| Basic Information | |
|---|---|
| Family ID | F096787 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 52 residues |
| Representative Sequence | MTDNNELNLTTHRASASVWDRRGWDGTRERLAMTRWLLGIGGCALALQGVRQ |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 52.43 % |
| % of genes near scaffold ends (potentially truncated) | 99.04 % |
| % of genes from short scaffolds (< 2000 bps) | 97.12 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.077 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (10.577 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.538 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (53.846 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.50% β-sheet: 0.00% Coil/Unstructured: 62.50% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF01725 | Ham1p_like | 20.19 |
| PF12704 | MacB_PCD | 0.96 |
| PF01035 | DNA_binding_1 | 0.96 |
| PF08543 | Phos_pyr_kin | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0127 | Inosine/xanthosine triphosphate pyrophosphatase, all-alpha NTP-PPase family | Nucleotide transport and metabolism [F] | 20.19 |
| COG0350 | DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase) | Replication, recombination and repair [L] | 0.96 |
| COG0351 | Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase | Coenzyme transport and metabolism [H] | 0.96 |
| COG0524 | Sugar or nucleoside kinase, ribokinase family | Carbohydrate transport and metabolism [G] | 0.96 |
| COG2240 | Pyridoxal/pyridoxine/pyridoxamine kinase | Coenzyme transport and metabolism [H] | 0.96 |
| COG2870 | ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
| COG3695 | Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domain | Transcription [K] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.08 % |
| Unclassified | root | N/A | 1.92 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918013|NODE_10738_length_1306_cov_6.866769 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1338 | Open in IMG/M |
| 3300002568|C688J35102_118018602 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300004114|Ga0062593_103141226 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300004157|Ga0062590_102084347 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300004157|Ga0062590_102228333 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300004480|Ga0062592_101758547 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300004643|Ga0062591_100974378 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 804 | Open in IMG/M |
| 3300004643|Ga0062591_102043729 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300005294|Ga0065705_10869586 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300005334|Ga0068869_100099219 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2201 | Open in IMG/M |
| 3300005344|Ga0070661_101670324 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300005353|Ga0070669_100207174 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1545 | Open in IMG/M |
| 3300005446|Ga0066686_10177319 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1420 | Open in IMG/M |
| 3300005459|Ga0068867_100277896 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1372 | Open in IMG/M |
| 3300005468|Ga0070707_100501117 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1176 | Open in IMG/M |
| 3300005534|Ga0070735_10805699 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300005535|Ga0070684_100731444 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 923 | Open in IMG/M |
