Metagenome / Metatranscriptome Family F096785

Basic Information
Family ID	F096785
Family Type	Metagenome / Metatranscriptome
Number of Sequences	104
Average Sequence Length	38 residues
Representative Sequence	LVSVPAERGPALEAEFGARKLFIRRIGRVEEGAGVVVE
Number of Associated Samples	92
Number of Associated Scaffolds	104

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	100.00 %
% of genes from short scaffolds (< 2000 bps)	94.23 %
Associated GOLD sequencing projects	89
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.47

Most Common Taxonomy
Group	Bacteria (98.077 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (22.115 % of family members)
Environment Ontology (ENVO)	Unclassified (29.808 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (55.769 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 19.70% β-sheet: 0.00% Coil/Unstructured: 80.30%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 104 Family Scaffolds
PF01467	CTP_transf_like	77.88
PF10143	PhosphMutase	7.69
PF02628	COX15-CtaA	4.81
PF13473	Cupredoxin_1	3.85
PF01676	Metalloenzyme	1.92
PF00117	GATase	0.96
PF01513	NAD_kinase	0.96

COG ID	Name	Functional Category	% Frequency in 104 Family Scaffolds
COG1612	Heme A synthase	Coenzyme transport and metabolism [H]	4.81

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	98.08 %
Unclassified	root	N/A	1.92 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	98.08 %
Unclassified	root	N/A	1.92 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	98.08 %
Unclassified	root	N/A	1.92 %

Name	Rank	Taxonomy	Distribution
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	21.15 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.92 %
Unclassified	root	N/A	1.92 %

Name	Rank	Taxonomy	Distribution
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	13.46 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	7.69 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	1.92 %
Unclassified	root	N/A	1.92 %

Name	Rank	Taxonomy	Distribution
unclassified Chloroflexi	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi	7.69 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	5.77 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1.92 %
Unclassified	root	N/A	1.92 %

Name	Rank	Taxonomy	Distribution
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	7.69 %
unclassified Actinomycetia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia	3.85 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1.92 %
Unclassified	root	N/A	1.92 %
Micrococcales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales	0.96 %

Name	Rank	Taxonomy	Distribution
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	7.69 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	3.85 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1.92 %
Unclassified	root	N/A	1.92 %
Intrasporangiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae	0.96 %

Name	Rank	Taxonomy	Distribution
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	7.69 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	3.85 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1.92 %
Unclassified	root	N/A	1.92 %
Phycicoccus	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus	0.96 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2228664021\|ICCgaii200_c0739446	All Organisms → cellular organisms → Bacteria	636	Open in IMG/M
3300000858\|JGI10213J12805_11109533	All Organisms → cellular organisms → Bacteria	701	Open in IMG/M
3300000956\|JGI10216J12902_109933977	All Organisms → cellular organisms → Bacteria	744	Open in IMG/M
3300000956\|JGI10216J12902_121205125	All Organisms → cellular organisms → Bacteria	772	Open in IMG/M
3300005184\|Ga0066671_10599178	All Organisms → cellular organisms → Bacteria	714	Open in IMG/M
3300005184\|Ga0066671_10784141	All Organisms → cellular organisms → Bacteria	611	Open in IMG/M
3300005329\|Ga0070683_100501566	All Organisms → cellular organisms → Bacteria	1159	Open in IMG/M
3300005454\|Ga0066687_10185022	All Organisms → cellular organisms → Bacteria	1127	Open in IMG/M
