoxygenic And Chlorotrophic Microbial Mat	MALCVRYLHRHPLELTHLPATAIVDLLALAAVEAELLADAQPL
Ga0209750_10480962	3300026237	Anoxygenic And Chlorotrophic Microbial Mat	MALCLRYLHRHPLELSHLPATAIVDLLALASVEAELLADAEPL
Ga0209809_10072561	3300026509	Anoxygenic And Chlorotrophic	MALCVRYLHRHPLELSHLPATAIVDLLALAAVEAELLADAEPL
Ga0209809_10077775	3300026509	Anoxygenic And Chlorotrophic	MALCVRYLHRHPLELSHLPATAIVDLLALAAVEAELLADAQPL
Ga0209809_10189312	3300026509	Anoxygenic And Chlorotrophic	MALCVRYLHRHPLELTHLPATAIVDLLALAAVEAELLTDAQPL
Ga0209809_10486543	3300026509	Anoxygenic And Chlorotrophic	MALCVRYLHRHPLELSHLPATAIVDLLALAAVEAELLTDAQPL
Ga0209809_10501082	3300026509	Anoxygenic And Chlorotrophic	MTLCARYLHRHPLELTHLPATAIVDLLALAAVEAELLADAQPL
Ga0209809_11004112	3300026509	Anoxygenic And Chlorotrophic	MTLCVRYLHRHPLELSHLPATAIVDLLALAAVEAELLADAEPL
Ga0209691_10042434	3300027279	Anoxygenic And Chlorotrophic	VALCLRYLHRHPLELSHLPATAIEDLLALAAVEAELLADAEPL
Ga0209691_10122975	3300027279	Anoxygenic And Chlorotrophic	MTLCVRYLHRHPLELTHLPATAIVDLLALAAVEAELLADAQPL
Ga0209691_10287423	3300027279	Anoxygenic And Chlorotrophic	MTLCVRYLHRHPLELSHLPATAIADLLAIAAVEAELLADAQPL
Ga0272447_10080876	3300028761	Microbial Mat	MALCLRYLHRHPLELSHLPATAIADLLALAAVEAELLADAEPL
Ga0272449_10039729	3300029977	Sediment	MTLCVRYLHRHPLELSHLPATAIADLLALGTVEAELLADAEPL
Ga0308395_11128751	3300031245	Hot Spring Phototrophic Mat	MTLCVRYLHRHPLELTHLPATAIVDLLALAAVEAELLADAEPL
Ga0308394_10155561	3300031508	Hot Spring Phototrophic Mat	GEAIMALCVRYLHRHPLELSHLPATAIVDLLALAAVEAELLTDAQPL
Ga0308399_10206134	3300031509	Hot Spring Phototrophic Mat	MTLCVRYLHRHPLELTHLPATAIADLLALAAVEAELIADAQPL
Ga0308399_10242211	3300031509	Hot Spring Phototrophic Mat	MALCLRYLHRHPLELTHLPATAIADLLALAAVEAELLADAEPL
Ga0308399_10943152	3300031509	Hot Spring Phototrophic Mat	MTLCLRYLHRHPLELSHLPATAIADLLALAAVEAELLADAQPL
Ga0308399_10975581	3300031509	Hot Spring Phototrophic Mat	MALCVRYLHRHPLELSHLSATAIVDLLALAAVEAELLADAQPL
Ga0308412_10174612	3300031513	Hot Spring Phototrophic Mat	VALCLRYLHRHPLELSHLPATAIVDLLALAAVEAELLADAEPL
Ga0308412_10332932	3300031513	Hot Spring Phototrophic Mat	MTLCVRYLHRHPLELSHLPATAIVDLLALAGVEAELLADAEPL
Ga0308412_10333432	3300031513	Hot Spring Phototrophic Mat	MALCVRYLHRHPLELSHLPAAAIVDLLALASVEAELLADAQPL
Ga0308412_10340471	3300031513	Hot Spring Phototrophic Mat	EAIMALCVRYLHRHPLELTHLPATAIVDLLALAAVESELLADTEPL
Ga0308412_10405282	3300031513	Hot Spring Phototrophic Mat	MALCLRYLHRHPLELSHLPATAIVDLLALAAVEAELLSDTEPL
Ga0308412_10603892	3300031513	Hot Spring Phototrophic Mat	MTLCVRYLHRHPLELTHLPATAIADLLALAAVEAELLADAQPL
Ga0308412_10638292	3300031513	Hot Spring Phototrophic Mat	MTLCVRYLHRHPLELTHLAATAIADLLAIAAVEAELLADAHPL
Ga0308412_10665183	3300031513	Hot Spring Phototrophic Mat	MALCVRYLHRHPLELSHLPAAAIVDLLALAAVEAELLADAEPL
Ga0308412_10738592	3300031513	Hot Spring Phototrophic Mat	MALCVRYLHRHPLELTHLPATAIVDLLAIAAVEAELIADAEPL
Ga0308412_10869603	3300031513	Hot Spring Phototrophic Mat	MALCLRYLHRHPLELSHLPATAIVDLLALAAVEAELLADAQPL