| 3300005536|Ga0070697_100299585 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1382 | Open in IMG/M |
| 3300005544|Ga0070686_100172967 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1529 | Open in IMG/M |
| 3300005556|Ga0066707_10258738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1137 | Open in IMG/M |
| 3300005615|Ga0070702_100564878 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 847 | Open in IMG/M |
| 3300005617|Ga0068859_102319457 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300005713|Ga0066905_100854596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 793 | Open in IMG/M |
| 3300005719|Ga0068861_100216431 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1616 | Open in IMG/M |
| 3300005719|Ga0068861_101524345 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300005764|Ga0066903_102036695 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1103 | Open in IMG/M |
| 3300005764|Ga0066903_106002638 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300005841|Ga0068863_100296440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1568 | Open in IMG/M |
| 3300005843|Ga0068860_101172121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 788 | Open in IMG/M |
| 3300005844|Ga0068862_101070047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 800 | Open in IMG/M |
| 3300006049|Ga0075417_10535104 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300006854|Ga0075425_101489028 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 764 | Open in IMG/M |
| 3300006864|Ga0066797_1232501 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
| 3300006871|Ga0075434_101461464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
| 3300006903|Ga0075426_10253749 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1281 | Open in IMG/M |
| 3300006914|Ga0075436_100707406 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 746 | Open in IMG/M |
| 3300006953|Ga0074063_10854783 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300007004|Ga0079218_13326123 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300007076|Ga0075435_101387177 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
| 3300009038|Ga0099829_11496192 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300009101|Ga0105247_11080898 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300009137|Ga0066709_101174715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1130 | Open in IMG/M |
| 3300009137|Ga0066709_104439642 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300009162|Ga0075423_11236909 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 797 | Open in IMG/M |
| 3300009177|Ga0105248_11204748 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
| 3300009553|Ga0105249_10349739 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1497 | Open in IMG/M |
| 3300009553|Ga0105249_10982657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 913 | Open in IMG/M |
| 3300009661|Ga0105858_1262844 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300010036|Ga0126305_11138102 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300010362|Ga0126377_11356262 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 784 | Open in IMG/M |
| 3300010366|Ga0126379_12475100 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300010375|Ga0105239_13265825 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300010397|Ga0134124_11621532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. HMWF008 | 678 | Open in IMG/M |
| 3300010399|Ga0134127_11007063 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 893 | Open in IMG/M |
| 3300010403|Ga0134123_11625994 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300012203|Ga0137399_10556074 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 964 | Open in IMG/M |
| 3300012204|Ga0137374_10888141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300012204|Ga0137374_11140043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300012212|Ga0150985_120153632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300012356|Ga0137371_10521925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 916 | Open in IMG/M |
| 3300012362|Ga0137361_11823374 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300012929|Ga0137404_11633201 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300012948|Ga0126375_10460201 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 937 | Open in IMG/M |
| 3300014968|Ga0157379_10568744 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1056 | Open in IMG/M |
| 3300014968|Ga0157379_12602329 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300015357|Ga0134072_10158280 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 752 | Open in IMG/M |
| 3300015372|Ga0132256_101623505 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 756 | Open in IMG/M |
| 3300015373|Ga0132257_102210526 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
| 3300015373|Ga0132257_102626917 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300015374|Ga0132255_103009304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
| 3300016341|Ga0182035_10274374 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1372 | Open in IMG/M |
| 3300016445|Ga0182038_11298666 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300018052|Ga0184638_1169219 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 781 | Open in IMG/M |
| 3300020581|Ga0210399_10613059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 900 | Open in IMG/M |
| 3300021432|Ga0210384_11308681 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300021560|Ga0126371_13791778 | Not Available | 509 | Open in IMG/M |
| 3300022756|Ga0222622_10096186 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1810 | Open in IMG/M |
| 3300025315|Ga0207697_10383560 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300025912|Ga0207707_11210015 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300025917|Ga0207660_11266990 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300025935|Ga0207709_11160657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300025941|Ga0207711_10216339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1751 | Open in IMG/M |
| 3300026035|Ga0207703_10606943 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1035 | Open in IMG/M |
| 3300026035|Ga0207703_11896607 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300026078|Ga0207702_12311089 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300026089|Ga0207648_11084897 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
| 3300026118|Ga0207675_101099979 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
| 3300026118|Ga0207675_101957491 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300026142|Ga0207698_10676056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1025 | Open in IMG/M |
| 3300026542|Ga0209805_1172174 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 970 | Open in IMG/M |
| 3300027874|Ga0209465_10301609 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300027874|Ga0209465_10411258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
| 3300028380|Ga0268265_11475893 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300031668|Ga0318542_10504493 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300031770|Ga0318521_10516633 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 718 | Open in IMG/M |
| 3300031824|Ga0307413_12138102 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300031859|Ga0318527_10400607 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300031942|Ga0310916_10113604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2193 | Open in IMG/M |
| 3300032012|Ga0310902_10650181 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
| 3300032174|Ga0307470_10178742 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1332 | Open in IMG/M |
| 3300033289|Ga0310914_11802619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300033290|Ga0318519_10623692 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300034149|Ga0364929_0253264 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 10.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.69% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.73% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 5.77% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 4.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.85% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.88% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.88% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.88% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.92% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.96% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.96% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.96% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.96% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.96% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.96% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.96% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.96% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.96% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918013 | Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009661 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Iowa-Corn-GraphCirc_03630890 | 2140918013 | Soil | MDEMGELNLTTHRAPTSVWDRRGWDGSRERVATTRMLLGVGGG |
| C688J35102_1180186021 | 3300002568 | Soil | MHLPPNLHGFPAMTDTHGLNLTTHRAAESVWQRSGWDGTPEQLAMTRWLVGIGGGALALQGL |
| Ga0062593_1031412261 | 3300004114 | Soil | MPPNLHLIGGMTDTNELNLTTHRAAESVWERSGWDGTREQLAITRWLVGIGGGALALQGL |
| Ga0062590_1020843471 | 3300004157 | Soil | MNDNNELNLTTHRAAASVWDRRGWDGTRERMAVTRWLLGIGG |
| Ga0062590_1022283331 | 3300004157 | Soil | MTENTRDLNLTMSTHRAPASVWERQGWDGSREPLALTRWLVGIGGAALAIQGMRQRTLVGGT |
| Ga0062592_1017585471 | 3300004480 | Soil | MNDNNELNLTTHRAPASVWDRRGWDGTRERLAMTRWLLGIGGCAL |
| Ga0062591_1009743781 | 3300004643 | Soil | MNETHGLNLTTHRAPASVWDRRGWDGTRAQLATTRWLLGVGGGALALQGLRQRS |
| Ga0062591_1020437292 | 3300004643 | Soil | MNDNNELNLTTHRAAASVWDRRGWDGTRERMAVTRWLLGIGGC |
| Ga0065705_108695862 | 3300005294 | Switchgrass Rhizosphere | MTDTRELNLTTHRAPESVWDRRGWDGSSERLTLTRWLVGIGGGALAIQGLRQRTVGG |
| Ga0068869_1000992191 | 3300005334 | Miscanthus Rhizosphere | MTDTHELNLTTHRAVESVWERSGWDGTREQLAVTRWLVGIGGGALALQGLRQRSI |
| Ga0070661_1016703242 | 3300005344 | Corn Rhizosphere | MTDNTADLNLTTATHRAPASVWERQGWDGSREPLALTRWLVGVGGAALAIQGLRQRTLIGGT |
| Ga0070669_1002071743 | 3300005353 | Switchgrass Rhizosphere | MTDNNELNLTTHRASASVWDRRGWDGTRERLAMTRWLLGIGGCA |
| Ga0066686_101773191 | 3300005446 | Soil | MTQPVSTRELNLTAHRAPASVWDRSGWDGTRERLTATRWLVGIGGSALA |
| Ga0070662_1003948253 | 3300005457 | Corn Rhizosphere | MAPLPPNLHHGEGMNETHGLNLTTHRAPASVWDRRGWDGTRAQLATTRWLLGVGGGALAL |
| Ga0068867_1002778961 | 3300005459 | Miscanthus Rhizosphere | MTDNNELNLTTHRASASVWDRRGWDGTRERLAMTRWLLGIGGCALALQGVRQKSITGGLL |
| Ga0070707_1005011174 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MEYTSGELNLTAITHRAPASVWDRDGWNGNRERLALTRWLVGLGGAALALEGVRQR |
| Ga0070735_108056992 | 3300005534 | Surface Soil | MTMTNNELNLTAHRDPASVWDKRGWDGTRNELAVTRWLVGVGGAALAIQGLRQRSAVGSM |
| Ga0070684_1007314442 | 3300005535 | Corn Rhizosphere | MTDTHGLNLTTHRAAESVWERSGWDGTREQLAMTHWLVGIGGGALALQGL |
| Ga0070697_1002995851 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MTEFSNAEGLNLTTHRAPASVWDRRGWDGTREQLALTRWLVGIGGGALAIQGLRQRTV |
| Ga0070686_1001729671 | 3300005544 | Switchgrass Rhizosphere | MTSTSDLNLATHRESASVWDRRGWDGTRERLTITRWLVGAGGGVLAIQGLRQRTVAGS |
| Ga0066707_102587381 | 3300005556 | Soil | MTKKDPSADGMNLTTHRGTTSVWNRRGWNGTAERLAVTRWLVGISGAAL |
| Ga0070702_1005648782 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MNDNNELNLTTHRASASVWDRRGWDGTRERLAMTRWLLGVGGSALALQGLRQKTAMGGL |
| Ga0068859_1023194571 | 3300005617 | Switchgrass Rhizosphere | MPPNLHLIRGMTDTNELNLTTHRAAESVWERSGWDGTREQLAITRWLVGIGGGAL |
| Ga0066905_1008545961 | 3300005713 | Tropical Forest Soil | MNEISHAKGLNLATHRAPVSVWDRRGWDGTREQLTMTRWLIGVGGAALAIQGLRQKT |
| Ga0068861_1002164311 | 3300005719 | Switchgrass Rhizosphere | MNDNNELNLTTHRAPASVWDRRGWDGTRERLAMTRWLLGIGGCALALQGVRQKSMT |
| Ga0068861_1015243452 | 3300005719 | Switchgrass Rhizosphere | MTDNNELNLTTHRASASVWDRRGWDGTRERLAMTRWLLGIGGCALALQGVRQKSM |
| Ga0066903_1020366951 | 3300005764 | Tropical Forest Soil | MTMNTTGLNLTNHRAATSVWDRRGWNGSTEFAVSRWLVGAGGAALVIQGVRY |
| Ga0066903_1060026382 | 3300005764 | Tropical Forest Soil | MTESTLNLSTHRAANSVWERRGWDGNRRHQTVTRWLVGIGGGALAIQ |
| Ga0068863_1002964403 | 3300005841 | Switchgrass Rhizosphere | MTDTHGLNLTTHRAAESVWERSGWDGTREQLAVTRWLVGIGGGALALQG |
| Ga0068860_1011721211 | 3300005843 | Switchgrass Rhizosphere | MTEHELNLTTHRAAESVWKRSGWDGTREQLAMTRWLVGIGGGALAVQGLRQRRT |
| Ga0068862_1010700472 | 3300005844 | Switchgrass Rhizosphere | MTDNNELNLTTHRASASVWDRRGWDGTRERLAMTRWLLGIGGCALALQGVRQ |
| Ga0075417_105351042 | 3300006049 | Populus Rhizosphere | MAQNSSELNLTTHRADSSVWDRRGWDGSREQLALTRWLVGVGGSLLAVEGLRRR |
| Ga0075425_1014890281 | 3300006854 | Populus Rhizosphere | MDATHELKNLTTHRTPVSVWDRRGWDGTREQLALTRWLVGIGGGALALQGL |
| Ga0066797_12325011 | 3300006864 | Soil | MNHHTSDRELNLGTHRAPVSVWHRRGWDGTREQLTMARWLVGIGGGALVVQGMRQ |
| Ga0075434_1014614641 | 3300006871 | Populus Rhizosphere | MTTNTSGLNLTTHRAPASVWDRRGWDGTRRELALTRWLVGLGGTALAL |
| Ga0075426_102537491 | 3300006903 | Populus Rhizosphere | MASPSELNLTTHRAPASVWDRRGWDGTPEQLAMTRWLVGIGGGALA |
| Ga0075436_1007074063 | 3300006914 | Populus Rhizosphere | MDATHELKNLTTHRTPISVWDRRGWDGTREQLALTRWLVGIGGGALALQGL |
| Ga0074063_108547833 | 3300006953 | Soil | MDVTPDLNLATHRESASVWDRRGWDGTRERLTLTRWLVGAGGGALV |
| Ga0079218_133261231 | 3300007004 | Agricultural Soil | MAISESVPHELNITSHRAPESIWDRRGWNGTPERLTMGRWLVGVGGGALAV |
| Ga0075435_1013871771 | 3300007076 | Populus Rhizosphere | MNEAHGLNLTTHRAPASVWDKRGWDGTREQLAMTRWLVGLGGTALA |
| Ga0099829_114961922 | 3300009038 | Vadose Zone Soil | MTDNQGLNLTTHRSPVSVWDRRGWDGTRDQLVLTRLLIGIGGGALALHGLRNRTVTGG |
| Ga0105247_110808981 | 3300009101 | Switchgrass Rhizosphere | MNDNNELNLTTHRASASVWDRRGWDGTRERIAMTRWLVGIGGSALA |
| Ga0066709_1011747151 | 3300009137 | Grasslands Soil | MTDFSHAEGLNLTTHRAPASVWDRRGWDGTREQLALTRWLVGIGGAALAVQ |
| Ga0066709_1044396422 | 3300009137 | Grasslands Soil | MTDTLNLTTHRAAESVWDRRGWNGTREQLAITRWLLGIGGSAL |
| Ga0075423_112369091 | 3300009162 | Populus Rhizosphere | MTTNTSGLNLTTHRAPASVWDRRGWDGTRRELALTRWLVGLGGTSLALQGMRQKSVS |
| Ga0105248_112047482 | 3300009177 | Switchgrass Rhizosphere | MNDNNELNLTTHRASASVWDRRGWDGTRERLAMTRWLLGVGGSALALQGLR |
| Ga0105249_103497393 | 3300009553 | Switchgrass Rhizosphere | LHLIRGMTDTNELNLTTHRAAESVWERSGWDGTREQLAITRWLVGIGGGALALQGLRQ |
| Ga0105249_109826572 | 3300009553 | Switchgrass Rhizosphere | MNDNNELNLTTHRASASVWDRRGWDGTRERIAMTRWLVGIGGSALALQG |
| Ga0105858_12628441 | 3300009661 | Permafrost Soil | MTDNHGLNLTPHRTPVSVWDRRGLDGTREQLAMTRWLLGVGGGALALQGLRQRGIVGS |
| Ga0126305_111381022 | 3300010036 | Serpentine Soil | MDQPTRGSSSGDLNLTTHRAETSVWDRRGWDGTRELETTRWLVGVGGGALAIEG |
| Ga0126377_113562621 | 3300010362 | Tropical Forest Soil | MTDHSDLNLTTHRDPNSVWNRRGWDGTRQQLALTRWLVGIGGV |
| Ga0126379_124751001 | 3300010366 | Tropical Forest Soil | MNLSTHRAPTSVWDKRGWDGTRERLVLTRWLVGIGGG |
| Ga0105239_132658253 | 3300010375 | Corn Rhizosphere | MTSNSDLNLATHRDATSVWDRRGWDGTRERLAITRWLVGAGGGALAIQGLRQ |
| Ga0134124_116215321 | 3300010397 | Terrestrial Soil | MADMQELNLTTHRAPESVWERRGWDGTRERIAMTRWLVGVGGGALALQGLR |
| Ga0134127_110070632 | 3300010399 | Terrestrial Soil | MTDNHRLNLATHRSPNSVWERSGWDGTREQLATTRWLVGIGGAALAVQGLRQRSITGSL |
| Ga0134123_116259941 | 3300010403 | Terrestrial Soil | MNNNFKNSDLNLTTHRSTSSVWERRGWDGTREPALTRWLVGIGGGALAVEGIRRRGV |
| Ga0137399_105560743 | 3300012203 | Vadose Zone Soil | MTETHGLNLTTHRAPASVWDRRGWDGTREQLTMTRWLVGIGGGALAL |
| Ga0137374_108881411 | 3300012204 | Vadose Zone Soil | MIDMAQSSDLNLTAGTHRAPASVWDRAGWDGTPQPLALTRWLVGIGGAALAL |
| Ga0137374_111400431 | 3300012204 | Vadose Zone Soil | MSEISRGIDSELNLATHRASVSVWDRRGWDGTREQIALTRWLVGAGGAALAVQGLRQRS |
| Ga0150985_1201536321 | 3300012212 | Avena Fatua Rhizosphere | MNETHGLNLTTHRAPASVWDRRGWDGTREQLATTRWLLGVGGGALALQGLRQRSVM |
| Ga0137371_105219251 | 3300012356 | Vadose Zone Soil | MSLTIHRGTTSVWNRRGWNGTAERLAVTRWLVGIGGAALVIQGVRQQ |
| Ga0137361_118233741 | 3300012362 | Vadose Zone Soil | MENNAQSPDLNLTTHRSANSVWERRGWDGTRELALTRWLVGIGGGALAVEG |
| Ga0137404_116332011 | 3300012929 | Vadose Zone Soil | MTDMNGLNLTTHRAPASVWDRRGWDGTPEQLAMTRWLLGIGGAALALQGLRQRSVMGSL |
| Ga0126375_104602012 | 3300012948 | Tropical Forest Soil | MTETSRPEGLNLTTHRAPASVWDKRGWDGTREQLALTRLLVGIGGGALAIQGLR |
| Ga0157379_105687443 | 3300014968 | Switchgrass Rhizosphere | LHLIRGMTDTHGLNLTTHRKVESVWERSGWDGTREQLAVTRWLVGIGGGALAVQGIRQ |
| Ga0157379_126023292 | 3300014968 | Switchgrass Rhizosphere | MTSNSDLNLATHRDAASVWERRGWDGTRERLAITRWLVGAGGG |
| Ga0134072_101582801 | 3300015357 | Grasslands Soil | MTTHTNGLNLTTHRAPASVWDRRGWDGTRRELALTRWLVGLGGAALAL |
| Ga0132256_1016235052 | 3300015372 | Arabidopsis Rhizosphere | MNEISQAEGLNLTTHRAPASVWDKRGWDGTPERLALTRWLIGIGGCALAVQGLRQKNV |
| Ga0132257_1022105262 | 3300015373 | Arabidopsis Rhizosphere | MNEISQAEVLNLTTHRAPASVWDKRGWDGTPERLALTRWLIGIGGCALAVQGLRQKNV |
| Ga0132257_1026269171 | 3300015373 | Arabidopsis Rhizosphere | MTEISHAEGLNLTTHRAPASVWDKRGWDGTREQLALTRWLVGVGGAALAIQGLRQRTVAGSL |
| Ga0132255_1030093042 | 3300015374 | Arabidopsis Rhizosphere | MTETSHAEGLNLTTHRAPASVWDKRGWDGPREQLALTRLLVGVGGGALAIQGLRQRTV |
| Ga0182035_102743741 | 3300016341 | Soil | MTTDTTGLNLTTHRAATSVWDRRGWNGSTEYAVTRWLLGVGGAALAIQGVRHRSRI |
| Ga0182038_112986661 | 3300016445 | Soil | MTTDTTGLNLTTHRAATSVWDRRGWNGSTEYAVTRWLVGVGGAALAIQGVRHRSRIGTMLAGL |
| Ga0184638_11692192 | 3300018052 | Groundwater Sediment | MNDNNELNLTTHRASASVWDRRGWDGTRERLATTRWLLGIGGTAL |
| Ga0210399_106130592 | 3300020581 | Soil | MTDTQGLNLTTHRATESVWERGGWDGNREKLAVTRLLVGIGGGALALQGLR |
| Ga0210384_113086811 | 3300021432 | Soil | MTETLNVAVTTHRANTSVWDRRGWDGRGQPIAITRLLIGIGGGALAIQGVRQRSA |
| Ga0126371_137917781 | 3300021560 | Tropical Forest Soil | MTGNTTGLNLTTHRAATSVWDRRGWNGSTEYAISRWLVGVGGAALAIQGVRHRSRIGTMLAGL |
| Ga0222622_100961864 | 3300022756 | Groundwater Sediment | MNDNNELNLTTHRASANVWDRRGWDGTRERLAMTRWLLGIGGTALALQGLR |
| Ga0207697_103835601 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MNDNNELNLTTHRASASVWDRRGWDGTRERIAMTRWLVGIGGSALALQGLRQKTVM |
| Ga0207707_112100152 | 3300025912 | Corn Rhizosphere | MNMNELNLTTHRASASVWDRRGWDGSRERLAATRWLLGVGGA |
| Ga0207660_112669901 | 3300025917 | Corn Rhizosphere | MSDMSELNLSTHRASASVWDRRGWDGTRERMAMTRWLLGAGGAAL |
| Ga0207709_111606571 | 3300025935 | Miscanthus Rhizosphere | MTEHELNLTTHRAAESVWKRSGWDGTREQLAMTRWLVGIGGGALA |
| Ga0207711_102163394 | 3300025941 | Switchgrass Rhizosphere | MTSNSDLNLATHRDAASVWERRGWDGTRERLAITRWLVGAGGGVLAIQGLRQRS |
| Ga0207703_106069433 | 3300026035 | Switchgrass Rhizosphere | MTENSADLNLTMATHRAPASVWERQGWDGSKEPLALTRWLVGIGGAALAIQGVRQRSWIG |
| Ga0207703_118966071 | 3300026035 | Switchgrass Rhizosphere | MTQSFSEELNLTTHRASVSVWDRRGWDGSREQRTPARWLVGLGGGALAVQGLR |
| Ga0207702_123110891 | 3300026078 | Corn Rhizosphere | MNQHLSPRTLNLTAHRAPASVWDRQGWDGRPEPLTVSRWLVAAGGSALAIQAF |
| Ga0207648_110848972 | 3300026089 | Miscanthus Rhizosphere | MTEHELNLTTHRAAESVWKRSGWDGTREQLAMTRWLVGIGGGALAVQGLRQRRTSGW |
| Ga0207675_1010999792 | 3300026118 | Switchgrass Rhizosphere | MNDNNELNLTTHRAPASVWDRRGWDGTRERLAMTRWLLGIGGCALAL |
| Ga0207675_1019574911 | 3300026118 | Switchgrass Rhizosphere | MTDNNELNLTTHRASASVWDRRGWDGTRERLAMTRWLLGIGGCALAL |
| Ga0207698_106760561 | 3300026142 | Corn Rhizosphere | MTEHELNLTTHRAAESVWKRSGWDGTREQLAMTRWLVGIGGGALAVQGLRQRRTS |
| Ga0209805_11721742 | 3300026542 | Soil | MTTHSSGLNLTTHRAPASVWDRRGWDGTRRELALTRWLVGLGGAAL |
| Ga0209465_103016092 | 3300027874 | Tropical Forest Soil | MAERRELNLRTHRAPVSVWDRRGWDGTPDQPALTRWLLGIGGSALAI |
| Ga0209465_104112582 | 3300027874 | Tropical Forest Soil | MNEAHGLNLTTHRASVSVWDRRGWNGTPEQLAVTRWLVGIGGAALAVQGLR |
| Ga0268265_114758931 | 3300028380 | Switchgrass Rhizosphere | MTDNNELNLTTHRASASVWDRRGWDGTRERLAMTRWLLGIGGCALALQGVRQK |
| Ga0318542_105044931 | 3300031668 | Soil | MTTDTTGLNLTTHRAATSVWDRRGWNGSTEYAVTRWLVGVGGAALAIQGVR |
| Ga0318521_105166332 | 3300031770 | Soil | MTTDTTGLNLTTHRAATSVWDRRGWNGSTEYAVTRWLVGVGGAALAIQ |
| Ga0307413_121381021 | 3300031824 | Rhizosphere | MTDMSELNLQTHRAPVSVWDRRGWNGTREELAVTRLLVGVGGAALAVQGLRQGTWTGR |
| Ga0318527_104006071 | 3300031859 | Soil | MTTDTTGLNLTTHRAATSVWDRRGWNGSTEYAVTRWLLGVGGAALAIQGVRHRSR |
| Ga0310916_101136041 | 3300031942 | Soil | MNDANELNLTARRTPVSVWSREGWDGTQQQLTLSRWLVGIGGGALAIQGLRQRSIPGSLL |
| Ga0310902_106501811 | 3300032012 | Soil | MTDQTADLNLTSTTHRAPASVWERQGWDGSKEPLALTRWLVGIGGAALAVQGVRQRTLIG |
| Ga0307470_101787421 | 3300032174 | Hardwood Forest Soil | MNDNNELNLTTHRAPASVWDRRGWDGTRERLAMTRWLLGIGGCALALQGVRQK |
| Ga0310914_118026193 | 3300033289 | Soil | MTEHELNLTTHRSSESVWNRSGWDGTREQLAMTRWLVGIGGSALAVQGLRQRKTSGWML |
| Ga0318519_106236922 | 3300033290 | Soil | MTTNTSGLNLTTHRAATSVWDRRGWNGSTEYAVTRWLVGVGGAALAIQG |
| Ga0364929_0253264_1_168 | 3300034149 | Sediment | MTDNHRLNLATHRSPNSVWERSGWDGTREQLATTRWLVGIGGAALAVQGLRQRSIT |
| ⦗Top⦘ |