3300005544\|Ga0070686_101062330	All Organisms → cellular organisms → Bacteria	667	Open in IMG/M
3300005559\|Ga0066700_10840164	All Organisms → cellular organisms → Bacteria	615	Open in IMG/M
3300005560\|Ga0066670_10363605	All Organisms → cellular organisms → Bacteria	883	Open in IMG/M
3300005561\|Ga0066699_11071523	All Organisms → cellular organisms → Bacteria	556	Open in IMG/M
3300005568\|Ga0066703_10422358	All Organisms → cellular organisms → Bacteria	800	Open in IMG/M
3300005574\|Ga0066694_10479221	All Organisms → cellular organisms → Bacteria	581	Open in IMG/M
3300005713\|Ga0066905_100751753	All Organisms → cellular organisms → Bacteria	841	Open in IMG/M
3300006854\|Ga0075425_101823734	All Organisms → cellular organisms → Bacteria	682	Open in IMG/M
3300009012\|Ga0066710_104272108	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	534	Open in IMG/M
3300009088\|Ga0099830_10297692	All Organisms → cellular organisms → Bacteria	1287	Open in IMG/M
3300009137\|Ga0066709_100419724	All Organisms → cellular organisms → Bacteria	1861	Open in IMG/M
3300009156\|Ga0111538_13529758	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	542	Open in IMG/M
3300009789\|Ga0126307_10726046	All Organisms → cellular organisms → Bacteria	802	Open in IMG/M
3300009818\|Ga0105072_1062504	All Organisms → cellular organisms → Bacteria	718	Open in IMG/M
3300010039\|Ga0126309_10156693	All Organisms → cellular organisms → Bacteria	1229	Open in IMG/M
3300010039\|Ga0126309_10658587	All Organisms → cellular organisms → Bacteria	667	Open in IMG/M
3300010045\|Ga0126311_11714140	All Organisms → cellular organisms → Bacteria	531	Open in IMG/M
3300010166\|Ga0126306_10014528	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	5075	Open in IMG/M
3300010166\|Ga0126306_11668935	All Organisms → cellular organisms → Bacteria	532	Open in IMG/M
3300010304\|Ga0134088_10116313	All Organisms → cellular organisms → Bacteria	1264	Open in IMG/M
3300010325\|Ga0134064_10461168	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	520	Open in IMG/M
3300010337\|Ga0134062_10433173	All Organisms → cellular organisms → Bacteria	649	Open in IMG/M
3300010373\|Ga0134128_10630317	All Organisms → cellular organisms → Bacteria	1192	Open in IMG/M
3300010373\|Ga0134128_12596039	All Organisms → cellular organisms → Bacteria	558	Open in IMG/M
3300010396\|Ga0134126_12256013	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	593	Open in IMG/M
3300011000\|Ga0138513_100012676	All Organisms → cellular organisms → Bacteria	1078	Open in IMG/M
3300011000\|Ga0138513_100079505	All Organisms → cellular organisms → Bacteria	508	Open in IMG/M
3300011269\|Ga0137392_10802107	All Organisms → cellular organisms → Bacteria	777	Open in IMG/M
3300012187\|Ga0136622_10409616	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	570	Open in IMG/M
3300012189\|Ga0137388_10445656	All Organisms → cellular organisms → Bacteria	1201	Open in IMG/M
3300012198\|Ga0137364_10495637	All Organisms → cellular organisms → Bacteria	918	Open in IMG/M
3300012204\|Ga0137374_11263377	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	512	Open in IMG/M
3300012350\|Ga0137372_10885004	All Organisms → cellular organisms → Bacteria	635	Open in IMG/M
3300012353\|Ga0137367_10025410	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	4595	Open in IMG/M
3300012353\|Ga0137367_10538895	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	820	Open in IMG/M
3300012357\|Ga0137384_10837790	All Organisms → cellular organisms → Bacteria	743	Open in IMG/M
3300012358\|Ga0137368_10594652	All Organisms → cellular organisms → Bacteria	703	Open in IMG/M
3300012398\|Ga0134051_1094393	All Organisms → cellular organisms → Bacteria	610	Open in IMG/M
3300012882\|Ga0157304_1102572	All Organisms → cellular organisms → Bacteria	524	Open in IMG/M
3300012897\|Ga0157285_10181858	All Organisms → cellular organisms → Bacteria	648	Open in IMG/M
3300012907\|Ga0157283_10034774	All Organisms → cellular organisms → Bacteria	1063	Open in IMG/M
3300012939\|Ga0162650_100043309	All Organisms → cellular organisms → Bacteria	722	Open in IMG/M
3300012984\|Ga0164309_10453685	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus	970	Open in IMG/M
3300012984\|Ga0164309_11113199	All Organisms → cellular organisms → Bacteria	658	Open in IMG/M
3300014326\|Ga0157380_12826067	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	552	Open in IMG/M
3300014497\|Ga0182008_10728429	All Organisms → cellular organisms → Bacteria	569	Open in IMG/M
3300015373\|Ga0132257_103541812	All Organisms → cellular organisms → Bacteria	568	Open in IMG/M
3300018027\|Ga0184605_10251702	All Organisms → cellular organisms → Bacteria	803	Open in IMG/M
3300018051\|Ga0184620_10268074	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	574	Open in IMG/M
3300018053\|Ga0184626_10380444	All Organisms → cellular organisms → Bacteria	568	Open in IMG/M
3300018431\|Ga0066655_10128840	All Organisms → cellular organisms → Bacteria	1467	Open in IMG/M
3300018468\|Ga0066662_11905337	All Organisms → cellular organisms → Bacteria	622	Open in IMG/M
3300019361\|Ga0173482_10758631	All Organisms → cellular organisms → Bacteria	509	Open in IMG/M
3300020005\|Ga0193697_1124656	All Organisms → cellular organisms → Bacteria	596	Open in IMG/M
3300021445\|Ga0182009_10513099	All Organisms → cellular organisms → Bacteria	633	Open in IMG/M
3300022694\|Ga0222623_10340180	All Organisms → cellular organisms → Bacteria	574	Open in IMG/M
3300023072\|Ga0247799_1006784	All Organisms → cellular organisms → Bacteria	1615	Open in IMG/M
3300025916\|Ga0207663_10144275	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1662	Open in IMG/M
3300025921\|Ga0207652_10136087	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2194	Open in IMG/M
3300025922\|Ga0207646_10258289	All Organisms → cellular organisms → Bacteria	1574	Open in IMG/M
3300025928\|Ga0207700_10051449	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	3074	Open in IMG/M
3300025961\|Ga0207712_10722678	All Organisms → cellular organisms → Bacteria	871	Open in IMG/M
3300025981\|Ga0207640_10121685	All Organisms → cellular organisms → Bacteria	1871	Open in IMG/M
3300026078\|Ga0207702_11345312	All Organisms → cellular organisms → Bacteria	708	Open in IMG/M
3300026118\|Ga0207675_101597690	All Organisms → cellular organisms → Bacteria	672	Open in IMG/M
3300026312\|Ga0209153_1070578	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1271	Open in IMG/M
3300026536\|Ga0209058_1275231	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	581	Open in IMG/M
3300027691\|Ga0209485_1262533	All Organisms → cellular organisms → Bacteria	560	Open in IMG/M
3300027775\|Ga0209177_10412246	All Organisms → cellular organisms → Bacteria	544	Open in IMG/M
3300027862\|Ga0209701_10448966	Not Available	710	Open in IMG/M
3300028705\|Ga0307276_10126791	All Organisms → cellular organisms → Bacteria	636	Open in IMG/M
3300028716\|Ga0307311_10068336	All Organisms → cellular organisms → Bacteria	963	Open in IMG/M
3300028716\|Ga0307311_10110428	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	773	Open in IMG/M
3300028719\|Ga0307301_10008963	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2819	Open in IMG/M
3300028719\|Ga0307301_10247253	All Organisms → cellular organisms → Bacteria	582	Open in IMG/M
3300028755\|Ga0307316_10013983	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2514	Open in IMG/M
3300028771\|Ga0307320_10218556	All Organisms → cellular organisms → Bacteria	747	Open in IMG/M
3300028778\|Ga0307288_10347066	All Organisms → cellular organisms → Bacteria	597	Open in IMG/M
3300028787\|Ga0307323_10070550	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1241	Open in IMG/M
3300028807\|Ga0307305_10051707	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1892	Open in IMG/M
3300028810\|Ga0307294_10067828	All Organisms → cellular organisms → Bacteria	1072	Open in IMG/M
3300028811\|Ga0307292_10067401	All Organisms → cellular organisms → Bacteria	1365	Open in IMG/M
3300028814\|Ga0307302_10706884	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	501	Open in IMG/M
