| Basic Information | |
|---|---|
| Family ID | F096784 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MLTATEIAGFAGAGLAGAAYVPQISHLIRARCSAGISRL |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 0.00 % |
| % of genes from short scaffolds (< 2000 bps) | 0.00 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (100.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (33.654 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.615 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.154 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.22% β-sheet: 0.00% Coil/Unstructured: 44.78% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF00440 | TetR_N | 13.46 |
| PF13560 | HTH_31 | 8.65 |
| PF02566 | OsmC | 5.77 |
| PF01381 | HTH_3 | 5.77 |
| PF13649 | Methyltransf_25 | 4.81 |
| PF00196 | GerE | 3.85 |
| PF08241 | Methyltransf_11 | 3.85 |
| PF09206 | ArabFuran-catal | 1.92 |
| PF00561 | Abhydrolase_1 | 1.92 |
| PF13374 | TPR_10 | 1.92 |
| PF04193 | PQ-loop | 1.92 |
| PF04237 | YjbR | 0.96 |
| PF09948 | DUF2182 | 0.96 |
| PF01527 | HTH_Tnp_1 | 0.96 |
| PF11199 | DUF2891 | 0.96 |
| PF01544 | CorA | 0.96 |
| PF12697 | Abhydrolase_6 | 0.96 |
| PF01259 | SAICAR_synt | 0.96 |
| PF00465 | Fe-ADH | 0.96 |
| PF13424 | TPR_12 | 0.96 |
| PF12679 | ABC2_membrane_2 | 0.96 |
| PF00355 | Rieske | 0.96 |
| PF00890 | FAD_binding_2 | 0.96 |
| PF08327 | AHSA1 | 0.96 |
| PF13302 | Acetyltransf_3 | 0.96 |
| PF13191 | AAA_16 | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 5.77 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 5.77 |
| COG0152 | Phosphoribosylaminoimidazole-succinocarboxamide synthase | Nucleotide transport and metabolism [F] | 0.96 |
| COG0337 | 3-dehydroquinate synthetase | Amino acid transport and metabolism [E] | 0.96 |
| COG0371 | Glycerol dehydrogenase or related enzyme, iron-containing ADH family | Energy production and conversion [C] | 0.96 |
| COG0598 | Mg2+ and Co2+ transporter CorA | Inorganic ion transport and metabolism [P] | 0.96 |
| COG1454 | Alcohol dehydrogenase, class IV | Energy production and conversion [C] | 0.96 |
| COG1979 | Alcohol dehydrogenase YqhD, Fe-dependent ADH family | Energy production and conversion [C] | 0.96 |
| COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 100.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 33.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.46% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 8.