NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F096795

Metagenome / Metatranscriptome Family F096795

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F096795
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 50 residues
Representative Sequence VVLYGHPCYEGVRDRQLRQVFALVLERGFRFVTMQTMAEQLRAVAAGR
Number of Associated Samples 97
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.88 %
% of genes near scaffold ends (potentially truncated) 93.27 %
% of genes from short scaffolds (< 2000 bps) 94.23 %
Associated GOLD sequencing projects 95
AlphaFold2 3D model prediction Yes
3D model pTM-score0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.038 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(17.308 % of family members)
Environment Ontology (ENVO) Unclassified
(21.154 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(35.577 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 39.47%    β-sheet: 5.26%    Coil/Unstructured: 55.26%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF02350Epimerase_2 78.85
PF01370Epimerase 2.88
PF00041fn3 1.92
PF01522Polysacc_deac_1 0.96
PF08241Methyltransf_11 0.96
PF04657DMT_YdcZ 0.96
PF02683DsbD 0.96
PF00986DNA_gyraseB_C 0.96
PF00534Glycos_transf_1 0.96
PF01208URO-D 0.96
PF13537GATase_7 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG0381UDP-N-acetylglucosamine 2-epimeraseCell wall/membrane/envelope biogenesis [M] 78.85
COG0707UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferaseCell wall/membrane/envelope biogenesis [M] 78.85
COG0187DNA gyrase/topoisomerase IV, subunit BReplication, recombination and repair [L] 0.96
COG0407Uroporphyrinogen-III decarboxylase HemECoenzyme transport and metabolism [H] 0.96
COG0726Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 familyCell wall/membrane/envelope biogenesis [M] 0.96
COG3238Uncharacterized membrane protein YdcZ, DUF606 familyFunction unknown [S] 0.96

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.04 %
UnclassifiedrootN/A0.96 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2140918013|NODE_3730_length_2030_cov_8.219212All Organisms → cellular organisms → Bacteria2062Open in IMG/M
3300003861|Ga0031654_10043604All Organisms → cellular organisms → Bacteria → Proteobacteria1270Open in IMG/M
3300003998|Ga0055472_10001889All Organisms → cellular organisms → Bacteria3144Open in IMG/M
3300004052|Ga0055490_10087911All Organisms → cellular organisms → Bacteria862Open in IMG/M
3300004114|Ga0062593_102418514All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300004114|Ga0062593_103234776All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300004479|Ga0062595_102549660All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300004643|Ga0062591_100824121All Organisms → cellular organisms → Bacteria859Open in IMG/M
3300004808|Ga0062381_10216944All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300005457|Ga0070662_101029476All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300005458|Ga0070681_11657984All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300005547|Ga0070693_100558153All Organisms → cellular organisms → Bacteria821Open in IMG/M
3300005562|Ga0058697_10176694All Organisms → cellular organisms → Bacteria951Open in IMG/M
3300005578|Ga0068854_101466081All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300005842|Ga0068858_101733425All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300005874|Ga0075288_1030552All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300005896|Ga0075282_1035704All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300005985|Ga0081539_10318625All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300005995|Ga0066790_10505602All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium516Open in IMG/M