3300028878\|Ga0307278_10426655	All Organisms → cellular organisms → Bacteria	582	Open in IMG/M
3300028880\|Ga0307300_10165474	All Organisms → cellular organisms → Bacteria	702	Open in IMG/M
3300030336\|Ga0247826_10273268	All Organisms → cellular organisms → Bacteria	1198	Open in IMG/M
3300030336\|Ga0247826_11247429	Not Available	597	Open in IMG/M
3300030336\|Ga0247826_11278128	All Organisms → cellular organisms → Bacteria	590	Open in IMG/M
3300030511\|Ga0268241_10130191	All Organisms → cellular organisms → Bacteria	603	Open in IMG/M
3300031114\|Ga0308187_10227604	All Organisms → cellular organisms → Bacteria	667	Open in IMG/M
3300031720\|Ga0307469_11167040	All Organisms → cellular organisms → Bacteria	726	Open in IMG/M
3300031903\|Ga0307407_11176717	All Organisms → cellular organisms → Bacteria	598	Open in IMG/M
3300031912\|Ga0306921_12622795	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	520	Open in IMG/M
3300031939\|Ga0308174_11953140	All Organisms → cellular organisms → Bacteria	505	Open in IMG/M
3300031943\|Ga0310885_10607740	All Organisms → cellular organisms → Bacteria	607	Open in IMG/M
3300034671\|Ga0314796_170559	All Organisms → cellular organisms → Bacteria	521	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	90.38%
Host-Associated	Host-Associated	9.62%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	85.58%
Plants	Host-Associated → Plants	9.62%
Aquatic	Environmental → Aquatic	4.81%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	82.69%
Rhizosphere	Host-Associated → Plants → Rhizosphere	5.77%
Sediment	Environmental → Aquatic → Sediment	3.85%
Rhizoplane	Host-Associated → Plants → Rhizoplane	3.85%
Agricultural Field	Environmental → Terrestrial → Agricultural Field	2.88%
Freshwater	Environmental → Aquatic → Freshwater	0.96%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	75.00%
Loam	Environmental → Terrestrial → Soil → Loam	6.73%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	5.77%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	3.85%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified	2.88%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	2.88%
Ice	Environmental → Aquatic → Freshwater → Ice	0.96%
Sand	Environmental → Terrestrial → Soil → Sand	0.96%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.96%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	47.12%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	17.31%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	5.77%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	5.77%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	5.77%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	3.85%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.88%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified	2.88%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	2.88%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	1.92%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	0.96%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.96%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.96%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.96%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	22.12%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	13.46%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	10.58%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	5.77%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	5.77%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	3.85%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	3.85%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	2.88%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.88%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.88%
Soil	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil	2.88%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.92%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.92%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.92%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.92%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	1.92%