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.73% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.77% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.85% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.92% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.92% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.92% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.96% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.96% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.96% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.96% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.96% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.96% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.96% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006937 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A01 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012493 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deepsgr_01581770 | 2199352025 | Soil | MSPKGSQMTTTEIAGFVGAGLAGAGYVPQITHLIRARCS |
| JGI10216J12902_1139398452 | 3300000956 | Soil | MTITEIAGFAGAGLAGAAYVPQISHLIRARCSAGIS |
| Ga0062387_1002366622 | 3300004091 | Bog Forest Soil | MLTITQIAGFAGAGLAGAAYVPQVSHLIRARCSAGISRLA |
| Ga0066388_1018467911 | 3300005332 | Tropical Forest Soil | MLTATQIGGFVGAGLAGAAYMPQISHLIRARCSAGISQLAF |
| Ga0070663_1008491782 | 3300005455 | Corn Rhizosphere | MEPAMLTITEIAGFAGAGLAGAAYIPQISHLIRARCSAGISRLAFE |
| Ga0066903_1012818954 | 3300005764 | Tropical Forest Soil | MLTATEIAGFVGAGLAGMAYVPQISHLIRARCSAGISRL |
| Ga0066903_1047173981 | 3300005764 | Tropical Forest Soil | MLIATQIGGFVGAGLAGAAYIPQISHLIRAHCSAGISRLAF |
| Ga0066903_1060850491 | 3300005764 | Tropical Forest Soil | MLIAMQIGGFVGAGLAGAAYIPQISHLIRARCSAGIS |
| Ga0066903_1073605501 | 3300005764 | Tropical Forest Soil | VNDVLTATEIAGYVGAGLSGAAYVPQISHLIRARCSAGI |
| Ga0066903_1082321933 | 3300005764 | Tropical Forest Soil | MLTATQIGGFAGAGLAGAAYVPQISHLVRARCSAGISRL |
| Ga0075015_1007976961 | 3300006102 | Watersheds | MLTTTEIAGFAGAGLAGAAYVPQISHLIRARCSAGISRLAFEVW |
| Ga0075425_1018622551 | 3300006854 | Populus Rhizosphere | MLTITEIAGLPAPGWPEQAYIPQISHLIRARCSAGISRLAFEVWL |
| Ga0075424_1020050052 | 3300006904 | Populus Rhizosphere | MLTITEIAGFAGAGLAGAAYVPQISRLIRAHCSAGISRLAFEVW |
| Ga0081243_14215812 | 3300006937 | Tropical Rainforest Soil | VLTITEAVGFVGAGLAGAAYLPQISRLIRARCSAGISRLA |
| Ga0126373_104170122 | 3300010048 | Tropical Forest Soil | MSYLTMLTATEIAGFIGAGLAGAAYVPQVYHLIRARCSAGPV |
| Ga0126373_104463073 | 3300010048 | Tropical Forest Soil | MDMSITEVAGFAGAGLAGAAYVPQISHLIKARCSAG |
| Ga0126373_132927332 | 3300010048 | Tropical Forest Soil | MLTATQIGGFIGAVLAGAAYVPQISHLIRARCSAG |
| Ga0126372_100519901 | 3300010360 | Tropical Forest Soil | MAITQIAGFAGAGLAGAAYVPQISHLIRARCSAGISRLA |
| Ga0126372_107920173 | 3300010360 | Tropical Forest Soil | MLTTTQIAGFVGAGLAGAAYVPQISHLIRVRCSAGMSRLAFEVWLLA* |
| Ga0126372_122573142 | 3300010360 | Tropical Forest Soil | MTATEIAGFAGAGLAGAAYVPQISHLIRARCSAGISRLAFE |
| Ga0126378_101471031 | 3300010361 | Tropical Forest Soil | MLTATEIAGFAGAGLAGAAYVPQISHLIRARCSAGI |
| Ga0126378_108340931 | 3300010361 | Tropical Forest Soil | MTTLGPAMLTATEIAGFIGAGLAGAAYVPQISHLIRARCSAGISRLAFEV |
| Ga0126378_120330252 | 3300010361 | Tropical Forest Soil | VLTTTEIAGFIGAGLAGAAYVPQISHLIRARCSAGISRL |
| Ga0126378_120990912 | 3300010361 | Tropical Forest Soil | MTVLGPTMLTATEIAGFVGAALAGAAYVPQISHLIRARCSAGISRLAFE |
| Ga0126381_1030488421 | 3300010376 | Tropical Forest Soil | MYRRGRKMSTTEIAGFVGAGLAGAAYVPQISHLIRARCSAGIS |
| Ga0134126_107271392 | 3300010396 | Terrestrial Soil | MLTATEIAGFAGAGLAGAAYVPQISHLVRARCSAG |
| Ga0126383_104506941 | 3300010398 | Tropical Forest Soil | MLTATEIAGFVGAGLAGAAYVPQISHLIRARCSAGISRLAFE |
| Ga0126383_121962662 | 3300010398 | Tropical Forest Soil | MLTATEIAGFVGAGLAGAAYVPQVSHLIRARCSAGISR |
| Ga0134127_121191292 | 3300010399 | Terrestrial Soil | MEPAMLTITEIAGFAGAGLAGAAYIPQISHLIRARCWP |
| Ga0137776_14753482 | 3300010937 | Sediment | MTASAAAVTEIAGFVGAGLAGAGYVPQISHLIRARCSAGIS |
| Ga0150984_1183976001 | 3300012469 | Avena Fatua Rhizosphere | MEPAMLTVTEIAGFAGAGLAGAGYVPQVVHMIRSRCSAGISQPAF |
| Ga0157344_10276062 | 3300012476 | Arabidopsis Rhizosphere | MLTITEIAGFAGAGLAGAAYIPQISHLIRARCSAGISRL |
| Ga0157355_10426612 | 3300012493 | Unplanted Soil | MLTITEIAGFAGAGLAGAAYIPQISHLIRARCSAGISRLA |
| Ga0126369_110435491 | 3300012971 | Tropical Forest Soil | MAPAMLTATEIAGFVGAGLAGAAYVPQVSHLVRARCSAG |
| Ga0132255_1002241213 | 3300015374 | Arabidopsis Rhizosphere | MEPAMLTITEIAGFAGAGLAGAAYIPQISHLIRARCSAGGIRRPGP* |
| Ga0182041_102910751 | 3300016294 | Soil | MLTATQIGGFAGAGLAGAAYLPQISHLIRARCSAGISRL |
| Ga0187814_104365311 | 3300017932 | Freshwater Sediment | MLTATEIAGFAGAGLAGAAYIPQISHLIRARCSAGIS |
| Ga0187779_100116181 | 3300017959 | Tropical Peatland | MLTATEIAGFAGAGLAGAAYIPQISRLIRARCSAGIS |
| Ga0187780_109584301 | 3300017973 | Tropical Peatland | MLTATQIGGFAGAGLAGAGYLPQISHLVRVRCSAGISR |
| Ga0187766_111202151 | 3300018058 | Tropical Peatland | MLIATQIGGFVGAALAGAAYVPQISHLIRARCSAGISRL |
| Ga0187765_108888201 | 3300018060 | Tropical Peatland | MLTATQIGGFVGAGLAGAAYVPQISHLVRARCSAGISRLA |
| Ga0206356_116364861 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTATEIAGFAGAGLAGAAYVPQISHLVRARCSAGISRLAFE |
| Ga0210401_104951422 | 3300020583 | Soil | MLTTTQIAGFVGAGLAGAAYIPQISHLIRARCSAGIS |
| Ga0210401_105824041 | 3300020583 | Soil | MNQMLTATEIAGFVGAGLAGAAYIPQISHLIRAHCSAGISR |
| Ga0210397_115444341 | 3300021403 | Soil | MLTATQIAGFAGAGLAGAACVPQISHLIRARCSAGIS |
| Ga0210387_104445732 | 3300021405 | Soil | MLTATEIAGFAGAGLAGAAYVPQISHLVRARCSAGIS |
| Ga0210384_101841481 | 3300021432 | Soil | MLTITEIAGFAGAGLAGAAYIPQISHLIRARCSAGI |
| Ga0210402_119111412 | 3300021478 | Soil | MLTITQIAGFAGVGLAGAAYVPQISRLIRARCSAGISRLAFE |
| Ga0207692_1000056212 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTATEIAGFAGAGLAGAAYVPQISHLVRARCSAGISR |
| Ga0207685_103644782 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTATEIAGFAGAGLAGAAYVPQISHLVRARCSAGISRL |
| Ga0207693_106907241 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTATQIGGFVGAGLAGAAYVPQIFHLIRARCSAGISRLAFG |
| Ga0207700_114778291 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTITEIAGFAGAGLAGAAYVPQISRLIRAHCSAGISRLASA |
| Ga0207702_102356763 | 3300026078 | Corn Rhizosphere | MLTITEIAGFAGAGLAGAAYVPQISRLIRAHCSAGISRLAF |
| Ga0209073_104020672 | 3300027765 | Agricultural Soil | MLTITEIAGFAGAGLAGAAYVPQISRLIRARCSAGISRLAFEVWL |
| Ga0209177_104284702 | 3300027775 | Agricultural Soil | MAITEIAGFAGAGLAGSAYVPQIAHLVRARCAAGISRL |
| Ga0209112_101759043 | 3300027817 | Forest Soil | MEPAMLTITEIAGFAGAGLAGAAYIPQISHLIRARCSAGISR |
| Ga0209693_101121432 | 3300027855 | Soil | MLTATEFAGFAGAGLAGAAYVPQISHLIRARCSAGISWLAF |
| Ga0268386_107601562 | 3300030619 | Soil | LSGVLTVTEIAGYIGVGLAGAAYVPQIWHLVRVHCSAG |
| Ga0318534_104735331 | 3300031544 | Soil | MLTATQIGGFAGAGLAGAAYLPQISHLIRARCSAGISRLAFG |
| Ga0318534_107728831 | 3300031544 | Soil | MLTATQIGGFVGAGLAGAAYVPQISHVIRARCSAGISQ |
| Ga0318538_102071602 | 3300031546 | Soil | MLTATQIAGFVGAGLAGMAYVPQISHLIRARCSAGISRLAF |
| Ga0318573_106952931 | 3300031564 | Soil | MGPAMLTATEIAGFAGAGLAGAAYVPQISHLVRARCSAG |
| Ga0318555_107866342 | 3300031640 | Soil | MAYPDGSAMLTATEIAGFVGAGLAGAAYIPQISHLIRARCSAGISRLAF |
| Ga0318561_103107611 | 3300031679 | Soil | MLTATEIAGFAGAGLAGAAYVPQVSHLIRARCSAGIS |
| Ga0318574_109023582 | 3300031680 | Soil | MILTATEIAGFVGAGLAGAAYIPQISHLIRARCSAGISRLA |
| Ga0318496_107978361 | 3300031713 | Soil | MLTATQIGGFVGAGLAGAAYVPQISHLVRARCSAGISQLAFRVWLL |
| Ga0306917_100215906 | 3300031719 | Soil | MLNATEIAGFVGAGLAGAAYIPQISHLIRARCSAGI |
| Ga0318501_107805171 | 3300031736 | Soil | MLTATEIAGFVGAGLAGAAYVPQISHLIRARCSAGISRLAFAV |
| Ga0318502_107420821 | 3300031747 | Soil | MILTATEIAGFVGAGLAGAAYIPQISHLIRARCSAGIS |
| Ga0318494_103502251 | 3300031751 | Soil | MLTATQIGGFAGAGLAGAAYLPQISHLIRARCSAGISR |
| Ga0318548_105161202 | 3300031793 | Soil | MLTATQIGGFAGAGLAGAAYLPQISHLIRARCSAGISRLAFGV |
| Ga0318497_101640452 | 3300031805 | Soil | MLTATEIAGFAGAGLAGAAYVPQVSHLIRARCSAGISRL |
| Ga0318567_104899371 | 3300031821 | Soil | MLTATEIAGFAGAGLAGAAYVPQVSHLIRARCSAS |
| Ga0318564_102846982 | 3300031831 | Soil | MTATEIAGFAGAGLAGAAYVPQISHLVRARCSAGI |
| Ga0318512_103115881 | 3300031846 | Soil | MLTATQIGGFAGAGLAGAAYLPQISHLIRARCSAG |
| Ga0318544_104316911 | 3300031880 | Soil | MLTATEIAGFAGAGLAGAAYVPQVSHLIRARCSGG |
| Ga0318522_101664071 | 3300031894 | Soil | MLTATQIGGVVGAGLAGAAYVPQIFHLIRAHCSAGISRL |
| Ga0306923_120717511 | 3300031910 | Soil | MLTATQIGGFAGAGLAGAAYLPQISHLIRVRCSAG |
| Ga0306921_100312369 | 3300031912 | Soil | MLTATEIAGFVGAGLAGAAYVPQIAHLIRARCSAGISRLAFEV |
| Ga0306921_106847861 | 3300031912 | Soil | MAPAMLTATEIAGFVGAGLAGAAYVPQVSHLVRAR |
| Ga0310910_105876051 | 3300031946 | Soil | MLTTTEIAGFVGAGLAGAAYVPQISHLIRARCSAGIS |
| Ga0306922_122733403 | 3300032001 | Soil | MLTATEIAGFVGAGLAGAAYVPQIAHLIRARCSAGIS |
| Ga0318562_102790341 | 3300032008 | Soil | MLTVTQIGGFVGAGLAGAGYLPQISHLIRARCAAGISRLA |
| Ga0318563_103666871 | 3300032009 | Soil | MLTATEIAGFAGAGLAGAAYVPQISHLIRARRAQR |
| Ga0318507_101632581 | 3300032025 | Soil | MLTTTEIAGFVGAGLAGAAYVPQISHLIRARCSAGISRLAFEVW |
| Ga0318514_107968101 | 3300032066 | Soil | MLTATQIGGFVGAGLAGAAYVPQISHLIRARCSAGISRLAFG |
| Ga0318524_107080122 | 3300032067 | Soil | MTTLGPAMLTATEIAGFTGAGLAGAAYVPQISHLIRARCSAGISR |
| Ga0308173_101756531 | 3300032074 | Soil | MLTITEIAGFAGTGLAGAAYVPQISRLIRARCSAGISR |
| Ga0306924_118655751 | 3300032076 | Soil | MLTATEIAGFAGAGLAGTAYVPQISHLIRARCSAGI |
| Ga0318525_102851481 | 3300032089 | Soil | MLTATEIAGFAGAGLAGAAYVPQVSHLIRARCSGGI |
| Ga0318525_106124451 | 3300032089 | Soil | MLTTTEIAGFIGAGLAGAAYIPQISHLIRAHCSAGISR |
| Ga0318518_101755711 | 3300032090 | Soil | MLTATQIGGFVGAGLAGAAYVPQISHVIRARCSAGI |
| Ga0318518_106154762 | 3300032090 | Soil | MGPAMLTATEIAGFAGAGLAGAAYVPQISHLIRARCSAGI |
| Ga0335070_102564643 | 3300032829 | Soil | MNQMLTATEIAGFAGAGLAGAAYVPQISHLIRARCSAGIS |
| Ga0335081_126525041 | 3300032892 | Soil | MEPAMLTTTEIAGFVGVGLAGAAYVPQISHLIRAHCSAGISR |
| Ga0335083_107383601 | 3300032954 | Soil | MLTATQIGGFVGAGLAGAAYVPQISHLVRAHCSAGISR |
| Ga0335083_114591841 | 3300032954 | Soil | MLTITQIGGFAGAGLAGAAYVPQISHLVRARCSAGI |
| Ga0335083_115555411 | 3300032954 | Soil | MLTITQIGGFAGAGLAGAAYVPQISHLVRARCSAGISR |
| Ga0335073_111023941 | 3300033134 | Soil | MNQLLTATEIAGFAGAGLAGAAYVPQISHLIRARCSAGISRLAF |
| Ga0335073_113622361 | 3300033134 | Soil | MLTATEIAGFVGAGLAGAAYVPQISHLVRARCSAG |
| Ga0335077_104293571 | 3300033158 | Soil | MLTTTEIAGFAGAGLAGAAYVPQISRLIRAHCSAGISRLAF |
| Ga0335077_120105321 | 3300033158 | Soil | MLTATEIAGFAGAGLAGAAYVPQISHLIRARCSAGISRL |
| Ga0318519_109931042 | 3300033290 | Soil | MLTATEIAGFAGAGLAGAAYVPQIAHLIRARCSAGIS |
| Ga0314866_022796_812_925 | 3300033807 | Peatland | MLTTTEIAGFFGAGLAGAAYVPQISHLIRARCSAGISR |
| ⦗Top⦘ |