3300006854|Ga0075425_100422674All Organisms → cellular organisms → Bacteria1535Open in IMG/M
3300006894|Ga0079215_11494109All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300007004|Ga0079218_10718881All Organisms → cellular organisms → Bacteria941Open in IMG/M
3300009098|Ga0105245_12943748All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300009176|Ga0105242_13129486All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300009789|Ga0126307_10248511All Organisms → cellular organisms → Bacteria1430Open in IMG/M
3300009811|Ga0105084_1118215All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300010042|Ga0126314_10964724All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300010044|Ga0126310_11148335All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300010044|Ga0126310_11428224All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300010045|Ga0126311_10214571All Organisms → cellular organisms → Bacteria1410Open in IMG/M
3300010166|Ga0126306_10312587All Organisms → cellular organisms → Bacteria1212Open in IMG/M
3300010397|Ga0134124_10708853All Organisms → cellular organisms → Bacteria997Open in IMG/M
3300010400|Ga0134122_12675575All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300010999|Ga0138505_100050850All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300012043|Ga0136631_10002101All Organisms → cellular organisms → Bacteria6466Open in IMG/M
3300012212|Ga0150985_105262172All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300012349|Ga0137387_11186163All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300012356|Ga0137371_10940858All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300012360|Ga0137375_10722589All Organisms → cellular organisms → Bacteria811Open in IMG/M
3300012469|Ga0150984_113496564All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium714Open in IMG/M
3300012529|Ga0136630_1150057All Organisms → cellular organisms → Bacteria847Open in IMG/M
3300012684|Ga0136614_10985929All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300012916|Ga0157310_10574941All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300012941|Ga0162652_100101748All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300012986|Ga0164304_11874165All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300012989|Ga0164305_10324674All Organisms → cellular organisms → Bacteria1148Open in IMG/M
3300013100|Ga0157373_10518643All Organisms → cellular organisms → Bacteria → Proteobacteria862Open in IMG/M
3300015373|Ga0132257_103863219All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300015374|Ga0132255_103481515All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300018000|Ga0184604_10178992All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300018027|Ga0184605_10121533All Organisms → cellular organisms → Bacteria1163Open in IMG/M
3300018027|Ga0184605_10546945All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300018032|Ga0187788_10455643All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300018054|Ga0184621_10126730All Organisms → cellular organisms → Bacteria914Open in IMG/M
3300018076|Ga0184609_10347171All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300018082|Ga0184639_10614937All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300018422|Ga0190265_10110452All Organisms → cellular organisms → Bacteria2601Open in IMG/M
3300018465|Ga0190269_11495962All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300019362|Ga0173479_10038669All Organisms → cellular organisms → Bacteria1497Open in IMG/M
3300019377|Ga0190264_12263038All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300019767|Ga0190267_11076328All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300021073|Ga0210378_10252536All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300021168|Ga0210406_10242934All Organisms → cellular organisms → Bacteria → Proteobacteria1480Open in IMG/M
3300022694|Ga0222623_10109987All Organisms → cellular organisms → Bacteria1073Open in IMG/M
3300025796|Ga0210113_1110230All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria541Open in IMG/M
3300025937|Ga0207669_11967186All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300026095|Ga0207676_10529994All Organisms → cellular organisms → Bacteria1122Open in IMG/M
3300027526|Ga0209968_1021981All Organisms → cellular organisms → Bacteria1038Open in IMG/M
3300027787|Ga0209074_10090964All Organisms → cellular organisms → Bacteria1015Open in IMG/M
3300027843|Ga0209798_10194728All Organisms → cellular organisms → Bacteria1001Open in IMG/M
3300027902|Ga0209048_10547042All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium777Open in IMG/M
3300027905|Ga0209415_10509527All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi924Open in IMG/M
3300028587|Ga0247828_10280215All Organisms → cellular organisms → Bacteria910Open in IMG/M
3300028771|Ga0307320_10378434All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300028784|Ga0307282_10514052All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300028807|Ga0307305_10357657All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300028824|Ga0307310_10040310All Organisms → cellular organisms → Bacteria1916Open in IMG/M
3300028828|Ga0307312_11133547All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300029990|Ga0311336_11965559All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium518Open in IMG/M
3300030620|Ga0302046_10534113All Organisms → cellular organisms → Bacteria958Open in IMG/M
3300030620|Ga0302046_11105724All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300031098|Ga0308191_1029530All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300031548|Ga0307408_101332789All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300031740|Ga0307468_102450047All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300031824|Ga0307413_11068325All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300031824|Ga0307413_11429049All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300031892|Ga0310893_10296458All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300031902|Ga0302322_102417811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi647Open in IMG/M
3300031903|Ga0307407_11000462All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300031903|Ga0307407_11139253All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300031913|Ga0310891_10369528All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300031940|Ga0310901_10159040All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300031995|Ga0307409_100006580All Organisms → cellular organisms → Bacteria → Proteobacteria6850Open in IMG/M
3300031995|Ga0307409_101351860All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300032003|Ga0310897_10434375All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300032005|Ga0307411_10405557All Organisms → cellular organisms → Bacteria1128Open in IMG/M
3300032013|Ga0310906_10537956All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300032126|Ga0307415_100913563All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300032159|Ga0268251_10143496All Organisms → cellular organisms → Bacteria894Open in IMG/M
3300032180|Ga0307471_102611139All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300032211|Ga0310896_10201033All Organisms → cellular organisms → Bacteria981Open in IMG/M
3300032421|Ga0310812_10146846All Organisms → cellular organisms → Bacteria1000Open in IMG/M
3300033551|Ga0247830_11151294All Organisms → cellular organisms → Bacteria619Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil17.31%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere8.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil7.69%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment5.77%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil5.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.85%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand2.88%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.88%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.88%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.88%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment1.92%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment1.92%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.92%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.92%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.92%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.92%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil1.92%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.92%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave1.92%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.96%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.96%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.96%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.96%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.96%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.96%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.96%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.96%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.96%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.96%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.96%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.96%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2140918013Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies)EnvironmentalOpen in IMG/M
3300003861Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CREnvironmentalOpen in IMG/M
3300003998Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2EnvironmentalOpen in IMG/M
3300004052Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300004808Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1FreshEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005562Agave microbial communities from Guanajuato, Mexico - As.Ma.eHost-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005874Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404EnvironmentalOpen in IMG/M
3300005896Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204EnvironmentalOpen in IMG/M
3300005985Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009811Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010999Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015EnvironmentalOpen in IMG/M
3300012043Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06)EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012529Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ568 (21.06)EnvironmentalOpen in IMG/M
3300012684Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06)EnvironmentalOpen in IMG/M
3300012916Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2EnvironmentalOpen in IMG/M
3300012941Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300025796Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027526Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027843Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027902Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300029990I_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300030620Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111EnvironmentalOpen in IMG/M
3300031098Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_186 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031913Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4EnvironmentalOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032159Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2)Host-AssociatedOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Iowa-Corn-GraphCirc_027229302140918013SoilVLYGHPCYEGVRDRLLRQVFATVLERGFRFVTMLTMAEQLRAVATAR
Ga0031654_1004360413300003861Freshwater Lake SedimentRRLDGERWVVLYGHPCYEGVNDGVLRRVFRTVLERGFRFVTHQQMVEQLH*
Ga0055472_1000188913300003998Natural And Restored WetlandsLEERSLVVLYGHPCYEGVREQVLRKVFARVLEHGFHFVTMQALAARLEARVPVR*
Ga0055490_1008791123300004052Natural And Restored WetlandsHPCYEGVREAILRKVFAAALEHGFRFVTMQHLAERLQAGAPAR*
Ga0062593_10241851423300004114SoilLYGHPCYEGVREGVLRQVFARVVERGFRFVTMQTLAERLQAAHAAR*
Ga0062593_10323477623300004114SoilESVVLYGHPCYEGVRDRVLRQVFATVLERGFRFVTMLTMAEQLRAVPTAR*
Ga0062595_10254966013300004479SoilRDWVVLYGHPCYEGVRDRLLRQVFAVVLERGYRFVTMHTMAEQLRTVAAGR*
Ga0062591_10082412113300004643SoilEHLETRDEVILYGHPCYEGVREGVLRQVFARVVERGFRFVTMQTLAERLQAAHAAR*
Ga0062381_1021694413300004808Wetland SedimentLDERDSVVLYGHPCYEGVRDRLLRQVFATVVERGFRFVTLQTMAEQLRMVAAGR*
Ga0070662_10102947623300005457Corn RhizosphereVVLYGHPCYEGVREQVLRKVFARVLEHGFHFVTMQALAARLETRVPVR*
Ga0070681_1165798413300005458Corn RhizosphereDWVVLYGHPCYEGVHDRLLRRVFTTVRERGFEFVTMEQMARQLEASTALL*
Ga0070693_10055815313300005547Corn, Switchgrass And Miscanthus RhizosphereEQHLDERDWVVLYGHPCYEGVRDRLLRQVFAVVLERGYRFVTMHTMAEQLRTVAAGR*
Ga0058697_1017669423300005562AgaveLYGHPCYEGVREGVLRKVFARVVEHGFRFVTLQHLAERLRAAHVVR*
Ga0068854_10146608123300005578Corn RhizosphereQLEQHLDERDWVVLYGHPCYEGVRDRLLRQVFAVVLERGYRFVTMHTMAEQLRTVAAGR*
Ga0068858_10173342513300005842Switchgrass RhizosphereLEQHLDERDWVVLYGHPCYEGVRDRLLRQVFAVVLERGYRFVTMHTMAEQLRTVAAGR*
Ga0075288_103055223300005874Rice Paddy SoilSVVLYGHPCYEGVRDGLLRRVFAAVLERGFRFVTLQTMAEQLRTVPLAQ*
Ga0075282_103570413300005896Rice Paddy SoilDEHLDTHDEVVLYGHPCYEGVREGVLRQIFARVVERGFRFVTMQTLAERLQAATPAR*
Ga0081539_1031862523300005985Tabebuia Heterophylla RhizosphereDEHLEAHDQVVLYGHPCYEGVREAVLRQVFARAVEHGFRFVTMQTLAERLQAAHAGR*
Ga0066790_1050560213300005995SoilDGERWVVLYGHPCYEGVNDGVLRRVFRTVLERGFRFVTHQQMVEQLG*
Ga0075425_10042267433300006854Populus RhizosphereHPSYEGVRESLLRRVFATVVEQGFRFVTMQAIAERLQAAAATR*
Ga0079215_1149410913300006894Agricultural SoilYEGVREQILRKVFARIIERGFRFVTMQAVAARLQAGAPVR*
Ga0079218_1071888113300007004Agricultural SoilPCYEGVREQVLRKVFARVLERGFRFVTMHALAARLGSGAPAR*
Ga0105245_1294374813300009098Miscanthus RhizosphereDQVILYGHPCYEGVRESVLRKVFGAVLERGYRFVTMQTIARRLQSGALV*
Ga0105242_1312948623300009176Miscanthus RhizosphereGVLRQVFARVVEHGFRFVTMQTLAERLQAAHAAR*
Ga0126307_1024851133300009789Serpentine SoilVVLYGHPCYEGVRDRQLRQVFALVLERGFRFVTMQTMAEQLRAVAAGR*
Ga0105084_111821523300009811Groundwater SandLVVLYGHPCYEGVREQILRKVFARVVEHGFRFVTMQAVAARLQAGAPVR*
Ga0126314_1096472413300010042Serpentine SoilHLDERDWVVLYGHPCYEGVRDRLLRQVFAVVLERGYRFVTMHTMAEQLRTVAAGR*
Ga0126310_1114833513300010044Serpentine SoilPCYEGVREAVLRKVFARVVERGFRFVTMQTMAERLQAAAATQ*
Ga0126310_1142822413300010044Serpentine SoilVVLYGHPCYEGVRDHVLRRVFATVVERGFRFVTMQTMAEQLRTVPLGR*
Ga0126311_1021457113300010045Serpentine SoilCYEGVRDRLLRQVFAVVLERGYRFVTMHTMAEQLRTVAAGP*
Ga0126306_1031258713300010166Serpentine SoilLDEHLDAHDEVILYGHPCYEGVREAVLRKVFARVVERGFRFVTMQTMAERLQAAAPTR*
Ga0134124_1070885323300010397Terrestrial SoilVREGVLRQVFARVVEHGFRFVTMQTLAERLQAAYAAR*
Ga0134122_1267557513300010400Terrestrial SoilAHDEVILYGHPCYEGVREAVLRKVFARVVERGFRFVTMQTMAERLQAAAATR*
Ga0138505_10005085023300010999SoilVLRLLGRHLDEHESVVLYGHPCYEGVRDRLLRQVFATVVERGFRFVTMLTMAEQLRTVATAR*
Ga0136631_1000210113300012043Polar Desert SandFRQLNQHLDENESVILYGHPCYEGVRDRILRQVFATVLERGFRFVTMQTLAERLGAVSPTR*
Ga0150985_10526217213300012212Avena Fatua RhizosphereGHPCYEGVRDRLLRQVFATVLERGFRFVTMLTIAEQLRAVATAQ*
Ga0137387_1118616313300012349Vadose Zone SoilLYGHPCYEGVREGLLRKVFARVVERGFRFVTMQTLAERLQAAALAR*
Ga0137371_1094085813300012356Vadose Zone SoilHLDANDLVIHYGHPSYEGVREAILRKVFATVMERGFRFVTMQALAERLQAAVPAR*
Ga0137375_1072258913300012360Vadose Zone SoilEVMRQLGEHLDSNDLVILYGHPSYEGVRDAILRRVFATVMERGFRFVTMQALAERLQAAVPAR*
Ga0150984_11349656413300012469Avena Fatua RhizosphereVREGVLRKVFARVVEHGFRFATLQTMAERLQAAAPSR*
Ga0136630_115005713300012529Polar Desert SandRQLNQHLDEHESVVFYGHPCYEGVRDRILRRVFATVVERGFRFVTMQTLAERLGAVSPTR
Ga0136614_1098592923300012684Polar Desert SandVVLYGHPCYEGVREGILRKVFATALEHGFRFVTMQTVAERLRSAAPVR*
Ga0157310_1057494113300012916SoilQHLDERDWVVLYGHPCYEGVRDRLLRQVFAVVLERGYRFVTMHTMAEQLRTVAAGR*
Ga0162652_10010174813300012941SoilPCYEGVRDRLLRQVFATVVERGFRFVTMLTMAEQLRTVATAR*
Ga0164304_1187416513300012986SoilYGHPCYEGVREGVLRQVFARVVEHGFRFVTMQTLAERLQAAHAAR*
Ga0164305_1032467413300012989SoilLYGHPCYEGVRDRILRQIFATVVERGFRFVTMQTMAEQLRTVTAAQ*
Ga0157373_1051864323300013100Corn RhizosphereVRQLEQHLEKRDWVVLYGHPCYEGVRDRLLRQVFAVVLERGYRFVTMHTMAEQLRTVAAGR*
Ga0132257_10386321913300015373Arabidopsis RhizosphereLGEHESVVLYGHPCYEGVRDRVLRQVFATVLERGFRFVTMLTMAEQLRAVPTAR*
Ga0132255_10348151513300015374Arabidopsis RhizosphereGHPCYGGVRARLLRQVFAVVLERGYRFVTMHTMAEQLRTVAAGR*
Ga0184604_1017899213300018000Groundwater SedimentVVLYGHPCYEGVRDNVLRQVFANVVERGFRFVTLQTMAEQLRTVPLGR
Ga0184605_1012153313300018027Groundwater SedimentRQLNQHLDEHDTVVLYGHPCYEGVRDNVLRQVFATVLERGFLFVTMQTMAEQLRTVALER
Ga0184605_1054694513300018027Groundwater SedimentEVLRLLGEHLDSHDLVILYGHPSYEGVRDAILRKVFATVIERGFRFVTMQSLAERFQAAVPAR
Ga0187788_1045564313300018032Tropical PeatlandHLESRDHVVLYGHPCYEGVREGILRQVFARVVERGYRFVTMQTLAERLQAVHAAR
Ga0184621_1012673023300018054Groundwater SedimentPCYEGVRDKLLRQVFATVVERGFRFVTLQTMAEQLRTVALER
Ga0184609_1034717113300018076Groundwater SedimentESRDLVVLYGHPCYEGVREQILRKVFARVVERGFRFVTMQVVAARLQAGAPVR
Ga0184639_1061493723300018082Groundwater SedimentLDLHLEANDHVVLYGHPCYEGVHEATLRKVFAMAVERGFRFVTMQTLAERLQAALPAQ
Ga0190265_1011045243300018422SoilLRQLNEHLDEHESVILYGHPCYEGVRDRILRQVFATVLERGFRFVTMQTLAERLGTVTSR
Ga0190269_1149596233300018465SoilEVILYGHPCYEGVREAVLRKVFARVVERGFRFVTMQTMAERLQAAAATR
Ga0173479_1003866923300019362SoilVVLYGHPCYEGVRDRLLRQVFAVVLERGYRFVTMHTMAEQLRTVAAGR
Ga0190264_1226303813300019377SoilHDEVILYGHPCYEGVREAVLRKVFARVVERGFRFVTMQTMAERLQAAAATR
Ga0190267_1107632813300019767SoilSVVLYGHPCYEGVRDRQLRQVFAVVLERGFRFVTMQTMAEQLRTVAAGR
Ga0210378_1025253613300021073Groundwater SedimentPEVFRQLSQHLDEHESVVLYGHPCYEGVRDRILRQVFATVLERGFRFVTMQTLAERLGAVALRQ
Ga0210406_1024293423300021168SoilLDGEHWVVLYGHPCYEGVNDGMLRRVFRTVLERGFRFVTHQQMVEQLH
Ga0222623_1010998723300022694Groundwater SedimentNQHLDEHDTVVLYGHPCYEGVRDNVLRQVFATVVERGFRFVTMQTMAEQLRAVALER
Ga0210113_111023023300025796Natural And Restored WetlandsLYGHPCYEGVREQVLRKVFARVLEHGFHFVTMQALAARLEARVPVR
Ga0207669_1196718613300025937Miscanthus RhizosphereDWVVLSGHPCYEGVRDRLLRQVFAVVLERGYRFVTMHTMAEQLRTVAAGR
Ga0207676_1052999413300026095Switchgrass RhizosphereAHDEVILYGHPCYEGVREAVLRKVFARVVERGFRFVTMQTMAERLQAAAATR
Ga0209968_102198113300027526Arabidopsis Thaliana RhizosphereRDQVILYGHPCYEGVREGVLRKVFGAVLERGYRFVTMQTIARRLQSGALV
Ga0209074_1009096413300027787Agricultural SoilEGVREAVLRQVFARVVEHGFRFVTMQTLAERLQVAHATR
Ga0209798_1019472823300027843Wetland SedimentLVVPYGHPCYEGVHDAMLRKVFAAVLEHGFRFVTMQTLAERLESGALAR
Ga0209048_1054704223300027902Freshwater Lake SedimentVVLYGHPCYEGVNDGILRQVFRTVLERGFRFVTHQEMVELLH
Ga0209415_1050952723300027905Peatlands SoilRLDGQDWVVLYGHPCYEGVNDALLRRVFRTVVDRGFHFVTHQQMAERLG
Ga0247828_1028021513300028587SoilQVILYGHPCYEGVRESVLRKVFGAVLERGYRFVTMQTIARRLQSGALV
Ga0307320_1037843413300028771SoilHPCYEGVRDNVLRQVFATVVERGFRFVTMQTMAEQLRAVALER
Ga0307282_1051405213300028784SoilRQLNQHLDEHDTVVLYGHPCYEGVRDNVLRQVFATVVERGFRFVTMQTMAEQLRTVALER
Ga0307305_1035765723300028807SoilGEHLDANDVVILYGHPSYEGVRDAILRKVFATVMERGFRFVTMQALAERLQAAVPAR
Ga0307310_1004031013300028824SoilGHPCYEGVRDNVLRQVFATVLERGFRFVTMQTMAEQLRAVALER
Ga0307312_1113354713300028828SoilDVVILYGHPSYEGVRDAILRKVFATVMERGFRFVTMQALAERLQAAVPAR
Ga0307308_1008487133300028884SoilEGVRDNVLRQVFANVVERGFRFVTLQTMAEQLRTVPLGR
Ga0311336_1196555923300029990FenDLNRQLDGNDWVVLYGHPCYEGVEHDMLRDVFRTVLQRGFQFVTHQQMAERLSEAA
Ga0302046_1053411323300030620SoilGHPCYEGVRDRMLRQVFATVLERGFRFVTMQTLAERLRAIALAR
Ga0302046_1110572413300030620SoilEVLRQLGQHLDEHESVVLYGHPCYEGVRDRLLRQVFATVVERGFRFVTMHTMAEQLRAVAAGR
Ga0308191_102953023300031098SoilGHPCYEGVRDNVLRQVFATVVERGFRFVTMQTMAEQLRTVALER
Ga0307408_10133278923300031548RhizosphereLDTHDSVILYGHPCYEGVRDRILRQVFATVLERGFRFVTMQTMAERLRAVALER
Ga0307468_10245004713300031740Hardwood Forest SoilVVLYGHPCYEGVRDRLLRQVFATVVERGFRFVTLQTMAEQRRMVAAGR
Ga0307413_1106832523300031824RhizosphereEPEVMQQLNDHLDTHDSVILYGHPCYEGVRDRILRGVFATVLERGFRFVTMQTMAERLRSVALER
Ga0307413_1142904913300031824RhizosphereCYEGVREALLRKVFARVVEHGFRFVTLQTMAERLQAATSAR
Ga0310893_1029645823300031892SoilEERDWVVLYGHPCYEGVRDRLLRQVFAVVLERGYRFVTMHTMAEQLRTVAAGR
Ga0302322_10241781123300031902FenSWVVLYGHPCYEGVNDGILRAVFRAVADRGYRFVTHQQMAERLAVAA
Ga0307407_1100046213300031903RhizosphereLNDHLDTHDSVILYGHPCYEGVRDRILRQVFATVLERGFRFVTMQTMAERLRAVALER
Ga0307407_1113925313300031903RhizosphereILYGHPCYEGVRDRILRGVFATVLERGFRFVTMQTMAERLRSVALER
Ga0310891_1036952813300031913SoilGHPCYEGVREAVLRKVFARVVERDFRFVTLQTMAERLQAAASTR
Ga0310901_1015904013300031940SoilVLYGHPCYEGVRDRLLRQVFAVVLERGYRFVTMHTMAEQLRTVAAGR
Ga0307409_10000658013300031995RhizosphereILYGHPCYEGVRDSVLRKVFARVLERDFRFVTMQTMAERLRAPAPTR
Ga0307409_10135186013300031995RhizosphereNDHLDTHDSVILYGHPCYEGVRDRILRQVFATVLERGFRFVTMQTMAERLRVVALER
Ga0310897_1043437523300032003SoilEVMRQLDEHLESHDEVVLYGHPCYEGVREGVLRQVFARVVEHGFRFVTMQTLAERLQAAHAAR
Ga0307411_1040555723300032005RhizosphereEVMQQLTEHLDTHDSVILYGHPCYEGVRDRILRQVFATVLEQGFRFVTMQTMAERLRAVALER
Ga0310906_1053795623300032013SoilQLEQHLEERDWVVLYGHPCYEGVRDRLLRQVFAVVLERGYRFVTMHTMAEQLRTVAAGR
Ga0307415_10091356323300032126RhizosphereVILYGHPCYEGVRDRILRQVFATVLEQGFRFVTMQTMAERLRAVALER
Ga0268251_1014349613300032159AgaveAHDQVVLYGHPCYEGVREGVLRKVFARVVEHGFRFVTLQHLAERLRAAHVVR
Ga0307471_10261113913300032180Hardwood Forest SoilLYGHPCYEGVREAVLRKVFARVVERGFRFVTMQTMAERLQAAAATR
Ga0310896_1020103323300032211SoilERDWVVLYGHPCYEGVRDRLLRQVFAVVLERGYRFVTMHTMAEQLRTVAAGR
Ga0310812_1014684613300032421SoilPCYEGVREGVLRQVFARVVEHGFRFVTMQTLAERLQAAYAAR
Ga0247830_1115129423300033551SoilRSLVVLYGHPCYEGVREQVLRKVFARVLEHGFHFVTMQALAARLETRVPVR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.