Polar Desert Sand	Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand	0.96%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.96%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.96%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.96%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.96%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.96%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.96%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	0.96%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.96%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.96%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.96%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.96%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.96%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.96%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2228664021	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000858	Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300005184	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120	Environmental	Open in IMG/M
3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Environmental	Open in IMG/M
3300005454	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136	Environmental	Open in IMG/M
3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Environmental	Open in IMG/M
3300005559	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149	Environmental	Open in IMG/M
3300005560	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119	Environmental	Open in IMG/M
3300005561	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148	Environmental	Open in IMG/M
3300005568	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152	Environmental	Open in IMG/M
3300005574	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009789	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28	Environmental	Open in IMG/M
3300009818	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40	Environmental	Open in IMG/M
3300010039	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56	Environmental	Open in IMG/M
3300010045	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61	Environmental	Open in IMG/M
3300010166	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27	Environmental	Open in IMG/M
3300010304	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015	Environmental	Open in IMG/M
3300010325	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG	Environmental	Open in IMG/M
3300010337	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300011000	Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015	Environmental	Open in IMG/M
3300011269	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG	Environmental	Open in IMG/M
3300012187	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ448 (21.06)	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental	Open in IMG/M
3300012204	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG	Environmental	Open in IMG/M
3300012350	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG	Environmental	Open in IMG/M
3300012353	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG	Environmental	Open in IMG/M
3300012357	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG	Environmental	Open in IMG/M
3300012358	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG	Environmental	Open in IMG/M
3300012398	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012882	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2	Environmental	Open in IMG/M
3300012897	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1	Environmental	Open in IMG/M
3300012907	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1	Environmental	Open in IMG/M
3300012939	Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015	Environmental	Open in IMG/M
3300012984	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG	Environmental	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300018027	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex	Environmental	Open in IMG/M
3300018051	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1	Environmental	Open in IMG/M
3300018053	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1	Environmental	Open in IMG/M
3300018431	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300019361	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)	Environmental	Open in IMG/M
3300020005	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2	Environmental	Open in IMG/M
3300021445	Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG	Environmental	Open in IMG/M
3300022694	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex	Environmental	Open in IMG/M
3300023072	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6	Environmental	Open in IMG/M
3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026312	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)	Environmental	Open in IMG/M
3300026536	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)	Environmental	Open in IMG/M
3300027691	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes)	Environmental	Open in IMG/M
3300027775	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)	Environmental	Open in IMG/M
3300027862	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300028705	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115	Environmental	Open in IMG/M
3300028716	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198	Environmental	Open in IMG/M
3300028719	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182	Environmental	Open in IMG/M
3300028755	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356	Environmental	Open in IMG/M
3300028771	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369	Environmental	Open in IMG/M
3300028778	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142	Environmental	Open in IMG/M
3300028787	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381	Environmental	Open in IMG/M
3300028807	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186	Environmental	Open in IMG/M
3300028810	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151	Environmental	Open in IMG/M
3300028811	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149	Environmental	Open in IMG/M
3300028814	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183	Environmental	Open in IMG/M
3300028878	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117	Environmental	Open in IMG/M
3300028880	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181	Environmental	Open in IMG/M
3300030336	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1	Environmental	Open in IMG/M
3300030511	Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2)	Environmental	Open in IMG/M
3300031114	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Host-Associated	Open in IMG/M
3300031912	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)	Environmental	Open in IMG/M
3300031939	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2	Environmental	Open in IMG/M
3300031943	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2	Environmental	Open in IMG/M
3300034671	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R1 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
ICCgaii200_07394461	2228664021	Soil	GGLLVSIPAEQGPELEAEFASRKLFLRRVGSVEEGSGVVVE
JGI10213J12805_111095332	3300000858	Soil	LLVSVPADRGPTLEAEFAARRLFLRRIGRVEEGSGVLVR*
JGI10216J12902_1099339771	3300000956	Soil	VSVAAERATALEAEFESRKLFVRRIGRVEEGTGVVVE*
JGI10216J12902_1212051251	3300000956	Soil	LPAERGAALEAEFAARRLFLRRIGRVEEGAGVHVM*
Ga0066671_105991782	3300005184	Soil	GGLLVSVPAERGAVLEAEFAARRLFIRRVGSVEEGSGVVVD*
Ga0066671_107841411	3300005184	Soil	LLVSLPADQGAALEAEFEAKKLFLRRIGRVEEGSGVLVT*
Ga0070683_1005015661	3300005329	Corn Rhizosphere	GGLLVSLPSQQGPALEAEFGSRRLFLRRVGTVEEGVGVVVV*
Ga0066687_101850221	3300005454	Soil	LLVSLPAAQGPALEAEFAARRLFIRRIGYVEEGSGVLVE*
Ga0070686_1010623301	3300005544	Switchgrass Rhizosphere	AGGLLVSLPSEQGPALEAEFGSRRLFLRRVGTVEEGAGVVVV*
Ga0066700_108401642	3300005559	Soil	TAGGLLIALAADRGATFEAEMQARRLFVRRIGRVEEGAGVVVE*