Ga0308412_10929341	3300031513	Hot Spring Phototrophic Mat	MTLCVRYLHRHPLELSHLPATAIVDLLALAAVEAELLADAQPL
Ga0308412_11414571	3300031513	Hot Spring Phototrophic Mat	MALCLRYLHRHPLELSHLPATAIVDLLALAAVEAELLADAEPL
Ga0308412_12113932	3300031513	Hot Spring Phototrophic Mat	GEAIMALCVRYLHRHPLELSHLPATAIVDLLALAAVEAELLADAQPL
Ga0308390_11290781	3300031514	Hot Spring Phototrophic Mat	LHRHPLELTHLPATAIVDLLALAAVEAELLADAQPL
Ga0308392_10518572	3300031517	Hot Spring Phototrophic Mat	MALCVRYLHRHPLELSHLPAAALVDLIALASAEADAYAEALP
Ga0308391_10087266	3300031567	Hot Spring Phototrophic Mat	MALCLRYLHRHPLELSHLPATAIADLLALAAVESELLADAESL
Ga0308391_10323964	3300031567	Hot Spring Phototrophic Mat	MALCVRYLHRHPLELNHLPATAIVDLLALASVEAELLADAEPL
Ga0308401_10148613	3300031767	Hot Spring Phototrophic Mat	MALCVRYLHRHPLELTHLPATAIADLLALAAVEAELLADAQPL
Ga0308401_10168853	3300031767	Hot Spring Phototrophic Mat	AGGEAIMALCVRYLHRHPLELSHLPATAIVDLLALAAVESELLADAEPL
Ga0308401_11037122	3300031767	Hot Spring Phototrophic Mat	MALCVRYLHRHPLELSHLPANAIVDLLALAAVEAELLADAQPL
Ga0308415_10333292	3300031776	Hot Spring Phototrophic Mat	MALCLRYLHRHPLELSHLPAAAIVDLLALAAVEAELLTDAQPL
Ga0308415_10749002	3300031776	Hot Spring Phototrophic Mat	MALCVRYLHRHPLELSHLPATAIVDLLALASVEAELLADAQPL
Ga0308415_11083941	3300031776	Hot Spring Phototrophic Mat	MALCLRYLHRHPLELSHLPATAIADLLALAAVEAELLADVEPL
Ga0308418_10492153	3300031783	Hot Spring Phototrophic Mat	MTLCVRYLHRHPLELSHLPATAIADLLALAGVEAELLADAQPL
Ga0308411_100285992	3300031812	Hot Spring Phototrophic Mat	MALCVRYLHRHPLELSHLPATAVVDLLALAAVEAELLADAEPL
Ga0308411_100468702	3300031812	Hot Spring Phototrophic Mat	MTLCVRYLHRHPLELTHLPATAIADLLALAAVEAELLTDAEPL
Ga0308411_100600062	3300031812	Hot Spring Phototrophic Mat	VALCLRYLHRHPLELSHLPATAIVDLLALAAVEAELLADAHPL
Ga0308411_101350922	3300031812	Hot Spring Phototrophic Mat	MALCVRYLHRHPLELTHLPATAIVDLLALAAVESELLTDAQPL
Ga0308411_101354482	3300031812	Hot Spring Phototrophic Mat	MTLCLRYLHRHPLELSHLPATAIADLLALAAVEAELLADAEPL
Ga0308411_101614521	3300031812	Hot Spring Phototrophic Mat	MALCVRYLHRHPLELTHLAATAIVDLLALAAVEAELLADAEPL
Ga0308411_101938522	3300031812	Hot Spring Phototrophic Mat	IRAGGEAIMALCVRYLHRHPLELSHLPATAIADLLALAAVEAELLADAEPL
Ga0308411_102432352	3300031812	Hot Spring Phototrophic Mat	MALCLRYLHRHPLELSHLPATAIVDLLALAAVEAELLADA
Ga0308409_10185912	3300031830	Hot Spring Phototrophic Mat	MALCVRYLHRHPLELTHLPATAIVDLLTLAAVEAELLADAEPL
Ga0308408_10199543	3300031865	Hot Spring Phototrophic Mat	MALCVRYLHRHPLELTHLPATAIVDLLALAAVEAELLADAEPL
Ga0308405_10947391	3300031875	Hot Spring Phototrophic Mat	RAGGEAIMALCVRYLHRHPLELSHLPATAIVDLLALAAVEAELLTDAQPL
Ga0308404_10215951	3300031878	Hot Spring Phototrophic Mat	MALCLRYLHRHPLELSHLPATAIVDLLALAAVEAEL
Ga0308404_10279962	3300031878	Hot Spring Phototrophic Mat	MALCLRYLHRHPLELSHLPATAIVDLLALAAVEAELLTDAQPL
Ga0308404_10323481	3300031878	Hot Spring Phototrophic Mat	GGEAIMALCVRYLHRHPLELTHLPATAIVDLLALAAVEAELLTDAQPL
Ga0308404_10499923	3300031878	Hot Spring Phototrophic Mat	MALCVRYLHRHPLELSHLSATAIVDLLALAAVEAELLADAEPL
Ga0308404_11105481	3300031878	Hot Spring Phototrophic Mat	KALRAGGEAIMALCVRYLHRHPLELSHLPATAIVDLLALAAVEAELLTDAQPL
Ga0308417_10099369	3300031950	Hot Spring Phototrophic Mat	MALCVRYLHRHPLELTHLPATAIVDLLALAAVEAELLADTEPL
Ga0308417_10451702	3300031950	Hot Spring Phototrophic Mat	MALCLRYLHRHPLELSHLPATAIVDLLALAAVEAELLADAHPL
Ga0308417_10697273	3300031950	Hot Spring Phototrophic Mat	MTLCVRYLHRHPLELSHLPATAIVDLLALAAVEAELLADTEPL
Ga0308417_10720373	3300031950	Hot Spring Phototrophic Mat	MTLCVRYLHRHPLELTHLPATAIVDLLAFAAVEAELLADAQPL
Ga0308417_10830952	3300031950	Hot Spring Phototrophic Mat	MTLCVRYLHRHPLELTHLAATAIADLLAIAAVEAELLADAQPL
Ga0308417_11025032	3300031950	Hot Spring Phototrophic Mat	MALCVRYLHRHPLELSHLPATAIVDLLALAAVEAEMLADAEPL
Ga0308417_11110363	3300031950	Hot Spring Phototrophic Mat	VALCLRYLHRHPLELSHLPATAIEDLLALAAVEAELLADAHPL
Ga0308417_11379972	3300031950	Hot Spring Phototrophic Mat	MTLCVRYLHRHPLELTHLPATAIADLLALAAVEAELLADAEPL
Ga0308417_11391232	3300031950	Hot Spring Phototrophic Mat	AGGEAIMTLCVRYLHRHPLELSHLPATAIVDLLALAAVEAELLADAEPL
Ga0308417_11563662	3300031950	Hot Spring Phototrophic Mat	MALCLRYLHRHPLELSHLPATAIADLLALAAVEAELLADAQPL
Ga0308417_12184162	3300031950	Hot Spring Phototrophic Mat	VALCLRYLHRHPLELSHLPATAIADLLALAAVEAELLADAHPL
Ga0308410_10716471	3300031958	Hot Spring Phototrophic Mat	MALCVRYLHRHPLELSHLPATAIVDLLALASVEAELLADAEPL
Ga0308410_10899103	3300031958	Hot Spring Phototrophic Mat	MALCVRYLHRHPLELSHLPATAIVDLLALAAVESELLADAESL
Ga0308407_11193232	3300032034	Hot Spring Phototrophic Mat	MALCVRYLHRHPLELTHLPATAIVDLLALAAVEAELLAD
Ga0308400_10090072	3300032045	Hot Spring Phototrophic Mat	MTLCVRYLHRHPLELSHLPATAIVDLLAIAAVEAELLTDAQPL
Ga0308400_10510632	3300032045	Hot Spring Phototrophic Mat	MALCLRYLHRHPLELTHLPATAIADLLALAAVEAELLTDAQPL
Ga0308400_10574232	3300032045	Hot Spring Phototrophic Mat	MALCLRYLHRHPLELSHLPATAIVDLLALASAEAELLADAQPL
Ga0308400_10653582	3300032045	Hot Spring Phototrophic Mat	MALCVRYLHRHPFELSHLPANAIVDLLALAAVEAELLADAEPL
Ga0308416_10079423	3300032049	Hot Spring Phototrophic Mat	MALCLRYLHRHPLELSHLPATAIVDLLALAAVEAELLADVEPL
Ga0308416_10251752	3300032049	Hot Spring Phototrophic Mat	MTLCVRYLHRHPLELSHLPATAIADLLALAAVEAELLTDAQPL
Ga0308416_10495363	3300032049	Hot Spring Phototrophic Mat	MALCVRYLHRHPLELTHLPATAIVDLLALAAVEAELLADAQ
Ga0308310_10819902	3300032056	Hot Spring Phototrophic Mat	AIMALCLRYLHRHPLELSHLPATAIVDLLALASVEAELLADAEPL
Ga0308419_11063982	3300032058	Hot Spring Phototrophic Mat	MTLCVRYLHRHPLELSHLPATAIVDLLAIAAVEAELLADAQPL
Ga0308414_10610423	3300032356	Hot Spring Phototrophic Mat	MALCVRYLHRHPLELSHLPATAIADLLALAAVEAELLADAEPL
Ga0308413_043331_718_849	3300033886	Hot Spring Phototrophic Mat	MALCVRYLHRHPLELSHLPATAIVDLLALAAVESELLADAEPL
Ga0308413_070318_657_788	3300033886	Hot Spring Phototrophic Mat	MALCVRYLHRHPLELSHLPANAIVDLLALAAVEAELLTDAQPL
Ga0370516_000543_10702_10830	3300034696	Hot Spring Water	MALCVRYLHRHPLELSHLPAAALADLIALANAEADAYAEALP

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F096802

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences