| Basic Information | |
|---|---|
| Family ID | F096792 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MWAMSSASAPASATGLADGQRDAVIHTEDLTKIYPGTDFAAVDRLN |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 38.46 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 92.31 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.18 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (76.923 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (35.577 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.692 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.038 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 13.51% β-sheet: 0.00% Coil/Unstructured: 86.49% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF03807 | F420_oxidored | 5.77 |
| PF00440 | TetR_N | 4.81 |
| PF02687 | FtsX | 4.81 |
| PF00196 | GerE | 3.85 |
| PF01734 | Patatin | 3.85 |
| PF13556 | HTH_30 | 3.85 |
| PF00106 | adh_short | 2.88 |
| PF12680 | SnoaL_2 | 2.88 |
| PF03448 | MgtE_N | 2.88 |
| PF00067 | p450 | 2.88 |
| PF00912 | Transgly | 1.92 |
| PF00561 | Abhydrolase_1 | 1.92 |
| PF00005 | ABC_tran | 1.92 |
| PF03061 | 4HBT | 0.96 |
| PF10417 | 1-cysPrx_C | 0.96 |
| PF00165 | HTH_AraC | 0.96 |
| PF07690 | MFS_1 | 0.96 |
| PF08241 | Methyltransf_11 | 0.96 |
| PF06197 | DUF998 | 0.96 |
| PF11716 | MDMPI_N | 0.96 |
| PF04679 | DNA_ligase_A_C | 0.96 |
| PF13520 | AA_permease_2 | 0.96 |
| PF01022 | HTH_5 | 0.96 |
| PF02190 | LON_substr_bdg | 0.96 |
| PF01471 | PG_binding_1 | 0.96 |
| PF02801 | Ketoacyl-synt_C | 0.96 |
| PF00903 | Glyoxalase | 0.96 |
| PF00415 | RCC1 | 0.96 |
| PF13191 | AAA_16 | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 3.85 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 3.85 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 3.85 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 2.88 |
| COG2239 | Mg/Co/Ni transporter MgtE (contains CBS domain) | Inorganic ion transport and metabolism [P] | 2.88 |
| COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.92 |
| COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 1.92 |
| COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 1.92 |
| COG5184 | Alpha-tubulin suppressor ATS1 and related RCC1 domain-containing proteins | Cell cycle control, cell division, chromosome partitioning [D] | 1.92 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.96 |
| COG3371 | Uncharacterized membrane protein | Function unknown [S] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.88 % |
| Unclassified | root | N/A | 22.12 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004092|Ga0062389_102854541 | Not Available | 645 | Open in IMG/M |
| 3300005332|Ga0066388_108459441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 512 | Open in IMG/M |
| 3300005434|Ga0070709_10087213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2050 | Open in IMG/M |
| 3300005546|Ga0070696_100421606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1048 | Open in IMG/M |
| 3300005549|Ga0070704_101319024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 661 | Open in IMG/M |
| 3300005602|Ga0070762_10409714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 875 | Open in IMG/M |
| 3300005617|Ga0068859_101708601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 695 | Open in IMG/M |
| 3300006047|Ga0075024_100864807 | Not Available | 511 | Open in IMG/M |
| 3300006162|Ga0075030_101537611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 521 | Open in IMG/M |
| 3300006854|Ga0075425_100782970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1093 | Open in IMG/M |
| 3300010048|Ga0126373_12338645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 595 | Open in IMG/M |
| 3300010333|Ga0134080_10409627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 629 | Open in IMG/M |
| 3300010343|Ga0074044_10950067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 563 | Open in IMG/M |
| 3300010360|Ga0126372_10200200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1662 | Open in IMG/M |
| 3300010360|Ga0126372_10561865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1086 | Open in IMG/M |
| 3300010361|Ga0126378_12296991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 616 | Open in IMG/M |
| 3300010361|Ga0126378_13165361 | Not Available | 524 | Open in IMG/M |
| 3300010379|Ga0136449_103066908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 650 | Open in IMG/M |
| 3300010396|Ga0134126_10663646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1188 | Open in IMG/M |
| 3300010401|Ga0134121_10536131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1084 | Open in IMG/M |
| 3300010401|Ga0134121_10967342 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300010876|Ga0126361_10953882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 688 | Open in IMG/M |
| 3300012208|Ga0137376_10614587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinocatenispora → Actinocatenispora sera | 940 | Open in IMG/M |
| 3300012971|Ga0126369_10482545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1294 | Open in IMG/M |
| 3300014489|Ga0182018_10532624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 620 | Open in IMG/M |
| 3300016357|Ga0182032_11763905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 540 | Open in IMG/M |
| 3300017928|Ga0187806_1301594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 565 | Open in IMG/M |
| 3300017946|Ga0187879_10830119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 516 | Open in IMG/M |
| 3300017955|Ga0187817_11086021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 513 | Open in IMG/M |
| 3300017961|Ga0187778_10736371 | Not Available | 669 | Open in IMG/M |
| 3300017966|Ga0187776_10346530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 979 | Open in IMG/M |
| 3300017974|Ga0187777_10373757 | Not Available | 983 | Open in IMG/M |
| 3300018001|Ga0187815_10231566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 782 | Open in IMG/M |
| 3300018007|Ga0187805_10524345 | Not Available | 556 | Open in IMG/M |
| 3300018047|Ga0187859_10824535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 533 | Open in IMG/M |
| 3300018058|Ga0187766_10089824 | All Organisms → cellular organisms → Archaea | 1850 | Open in IMG/M |
| 3300018058|Ga0187766_11418620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kibdelosporangium → Kibdelosporangium aridum | 510 | Open in IMG/M |
| 3300018085|Ga0187772_10982092 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 616 | Open in IMG/M |
| 3300018431|Ga0066655_10260585 | Not Available | 1112 | Open in IMG/M |
| 3300020581|Ga0210399_10833602 | Not Available | 751 | Open in IMG/M |
| 3300020581|Ga0210399_11576080 | Not Available | 507 | Open in IMG/M |
| 3300021181|Ga0210388_10077879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2808 | Open in IMG/M |
| 3300021384|Ga0213876_10116999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1415 | Open in IMG/M |
| 3300021402|Ga0210385_10022226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4032 | Open in IMG/M |
| 3300021402|Ga0210385_10726808 | Not Available | 760 | Open in IMG/M |
| 3300021403|Ga0210397_11287795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 568 | Open in IMG/M |
| 3300021406|Ga0210386_10332114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1306 | Open in IMG/M |
| 3300021433|Ga0210391_10900489 | Not Available | 690 | Open in IMG/M |
| 3300024181|Ga0247693_1058809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 564 | Open in IMG/M |
| 3300025627|Ga0208220_1050102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1227 | Open in IMG/M |
| 3300025906|Ga0207699_10074465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2086 | Open in IMG/M |
| 3300025927|Ga0207687_11612220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 557 | Open in IMG/M |
| 3300027783|Ga0209448_10062957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1248 | Open in IMG/M |
| 3300027812|Ga0209656_10063488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2035 | Open in IMG/M |
| 3300028742|Ga0302220_10366382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 519 | Open in IMG/M |
| 3300028775|Ga0302231_10439395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 550 | Open in IMG/M |
| 3300028781|Ga0302223_10030838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1903 | Open in IMG/M |
| 3300028789|Ga0302232_10243977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 891 | Open in IMG/M |
| 3300028877|Ga0302235_10491194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 522 | Open in IMG/M |
| 3300029999|Ga0311339_11430556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 619 | Open in IMG/M |
| 3300030007|Ga0311338_11473367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 629 | Open in IMG/M |
| 3300030494|Ga0310037_10264164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 743 | Open in IMG/M |
| 3300030503|Ga0311370_11466744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 716 | Open in IMG/M |
| 3300031236|Ga0302324_102645654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 608 | Open in IMG/M |
| 3300031544|Ga0318534_10279628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 962 | Open in IMG/M |
| 3300031544|Ga0318534_10409705 | Not Available | 778 | Open in IMG/M |
| 3300031545|Ga0318541_10326993 | Not Available | 856 | Open in IMG/M |
| 3300031549|Ga0318571_10094400 | Not Available | 970 | Open in IMG/M |
| 3300031564|Ga0318573_10334434 | Not Available | 812 | Open in IMG/M |
| 3300031679|Ga0318561_10057373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1965 | Open in IMG/M |
| 3300031708|Ga0310686_103650617 | Not Available | 1325 | Open in IMG/M |
| 3300031708|Ga0310686_119648438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1078 | Open in IMG/M |
| 3300031713|Ga0318496_10483578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 685 | Open in IMG/M |
| 3300031747|Ga0318502_10079172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1788 | Open in IMG/M |
| 3300031777|Ga0318543_10383435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 630 | Open in IMG/M |
| 3300031796|Ga0318576_10414345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 637 | Open in IMG/M |
| 3300031805|Ga0318497_10171856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1192 | Open in IMG/M |
| 3300031835|Ga0318517_10327472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 692 | Open in IMG/M |
| 3300031835|Ga0318517_10583164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 503 | Open in IMG/M |
| 3300031860|Ga0318495_10212899 | Not Available | 869 | Open in IMG/M |
| 3300031880|Ga0318544_10317307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300031896|Ga0318551_10044605 | Not Available | 2214 | Open in IMG/M |
| 3300031897|Ga0318520_10509712 | Not Available | 743 | Open in IMG/M |
| 3300031910|Ga0306923_10258129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1994 | Open in IMG/M |
| 3300031910|Ga0306923_11287233 | Not Available | 776 | Open in IMG/M |
| 3300031912|Ga0306921_12715285 | Not Available | 509 | Open in IMG/M |
| 3300031942|Ga0310916_10626888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 913 | Open in IMG/M |
| 3300031945|Ga0310913_10181004 | All Organisms → cellular organisms → Bacteria | 1468 | Open in IMG/M |
| 3300031946|Ga0310910_10422399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1057 | Open in IMG/M |
| 3300031954|Ga0306926_11946209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 663 | Open in IMG/M |
| 3300032001|Ga0306922_10244643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1927 | Open in IMG/M |
| 3300032008|Ga0318562_10026172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. Iso899 | 3074 | Open in IMG/M |
| 3300032009|Ga0318563_10052880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2085 | Open in IMG/M |
| 3300032041|Ga0318549_10292361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 734 | Open in IMG/M |
| 3300032054|Ga0318570_10046543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1786 | Open in IMG/M |
| 3300032055|Ga0318575_10054349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1846 | Open in IMG/M |
| 3300032065|Ga0318513_10335497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 736 | Open in IMG/M |
| 3300032065|Ga0318513_10454270 | Not Available | 626 | Open in IMG/M |
| 3300032067|Ga0318524_10158856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1146 | Open in IMG/M |
| 3300032160|Ga0311301_11845444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 716 | Open in IMG/M |
| 3300032805|Ga0335078_10382471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1855 | Open in IMG/M |
| 3300032805|Ga0335078_11281151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 838 | Open in IMG/M |
| 3300032805|Ga0335078_12644069 | Not Available | 513 | Open in IMG/M |
| 3300032828|Ga0335080_10522179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1258 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 35.58% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 8.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.77% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.77% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.85% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.88% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.88% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.88% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.92% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.92% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.96% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.96% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.96% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.96% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300024181 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34 | Environmental | Open in IMG/M |
| 3300025627 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028742 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300028781 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062389_1028545412 | 3300004092 | Bog Forest Soil | MSSVPAPVSAIDRPDGHTDAVIHTEDLTKVYPGADFAAVDHLNLDVR |
| Ga0066388_1084594412 | 3300005332 | Tropical Forest Soil | MWAMSSAPASASAAGKADGQRDAVIHTEDLTKVYQGTDFAAVD |
| Ga0070709_100872133 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MGTAEAQASAAGQADGEPGAVIHTEDLTKVYPGTDFAAVDRLNLDV |
| Ga0070696_1004216063 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MWAMSSASAPASATGLADGQRDAVIHTEDLTKIYPGTDFAAVDRLN |
| Ga0070704_1013190242 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MWAMSSASAPASATGLADGQRDAVIHTEDLTKIYPGTDFAAVDRLNL |
| Ga0070762_104097141 | 3300005602 | Soil | MWPMSTADAPAGAAGTRDADRDAVIHTEDLTKVYPGTD |
| Ga0068859_1017086013 | 3300005617 | Switchgrass Rhizosphere | MWAMSSASAPASATGLADGQRDAVIHTEDLTKIYPGTDFAAVDRLNLDV |
| Ga0075024_1008648072 | 3300006047 | Watersheds | MCAMSTADAPAGAAGIRDADRDAVIHTEDLTKVYPGTDFAAVDRLNLDV |
| Ga0075030_1015376111 | 3300006162 | Watersheds | MSAAQAPASPVSSASGLAGRGPDAVIHTEDLTKVY |
| Ga0075425_1007829701 | 3300006854 | Populus Rhizosphere | MWAMSSASAPASATGLANGQRDAVIHTEDLTKIYPGTD |
| Ga0126373_123386452 | 3300010048 | Tropical Forest Soil | MWAMSSASAPAGATGLADGQRDAVIHTEDLTKIYAGTDFAAVDRLNLDVE |
| Ga0134080_104096272 | 3300010333 | Grasslands Soil | MWAMSSASAPASATGLAGGQRDAVIHTEDLTKIYPGTDFAAVDKLNLDV |
| Ga0074044_109500671 | 3300010343 | Bog Forest Soil | MSTAQAPVTPAGINDGPQDAVIHTQDLTKVYPGADFSAVDKLNLDV |
| Ga0126372_102002001 | 3300010360 | Tropical Forest Soil | MWAMSSASAPAGATGLADGQRDAVIHTEDLTKIYAGTDFAAVDRLN |
| Ga0126372_105618652 | 3300010360 | Tropical Forest Soil | MSTTQAAASGTGALEGQPGAVIHTENLTKVYPGTDFAAVDHLD |
| Ga0126378_122969911 | 3300010361 | Tropical Forest Soil | MWAMSSASAPAGATGLAGGSQDAVIHTEDLTKIYAGTDFAAVDRLNLD |
| Ga0126378_131653612 | 3300010361 | Tropical Forest Soil | MCRMGIADAPASTAGLPDGQRPEDHRDAVIHTEDLTKIYPGTDFAAVD |
| Ga0136449_1030669081 | 3300010379 | Peatlands Soil | MGTAQAPAVTAGRDGGEPDAVIHTEDLTKVYPGTDFAAVDKLNLD |
| Ga0134126_106636462 | 3300010396 | Terrestrial Soil | MGTAEAQASAAGQADGEPGAVIHTEDLTKVYPGTDFAAVDRLNLDVRA |
| Ga0134121_105361312 | 3300010401 | Terrestrial Soil | MCAMSTADAPAGAGTLDAERDAVIHTEDLTKIYAGTDFAAVDRLNL |
| Ga0134121_109673421 | 3300010401 | Terrestrial Soil | MSTAHMPAGTTERPEGRPDAVIHTEDLTKVYPGTDFAAVDRLNLDVAA |
| Ga0126361_109538822 | 3300010876 | Boreal Forest Soil | MSTAQAPVTPADLGEGEPAAVIHTEDLTKVYPGTDFAAVDKLN |
| Ga0137376_106145871 | 3300012208 | Vadose Zone Soil | MWAMSSASAPASAAGLAEGQRDAVIHTENLTKVYPGTDFAAVDK |
| Ga0126369_104825451 | 3300012971 | Tropical Forest Soil | MWAMSSASAPASAAGPAGGQRDAVIHTEDLTKVYPGTD |
| Ga0182018_105326241 | 3300014489 | Palsa | MSTVHAPASTTGLPEGERGSVIHTEDLTKVYPGADFTA |
| Ga0182032_117639053 | 3300016357 | Soil | MSIAQAPTGAADRPDGRADGVIHTEDLTKVYPGTDFAAVDRLNL |
| Ga0187806_13015942 | 3300017928 | Freshwater Sediment | MRAAASPQSSLRVPGAEPAAIIHTEDLTKVYPGTDFAAVDKLNLD |
| Ga0187879_108301192 | 3300017946 | Peatland | MGTAQAPAAAAGSPGTEHGGEPDAVIHTENLTKVYPGTAFA |
| Ga0187817_110860211 | 3300017955 | Freshwater Sediment | MGTAQAPTVAAGTEPGGEPDAVIHTENLTKVYPGTDFAAV |
| Ga0187778_107363711 | 3300017961 | Tropical Peatland | MWAMSSASAAASATGLNGDQRDAIIHTEELTKVYPGTDFAA |
| Ga0187776_103465301 | 3300017966 | Tropical Peatland | VAHPAQRTMWAMSSASAPASAAGLADGQRDAVIHTEDLTKVYPGTDFAAVDR |
| Ga0187777_103737572 | 3300017974 | Tropical Peatland | MSTASAAASAAGLSGGEPGGVIHTEDLTKVYHGTDFAAVDKLNLDV |
| Ga0187815_102315662 | 3300018001 | Freshwater Sediment | MRAAASPQSSLRVPGAEPAAIIHTEDLTKVYPGTDFAAVDKLNLDV |
| Ga0187805_105243452 | 3300018007 | Freshwater Sediment | MPKEGSAISAAPAPAGATSLATGEQAAVIHTEDLTKVYPGADFAAVDKLNL |
| Ga0187859_108245352 | 3300018047 | Peatland | MSTKPAPVTPASPGDGESASVIHTEDLTKVYPGTDFAAVDHLNLDVQAG |
| Ga0187766_100898241 | 3300018058 | Tropical Peatland | MVYPPQRTMWAMSSASAAASTTGLAGGQRDAVIHTEDLTKVYPG |
| Ga0187766_114186202 | 3300018058 | Tropical Peatland | MSTAPAAANSASHTGGRPDGQPGAVIHTEDLTKIYPGT |
| Ga0187772_109820921 | 3300018085 | Tropical Peatland | MGAVQAATQAAGSGEPDAVIHTEDLTKVYPGTDFA |
| Ga0066655_102605851 | 3300018431 | Grasslands Soil | MSTADAPAGTGTRDAERDAVIHTEDLTKIYAGTDFAAVDRLNLD |
| Ga0210399_108336021 | 3300020581 | Soil | MSTAQAPTSAPGRPDGQEDGVIHTEDLTKVYPGTDFAAVDR |
| Ga0210399_115760801 | 3300020581 | Soil | MRTAHAPASAAGQPGQEPGGEPDAVIHTENLTKVYPDTDFAA |
| Ga0210388_100778791 | 3300021181 | Soil | MSTAQAPASPVSSTGGEPDGVIHTEDLTKVYPGTDFAAVD |
| Ga0213876_101169993 | 3300021384 | Plant Roots | MSTAAAPARPAGQQPGGEPDAVIHTEDLTKVYRGTDF |
| Ga0210385_100222261 | 3300021402 | Soil | MSTVETPASATHSPEANPAGIIHTEDLTKVYPGTDFAAVD |
| Ga0210385_107268082 | 3300021402 | Soil | MSTAEVTASQDGRPRKDEPDAVIHTEDLTKVYPGTDF |
| Ga0210397_112877951 | 3300021403 | Soil | MSTAPAPASATGRPEGQPGGVIHTEDLTKVYPGTDFAAVD |
| Ga0210386_103321141 | 3300021406 | Soil | MGTEATARSPAGGPGGKPEAVIHTEDLTKVYPGTDFTAVDKLNL |
| Ga0210391_109004891 | 3300021433 | Soil | MSTVEAPASATHSPEANPAGIIHTEDLTKVYPGTDFAAVDR |
| Ga0247693_10588091 | 3300024181 | Soil | MWAMSSASAPASATGLADGQRDAVIHTEDLTKIYPGTDFAAVDKL |
| Ga0208220_10501021 | 3300025627 | Arctic Peat Soil | VAMSTAHAPASSTDLPGGEPVAVIHTSDLTKIYPGTD |
| Ga0207699_100744651 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MGTAEAQASAAGQADGEPGAVIHTEDLTKVYPGTDFAAVDRLNLDVR |
| Ga0207687_116122202 | 3300025927 | Miscanthus Rhizosphere | MWAMSSASAPASATGLADDQRDAVIHTEDLTKIYPG |
| Ga0209448_100629571 | 3300027783 | Bog Forest Soil | MGTARAPAVTAGPPGTEHGGEPDAVIHTENLTKVYPGTDFAAV |
| Ga0209656_100634884 | 3300027812 | Bog Forest Soil | MSTAHAPASPAELAGGEPGAVIHTEDLTKVYPGTDFAAVDRLNLDVRA |
| Ga0302220_103663822 | 3300028742 | Palsa | MSTAQAPVIPAGPGDGEAASVIHTEDLTKVYPGTDFAAVDHLNLD |
| Ga0302231_104393952 | 3300028775 | Palsa | MSTAQAPVTPAGPGDGEPAPVIHTEDLTKVYPGTDF |
| Ga0302223_100308381 | 3300028781 | Palsa | MSTAPAPVTPARPGDGESVPKTSVIHTQDLTKVYPGTD |
| Ga0302232_102439772 | 3300028789 | Palsa | MSTAQAHASATDLPAAGPVAVIHTEDLTKVYPGADLAAVDQLNLDVQAG |
| Ga0302235_104911941 | 3300028877 | Palsa | MSTAQAPAAAAGRPAGEEDAVIHTADLTKVYPGTDF |
| Ga0311339_114305562 | 3300029999 | Palsa | MSTAQAPVIPAGPGDGEAASVIHTEDLTKVYPGTDFAAVDHL |
| Ga0311338_114733672 | 3300030007 | Palsa | MNTAQAPVTPATPGGEPDPLTSVIHTEDLTKVYHGTDFAAVDHLNLDVQAG |
| Ga0310037_102641643 | 3300030494 | Peatlands Soil | MSTAQAPASAASLAGGPPAAVIHTEDLTKVYPGTDFAAVDR |
| Ga0311370_114667441 | 3300030503 | Palsa | MSTAPAPVTPARPGDGESDPKTSVIHTQDLTKVYPGTDFAAVDHLNL |
| Ga0302324_1026456541 | 3300031236 | Palsa | MSTAQAPAAAAGRPAGEEDAVIHTADLTKVYPGTDFAAVDR |
| Ga0318534_102796281 | 3300031544 | Soil | MSTAEARASAAGTDHQDAVIHTEDLTKIYQGTDFAAVDKLN |
| Ga0318534_104097051 | 3300031544 | Soil | VDDVSSASAPASAAGRAGGSRDAVIHTEDLTKIYP |
| Ga0318541_103269931 | 3300031545 | Soil | MCRMSTAEATAGTGLPDGQRDAVIHTEDLTKVYPGTDFA |
| Ga0318571_100944001 | 3300031549 | Soil | MCRMSTAEATAGTGLPDGQRDAVIHTEDLTKVYPGTD |
| Ga0318573_103344342 | 3300031564 | Soil | MCRMSTAEATAGTGLPDGQRDAVIHTEDLTKVYPGTDFAAVDK |
| Ga0318561_100573731 | 3300031679 | Soil | MWAMSSASAAAGATGLADGGQRDAVIHTEDLTKIYAGTD |
| Ga0310686_1036506172 | 3300031708 | Soil | LKEGSAISTAPAPAGATSLAHGQHAVAIHTEDLTKVYPGTDFAAVDK |
| Ga0310686_1196484383 | 3300031708 | Soil | MRTAHAPASAAGLPDQEPDAVIHTEDLTKVYPDTDFAAVD |
| Ga0318496_104835782 | 3300031713 | Soil | MWAMSSASAPASAAGRAGGQRDAVIHTEDLTKIYPGTDFAAVDRLNLDVG |
| Ga0318502_100791721 | 3300031747 | Soil | MWAMSSASAAAGATGLADGGQRDAVIHTEDLTKIYA |
| Ga0318543_103834352 | 3300031777 | Soil | MWAMSSASAPAGATGLANGRRDAVIHTEELTKVYPGTDFAAVDRLNLDVE |
| Ga0318576_104143452 | 3300031796 | Soil | MSTAQAPTSATDRPDGHADGVIHTEDLTKIYPGTDFAAV |
| Ga0318497_101718563 | 3300031805 | Soil | VSSASAPASAAGRAGGSRDAVIHTEDLTKIYPGTDFAAV |
| Ga0318517_103274721 | 3300031835 | Soil | MWAMSSASSPASAAGLAGGQRDAVIHTEDLTKVYPGT |
| Ga0318517_105831642 | 3300031835 | Soil | MWAMSSASAAAGATGLADGGQRDAVIHTEDLTKIYAG |
| Ga0318495_102128991 | 3300031860 | Soil | MSTAPAPTSATDRPDGRPDGVIHTEDLTKIYPGTD |
| Ga0318544_103173072 | 3300031880 | Soil | MCAMSTADAPAGAGTRDAARDAVIHTEDLTKVYPG |
| Ga0318551_100446053 | 3300031896 | Soil | MSTAQAPTSATDRPDGHADGVIHTEDLTKIYPGTDFAAVDRLN |
| Ga0318520_105097121 | 3300031897 | Soil | MSTAPAPTSATDRPDGRPDGVIHTEDLTKIYPGTDFAAVDRLN |
| Ga0306923_102581291 | 3300031910 | Soil | MWAMSSASAAAGATGLADGQRDAVIHTEDLTKIYAGTDF |
| Ga0306923_112872332 | 3300031910 | Soil | MSTAPAPTSATDRPDGRPDGVIHTEDLTKIYPGTDFAAVDRLNLDVR |
| Ga0306921_127152851 | 3300031912 | Soil | MCRMSTAEATAGTGLPDGQRDAVIHTEDLTKVYPG |
| Ga0310916_106268881 | 3300031942 | Soil | MSTAQAPTSATDRPDGHADGVIHTEDLTKIYPGTDF |
| Ga0310913_101810043 | 3300031945 | Soil | MCAMSTADAPGGTGAGTHDAERGAVIHTEDLSKIYAGTDF |
| Ga0310910_104223991 | 3300031946 | Soil | MWAMSSASAAAGATGLADGGQRDAVIHTEDLTKIYAGTDFAAVDRLNLDVE |
| Ga0306926_119462092 | 3300031954 | Soil | MSTAQAPTSAPGRPDGQQDGVIHTEDLTKVYPGTDFAAVDRLNLDVRA |
| Ga0306922_102446431 | 3300032001 | Soil | MSSASAAAGVTGLADGQRDAVIHTEDLTKIYAGTDFAAVDRLNLD |
| Ga0318562_100261723 | 3300032008 | Soil | MWAMSSASAAAGATGLADGGQRDAVIHTEDLTKIYAGTDFAAVDRLNL |
| Ga0318563_100528801 | 3300032009 | Soil | MWAMSSASSPASAAGLAGGQRDAVIHTEDLTKVYPGTDFAAVDK |
| Ga0318549_102923612 | 3300032041 | Soil | MSTTEAKTSAAKVDLPDGVIHTEDLTKIYQGTDFAAVDKLNLDIRT |
| Ga0318570_100465431 | 3300032054 | Soil | VVRPPQRTMWAMSSASAAAGVTGLADGQRDAVIHTEDLTKIYAGTDFAAV |
| Ga0318575_100543491 | 3300032055 | Soil | MWAMSSASAAAGATGLADGGQRDAVIHTKDLTKIYAGTDFAAVDRLNLDV |
| Ga0318513_103354973 | 3300032065 | Soil | MSSASAAAGVTGLADGQRDAVIHTEDLTKIYAGTDFA |
| Ga0318513_104542702 | 3300032065 | Soil | MCPMSTADAPAGSAGTRDAGRDAVIHTEDLTKVYPGTD |
| Ga0318524_101588561 | 3300032067 | Soil | MSTAQAPTSATDRPDGRPDGVIHTEDLTKIYPGTDFAAVDRLNLDV |
| Ga0311301_118454441 | 3300032160 | Peatlands Soil | MGTAQAPAAAAGPPGTEHGGEPDAVIHTENLTKVYPGTDFAAVDQLNLDV |
| Ga0335078_103824713 | 3300032805 | Soil | VTSGTQVAAGTAGLSDGEPSAVIHTEDLTKVYGGTDFAA |
| Ga0335078_112811511 | 3300032805 | Soil | MGTAEAQASAAGQADREPGAVIHTEDLTKVYPGTDFAAVDRLNLDV |
| Ga0335078_126440691 | 3300032805 | Soil | MSTAEAAAKSAAQAGEPDAIIHTEDLTKVYPGTDFAAVDRLNLDV |
| Ga0335080_105221791 | 3300032828 | Soil | MWAMSSASAPASATGLADGQRDAVIHTEDLTKIYPGTDFAAVDKLNLDVEA |
| ⦗Top⦘ |