Ga0066670_103636051	3300005560	Soil	LLVSLPSEQGAALEAEFAARRLFIRRIGRVEEGSGVRVQ*
Ga0066699_110715231	3300005561	Soil	LLVSVPAEQGPALEAEFEAHKLFIRRIGRVEEGSGVSVS*
Ga0066703_104223581	3300005568	Soil	VSIPAERAAALEAEFEARKLFIRRVGRVEEGVGVVVE*
Ga0066694_104792212	3300005574	Soil	VTLPSEQGAVLEAQFSSRRLFLRRVGTVEEGAGVVVV*
Ga0066905_1007517533	3300005713	Tropical Forest Soil	SLPAHQGPVLEAEFSSRRLFLRRVGTVEEGSGVLVV*
Ga0075425_1018237342	3300006854	Populus Rhizosphere	PGERAGALEAEFTARKLFIRRIGRVEEGSGVTVE*
Ga0066710_1042721082	3300009012	Grasslands Soil	LVTLPADRCAVLEAEFAARDLPVWRIGSVEQGSGVEVT
Ga0099830_102976923	3300009088	Vadose Zone Soil	VSLPAEQGPALEAEFGARRLFVRRIGRVEEGAGVLVE*
Ga0066709_1004197244	3300009137	Grasslands Soil	GLLISLPSEQGPALEAEFEARKLFIRRIGRVEEGSGVVVQ*
Ga0111538_135297581	3300009156	Populus Rhizosphere	SVPAERGAALEAEFSSRRLFIRRIGSVEEGAGVAVS*
Ga0126307_107260462	3300009789	Serpentine Soil	GLLVSLPRERGPALEAAFERHGLFIRRIGSVEEGAGVLVR*
Ga0105072_10625042	3300009818	Groundwater Sand	VPSERGPALEAEFGARRLFIRRIGRVEEGAGVVVQ*
Ga0126309_101566933	3300010039	Serpentine Soil	VSVPAERGPVLEAEFAARRLFVRRVGRVEEGSGVVVE*
Ga0126309_106585872	3300010039	Serpentine Soil	VPAERGAALEAEFDARRLFIRRVGRVEEGSGVAVN*
Ga0126311_117141402	3300010045	Serpentine Soil	GGLLVSVPAERGATLEAEFTARRLFVRRIGFVEEGSGVVVQ*
Ga0126306_100145287	3300010166	Serpentine Soil	VSLPAERSATIDAEFSAQRLFLRRIGRVEEGGGVVVQ*
Ga0126306_116689351	3300010166	Serpentine Soil	VPSERGAVLEAEFQAKKLFLRRVGRVEEGAGVVVE*
Ga0134088_101163131	3300010304	Grasslands Soil	GLLVSLPSEQGPALEAEFAKRRLFVRRIGRVEEGVGLFVE*
Ga0134064_104611681	3300010325	Grasslands Soil	PSDRGVALEAEFGARRLFIRRIGRVEEGTGVVVE*
Ga0134062_104331732	3300010337	Grasslands Soil	LPVERGAALEAEFSARRLFIRRIGYVEEGSGVVVE*
Ga0134128_106303171	3300010373	Terrestrial Soil	LPSEQGTALEAEFASRRLFLRRVGTVEEGTGVLVV*
Ga0134128_125960392	3300010373	Terrestrial Soil	LLISLPSEQGPALEAEFEAHKLFIRRIGRVEEGFGVQVQ*
Ga0134126_122560131	3300010396	Terrestrial Soil	SLPADRGAVLQASFESRGLFLRRSGHVEEGAGVVVQ*
Ga0138513_1000126763	3300011000	Soil	TLPKERGAALEAEFDARKLFIRRIGTIEEGAGVVVE*
Ga0138513_1000795052	3300011000	Soil	ALPSEQGAVLEAEFTSRRLFLRRVGTVEEGSGVLVV*
Ga0137392_108021073	3300011269	Vadose Zone Soil	GGLLVSVPAEQGAALEAEFEGRKLFVRRIGRVEEGAGVFVE*
Ga0136622_104096161	3300012187	Polar Desert Sand	LPSAKAAVLEAAFVSVGLFIRRIGRVEPGRGVHLE*
Ga0137388_104456561	3300012189	Vadose Zone Soil	SVPAERGAALEAEFESRRLFIRRIGRVEEGAGVIVE*
Ga0137364_104956373	3300012198	Vadose Zone Soil	PAEQGPALEAEFAKRRLFVRRIGRVEEGAGVFVE*
Ga0137374_112633772	3300012204	Vadose Zone Soil	LVSIPAERGPALEAEFAARRLFIRRIGRVEEGAGVTVE*
Ga0137372_108850042	3300012350	Vadose Zone Soil	VSVPAERGAALEAEFSARKLFIRRIGRVEEGAGVIVE*
Ga0137367_100254106	3300012353	Vadose Zone Soil	CLPADRAAVLQASFDAADLFLQRIGRVEEGSGVVIA*
Ga0137367_105388951	3300012353	Vadose Zone Soil	LISLPSDRGAALEAEFTARKLFIRRIGRVEEGAGVVVE*
Ga0137384_108377901	3300012357	Vadose Zone Soil	SIRGDQAAALEAEFMARGLFIRRIGRVEEGAGVVVE*
Ga0137368_105946522	3300012358	Vadose Zone Soil	VSLPAERGAALEAEFTARKLFIRRIGRVEEGAGVTVE*
Ga0134051_10943932	3300012398	Grasslands Soil	VSVPAERGVALEAEFTAKRLFIRRIGRVEEGAGVVVE*
Ga0157304_11025722	3300012882	Soil	VSVPAERGPALEAEFEAQKLFIRRIGRVEDGAGVVVR*
Ga0157285_101818581	3300012897	Soil	LLISLPSEQGPALEAEFEADKLFIRRIGRVEEGFGVQVQ*
Ga0157283_100347741	3300012907	Soil	VSVAGERAAALEAEFESRKLFVRRVGHVEEGAGVVVE*
Ga0162650_1000433091	3300012939	Soil	SGGLLVSIPALQGPVLEAEFAERRLFLRRIGSVEEGTGVIVE*
Ga0164309_104536853	3300012984	Soil	LVFLLYDRGAALEAEFSTRRLFLRRIGRVEEGIGVVVE*
Ga0164309_111131992	3300012984	Soil	LLVSLPAQQGAALEAEFAARRLFLRRIGRVEEGAGVYVE*
Ga0157380_128260672	3300014326	Switchgrass Rhizosphere	LVSVPAERGAALEAEFSSRRLFIRRIGSVEEGAGVTVS*
Ga0182008_107284291	3300014497	Rhizosphere	GGLLVAIPSERGPALEAEFGSRKLFIRRVGAVEEGSGVVVE*
Ga0132257_1035418122	3300015373	Arabidopsis Rhizosphere	LPADRGPAMEAEFTARKLFIRRIGRVESGAGVTVV*
Ga0184605_102517022	3300018027	Groundwater Sediment	ISGERAPALQAEFESHKLFIRRVGRVEEGAGVVVE
Ga0184620_102680742	3300018051	Groundwater Sediment	LVSLPAEQGAALEAEFAARRLFLRRIGRVEEGAGVFVE
Ga0184626_103804442	3300018053	Groundwater Sediment	LVALPSEHGAVLEAEFTSKRFFLRRVGTVEEGSGVLVV
Ga0066655_101288401	3300018431	Grasslands Soil	SLPAEQGPALEAEFGARRLFVRRIGRVEEGSGVVVQ
Ga0066662_119053371	3300018468	Grasslands Soil	TLPAEHGAALEAEFTARKLFIRRIGRVEEGAGVLVR
Ga0173482_107586312	3300019361	Soil	GLLISLPSEQGPALEAEFEARKLFIRRIGRVEEGSGVQVQ
Ga0193697_11246562	3300020005	Soil	LVSIPAERAAALEAEFESRKLFIRRVGRVEEGSGVVVG
Ga0182009_105130991	3300021445	Soil	VSLPGEQASALEAEFMARGLFVRRIGSVEEGVGVVVE
Ga0222623_103401801	3300022694	Groundwater Sediment	PAEQSATLEAEFAARKLFLRRVGAVEEGSGVVVAG
Ga0247799_10067841	3300023072	Soil	VAGERAAALEAEFESRKLFVRRVGHVEEGAGVVVE
Ga0207663_101442753	3300025916	Corn, Switchgrass And Miscanthus Rhizosphere	GLLISLPSEQGPALEADFEAHKLFIRRIGRVEEGFGVQVQ
Ga0207652_101360871	3300025921	Corn Rhizosphere	SVPAERGPALEAEFESGKLFIRRVGRVEEGSGVVVA
Ga0207646_102582893	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	SLPADRGAALEAEFTTKRLFIRRIGRVEEGNGVVVE
Ga0207700_100514495	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	SLPSEQGSALEAEFEAHKLFIRRIGRVEEGSGVLVQ
Ga0207712_107226783	3300025961	Switchgrass Rhizosphere	LPSEQGPALEAEFEAHKLFIRRIGRVEEGFGVQVQ
Ga0207640_101216854	3300025981	Corn Rhizosphere	SLPGDRGAALEAEFASRKLFVRRVGRVEEGQGVVVE
Ga0207702_113453122	3300026078	Corn Rhizosphere	GLLVTIPAERGPALEAEFESRKLFLRRVGRVEEGAGVSVT
Ga0207675_1015976901	3300026118	Switchgrass Rhizosphere	SVPPERGPMLEAEFAARHLFLRRIGAVEEGSGVYVE
Ga0209153_10705783	3300026312	Soil	GGLLVSVPAERGAVLEAEFAARRLFIRRVGSVEEGSGVVVD
Ga0209058_12752311	3300026536	Soil	VSLPSEQGPALEAEFAKRRLFVRRIGRVEEGAGLFVE
Ga0209485_12625332	3300027691	Agricultural Soil	GLLVSLPHERGPALEAEFERNGLFIRRIGSVEEGAGVLVR
Ga0209177_104122461	3300027775	Agricultural Soil	GLLVSIAADRAPALEAEFDSRKLFIRRVGRVEEGAGVVVE
Ga0209701_104489661	3300027862	Vadose Zone Soil	GGLLVSLPAQQGPALEAEFAAQRLFLRRIGSVEEGSGVYVE
Ga0307276_101267912	3300028705	Soil	SIPAERGPALEAEFASRKLFVRRVGRVEEGAGVVVE
Ga0307311_100683361	3300028716	Soil	LPAERGAALEAEFAGRRLFIRRIGRVEEGAGVIVE
Ga0307311_101104283	3300028716	Soil	SLPAEQGAALEAEFAARRLFLRRIGRVEEGAGVFVE
Ga0307301_100089634	3300028719	Soil	LLVSLPAEQGPTLEAEFGARRLFLRRIGSVEEGSGIYVE
Ga0307301_102472532	3300028719	Soil	SLSAEKGAALEAEFEGRWLFLRRIGSVEEGSGVVVE
Ga0307316_100139834	3300028755	Soil	VPAERGAALEAEFGARKLFIRRIGRVEEGAGVVVE
Ga0307320_102185561	3300028771	Soil	GLLVSVSGERAPALQAEFESRKLFVRRVGRVEEGAGVVVE
Ga0307288_103470661	3300028778	Soil	VSLPSQQGAALEAEFAARRLFLRRVGTVDAGAGVLVV
Ga0307323_100705501	3300028787	Soil	GGLLISLPSEQGPALEADFEAHKLFIRRIGRVEEGFGVQVQ
Ga0307305_100517071	3300028807	Soil	GGLLVSAPPERGPVLEAEFAARHLFLRRIGAVEEGAGVYVD
Ga0307294_100678283	3300028810	Soil	IPGERAPALEAEFQSRKLFVRRVGRVEEGAGVIVE
Ga0307292_100674013	3300028811	Soil	SIPAERAPALEAEFESRKLFVRRVGRVEEGAGVVVS
Ga0307302_107068842	3300028814	Soil	LVSVPAERGPALEAEFGARKLFIRRIGRVEEGAGVVVE
Ga0307278_104266551	3300028878	Soil	GLLVSMPVERGAVLEAEFQAKSSFLRRVGRVEEGSGVVVE
Ga0307300_101654742	3300028880	Soil	LVTLPAEQSATLEAEFATRKLFLRRVGAIEEGSGVVVAG
Ga0247826_102732683	3300030336	Soil	SLPARQAPVLEAEFGERRLFLRRVGVVEEGSGVVVE
Ga0247826_112474291	3300030336	Soil	LPADKAPVLQAEFESRKLFACRVGRVVEGSGVALR
Ga0247826_112781281	3300030336	Soil	LISIPADRGPALEAEFLSRRLFIRRIGSVEEGSGVVVQ
Ga0268241_101301911	3300030511	Soil	SLPAERGAALEAEFAAKKLFIRRIGRVEEGVGVVVE
Ga0308187_102276042	3300031114	Soil	SLPAEQGPALEAAFAERRLFIRRIGRVEEGAGVFVE
Ga0307469_111670403	3300031720	Hardwood Forest Soil	LVTLPAERGPALEAEFAARRLFIRRIGRVEEGAGVIVE
Ga0307407_111767171	3300031903	Rhizosphere	LVSVAGERAPALEAEFASRRLFIRRVGRVEEGAGVLVE
Ga0306921_126227951	3300031912	Soil	TVPAERGPALEAEFGAKKLFIRRIGSVEEGAGVLVG
Ga0308174_119531401	3300031939	Soil	SIPAERGAALEAEFAARKLFIRRIGSVEEGSGVVVE
Ga0310885_106077401	3300031943	Soil	LPADQGAALEAEFDARRLFIRRIGRVEEGSGVVVE
Ga0314796_170559_2_130	3300034671	Soil	AGGLLVSIAADRGPALEAEYDSRKLFIRRVGRVEEGAGVVVE

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.47
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.47
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F096785

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign