Basic Information | |
---|---|
Family ID | F096781 |
Family Type | Metagenome |
Number of Sequences | 104 |
Average Sequence Length | 39 residues |
Representative Sequence | VGTSLAAEPLLSLAVTVTSEQRVESVLQSIVQGLASQ |
Number of Associated Samples | 76 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 97.12 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 94.23 % |
Associated GOLD sequencing projects | 71 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.41 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (57.692 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (26.923 % of family members) |
Environment Ontology (ENVO) | Unclassified (37.500 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.808 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.15% β-sheet: 0.00% Coil/Unstructured: 53.85% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF00158 | Sigma54_activat | 5.77 |
PF02502 | LacAB_rpiB | 4.81 |
PF02954 | HTH_8 | 2.88 |
PF12833 | HTH_18 | 2.88 |
PF02780 | Transketolase_C | 0.96 |
PF04542 | Sigma70_r2 | 0.96 |
PF00440 | TetR_N | 0.96 |
PF01740 | STAS | 0.96 |
PF02518 | HATPase_c | 0.96 |
PF01654 | Cyt_bd_oxida_I | 0.96 |
PF07724 | AAA_2 | 0.96 |
PF03707 | MHYT | 0.96 |
PF07690 | MFS_1 | 0.96 |
PF00456 | Transketolase_N | 0.96 |
PF00196 | GerE | 0.96 |
PF13620 | CarboxypepD_reg | 0.96 |
PF00072 | Response_reg | 0.96 |
COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
---|---|---|---|
COG0698 | Ribose 5-phosphate isomerase RpiB | Carbohydrate transport and metabolism [G] | 4.81 |
COG0021 | Transketolase | Carbohydrate transport and metabolism [G] | 0.96 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.96 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.96 |
COG1271 | Cytochrome bd-type quinol oxidase, subunit 1 | Energy production and conversion [C] | 0.96 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.96 |
COG3300 | MHYT domain, NO-binding membrane sensor | Signal transduction mechanisms [T] | 0.96 |
COG3959 | Transketolase, N-terminal subunit | Carbohydrate transport and metabolism [G] | 0.96 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.96 |
COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.96 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 57.69 % |
All Organisms | root | All Organisms | 42.31 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000559|F14TC_103509652 | Not Available | 607 | Open in IMG/M |
3300000955|JGI1027J12803_103711356 | Not Available | 513 | Open in IMG/M |
3300000955|JGI1027J12803_104400439 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
3300000955|JGI1027J12803_106328948 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter riparius | 556 | Open in IMG/M |
3300004091|Ga0062387_100934867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli 8C-3 | 659 | Open in IMG/M |
3300004092|Ga0062389_102699026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli 8C-3 | 662 | Open in IMG/M |
3300004268|Ga0066398_10145346 | Not Available | 591 | Open in IMG/M |
3300005332|Ga0066388_100153683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 2883 | Open in IMG/M |
3300005332|Ga0066388_107787236 | Not Available | 536 | Open in IMG/M |
3300005445|Ga0070708_100682115 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
3300005546|Ga0070696_100252736 | All Organisms → cellular organisms → Bacteria | 1333 | Open in IMG/M |
3300005549|Ga0070704_101908100 | Not Available | 551 | Open in IMG/M |
3300006854|Ga0075425_102556769 | Not Available | 565 | Open in IMG/M |
3300006914|Ga0075436_100084119 | All Organisms → cellular organisms → Bacteria | 2208 | Open in IMG/M |
3300006969|Ga0075419_11287960 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300007265|Ga0099794_10410803 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 707 | Open in IMG/M |
3300009092|Ga0105250_10237568 | Not Available | 776 | Open in IMG/M |
3300009176|Ga0105242_11405805 | Not Available | 725 | Open in IMG/M |
3300009177|Ga0105248_11308710 | Not Available | 820 | Open in IMG/M |
3300009177|Ga0105248_13036628 | Not Available | 534 | Open in IMG/M |
3300009551|Ga0105238_11080952 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter riparius | 824 | Open in IMG/M |
3300009792|Ga0126374_10839155 | Not Available | 706 | Open in IMG/M |
3300010043|Ga0126380_10055962 | All Organisms → cellular organisms → Bacteria | 2158 | Open in IMG/M |
3300010043|Ga0126380_10855621 | Not Available | 750 | Open in IMG/M |
3300010046|Ga0126384_11606571 | Not Available | 612 | Open in IMG/M |
3300010047|Ga0126382_10487307 | Not Available | 987 | Open in IMG/M |
3300010047|Ga0126382_11294420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa acidisoli | 659 | Open in IMG/M |
3300010048|Ga0126373_11115790 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus | 855 | Open in IMG/M |
3300010048|Ga0126373_12072329 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter riparius | 631 | Open in IMG/M |
3300010358|Ga0126370_10033742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 3112 | Open in IMG/M |
3300010358|Ga0126370_10985667 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300010358|Ga0126370_11884969 | Not Available | 581 | Open in IMG/M |
3300010358|Ga0126370_12349917 | Not Available | 528 | Open in IMG/M |
3300010360|Ga0126372_11137342 | Not Available | 801 | Open in IMG/M |
3300010360|Ga0126372_11533322 | Not Available | 703 | Open in IMG/M |
3300010360|Ga0126372_11657793 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300010360|Ga0126372_12399853 | Not Available | 578 | Open in IMG/M |
3300010360|Ga0126372_12499821 | Not Available | 567 | Open in IMG/M |
3300010361|Ga0126378_11596627 | Not Available | 740 | Open in IMG/M |
3300010366|Ga0126379_10226798 | All Organisms → cellular organisms → Bacteria | 1820 | Open in IMG/M |
3300010366|Ga0126379_11963334 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
3300010376|Ga0126381_102186275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus | 796 | Open in IMG/M |
3300010376|Ga0126381_102255226 | Not Available | 782 | Open in IMG/M |
3300010398|Ga0126383_10984989 | Not Available | 931 | Open in IMG/M |
3300010401|Ga0134121_11081322 | Not Available | 793 | Open in IMG/M |
3300012205|Ga0137362_10970262 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300012971|Ga0126369_11211181 | Not Available | 845 | Open in IMG/M |
3300012971|Ga0126369_13338258 | Not Available | 526 | Open in IMG/M |
3300012971|Ga0126369_13528935 | Not Available | 512 | Open in IMG/M |
3300013104|Ga0157370_11294666 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300016270|Ga0182036_10970752 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300016341|Ga0182035_10451367 | Not Available | 1090 | Open in IMG/M |
3300016341|Ga0182035_11342486 | Not Available | 641 | Open in IMG/M |
3300016341|Ga0182035_11350559 | Not Available | 639 | Open in IMG/M |
3300016371|Ga0182034_12003953 | Not Available | 512 | Open in IMG/M |
3300016404|Ga0182037_10909650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 763 | Open in IMG/M |
3300016404|Ga0182037_11994865 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus | 521 | Open in IMG/M |
3300016422|Ga0182039_10357231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1228 | Open in IMG/M |
3300016445|Ga0182038_11220160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 671 | Open in IMG/M |
3300021046|Ga0215015_10602324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli 8C-3 | 575 | Open in IMG/M |
3300021171|Ga0210405_10018517 | All Organisms → cellular organisms → Bacteria | 5685 | Open in IMG/M |
3300021361|Ga0213872_10327487 | Not Available | 632 | Open in IMG/M |
3300021478|Ga0210402_10707891 | Not Available | 930 | Open in IMG/M |
3300021560|Ga0126371_10926221 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
3300021560|Ga0126371_13237570 | Not Available | 550 | Open in IMG/M |
3300025924|Ga0207694_10917559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter riparius | 741 | Open in IMG/M |
3300025939|Ga0207665_11521142 | Not Available | 532 | Open in IMG/M |
3300025942|Ga0207689_10613566 | Not Available | 915 | Open in IMG/M |
3300026088|Ga0207641_11855447 | Not Available | 604 | Open in IMG/M |
3300031545|Ga0318541_10169321 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
3300031546|Ga0318538_10125354 | All Organisms → cellular organisms → Bacteria | 1344 | Open in IMG/M |
3300031564|Ga0318573_10286925 | Not Available | 880 | Open in IMG/M |
3300031573|Ga0310915_10315081 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
3300031640|Ga0318555_10403612 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
3300031682|Ga0318560_10211685 | Not Available | 1037 | Open in IMG/M |
3300031723|Ga0318493_10382455 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300031751|Ga0318494_10644480 | Not Available | 620 | Open in IMG/M |
3300031781|Ga0318547_10846511 | Not Available | 570 | Open in IMG/M |
3300031782|Ga0318552_10559732 | Not Available | 584 | Open in IMG/M |
3300031795|Ga0318557_10555637 | Not Available | 527 | Open in IMG/M |
3300031819|Ga0318568_10797754 | Not Available | 586 | Open in IMG/M |
3300031833|Ga0310917_10173693 | Not Available | 1432 | Open in IMG/M |
3300031896|Ga0318551_10680838 | Not Available | 595 | Open in IMG/M |
3300031910|Ga0306923_12231063 | Not Available | 548 | Open in IMG/M |
3300031912|Ga0306921_10818848 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1062 | Open in IMG/M |
3300031942|Ga0310916_10935585 | Not Available | 725 | Open in IMG/M |
3300031946|Ga0310910_10079509 | All Organisms → cellular organisms → Bacteria | 2385 | Open in IMG/M |
3300031946|Ga0310910_10756751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus | 766 | Open in IMG/M |
3300031946|Ga0310910_10919703 | Not Available | 686 | Open in IMG/M |
3300031954|Ga0306926_10970917 | Not Available | 1013 | Open in IMG/M |
3300031954|Ga0306926_12745190 | Not Available | 533 | Open in IMG/M |
3300031962|Ga0307479_10664406 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1022 | Open in IMG/M |
3300032001|Ga0306922_10297808 | Not Available | 1732 | Open in IMG/M |
3300032001|Ga0306922_12425449 | Not Available | 500 | Open in IMG/M |
3300032042|Ga0318545_10139973 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
3300032059|Ga0318533_10298628 | Not Available | 1168 | Open in IMG/M |
3300032059|Ga0318533_11332994 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus | 524 | Open in IMG/M |
3300032076|Ga0306924_12613739 | Not Available | 503 | Open in IMG/M |
3300032091|Ga0318577_10452601 | Not Available | 613 | Open in IMG/M |
3300032174|Ga0307470_10642437 | Not Available | 800 | Open in IMG/M |
3300032174|Ga0307470_11436731 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300032180|Ga0307471_101681012 | Not Available | 789 | Open in IMG/M |
3300032828|Ga0335080_11407645 | Not Available | 693 | Open in IMG/M |
3300033290|Ga0318519_10796683 | Not Available | 581 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 26.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 24.04% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.38% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.85% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.88% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.88% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.88% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.88% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.92% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.92% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.96% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Host-Associated | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
F14TC_1035096522 | 3300000559 | Soil | VGNSLAAESLLSLAVAVTSEHRVESALQRIVEGLAAQPGVALS |
JGI1027J12803_1037113561 | 3300000955 | Soil | VGTSLAAEPLLALAVTVTSEQRVDSVLHSIVQGLASQP |
JGI1027J12803_1044004392 | 3300000955 | Soil | VRSVVKTSLEAEQLLSIAVTVTSEQRVESVLQRTVQG |
JGI1027J12803_1063289481 | 3300000955 | Soil | VGTSLAAEPLLALAVTVTSEQHVDSVLASIVEGLA |
Ga0062387_1009348671 | 3300004091 | Bog Forest Soil | MVNLVETSLTAEPLLSLAVNVTSEHRVDSVLQSIVQGLASQPGV |
Ga0062389_1026990261 | 3300004092 | Bog Forest Soil | MVNLVETSLTAEPLLSLAVNVTSEHRVDSVLQSIVQGLASQPGVA |
Ga0066398_101453461 | 3300004268 | Tropical Forest Soil | VGTSLAAEPLLALAVTVTSEQRVDSVLQSIVQGLASQPGV |
Ga0066388_1001536833 | 3300005332 | Tropical Forest Soil | VGTSLAAEPLLALAVTVTSEQQVDSVLHSIVQGLASQPGVAL |
Ga0066388_1077872361 | 3300005332 | Tropical Forest Soil | VGSSLAAEPLLALAVTVTSEQQVDSVLHSIVQGLASQPGVAL |
Ga0070708_1006821152 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLAAEPLLSLAVTVTSEQRVESVLRNIVQGLASQPGVALT |
Ga0070696_1002527361 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VSTPPATSLAAESLLSLAVTVTSEQYVESVLHSIVDGLAAQPGVA |
Ga0070704_1019081001 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VGNSLAAEPLLALAVTVTSEQRVDSVLQSIVQGLASQPGVA |
Ga0075425_1025567692 | 3300006854 | Populus Rhizosphere | VGNSLAAEPLLALAVTVTSEQRVDSVLQSIVQGLASQPGVAL |
Ga0075436_1000841191 | 3300006914 | Populus Rhizosphere | VGTSLAAEPLLALAVTVTSEQRVDSVLRSIVQGLASQPGVA |
Ga0075419_112879601 | 3300006969 | Populus Rhizosphere | MESSLEAERLLSIAVTVTSEQRLESVLQRTVQGLAAQPGVA |
Ga0099794_104108031 | 3300007265 | Vadose Zone Soil | MSLAAEPLLSLAVTVTSEQRVESVLRNIVQGLASQPGV |
Ga0105250_102375681 | 3300009092 | Switchgrass Rhizosphere | VVTSLAPEPLLALAVTVTSEQQVDSVLQSIVQGLASQP |
Ga0105242_114058051 | 3300009176 | Miscanthus Rhizosphere | VSTPPATSLAAESLLSLAVTVTSEQYVESVLHSIVDGLAAQ |
Ga0105248_113087101 | 3300009177 | Switchgrass Rhizosphere | VGNSLAPEPLLALAVTVTSEQQVDSVLQSIVQGLASQPGV |
Ga0105248_130366281 | 3300009177 | Switchgrass Rhizosphere | MGNALAAEPLLALAVTVTSEQRVDSVLQSIVQGLASQ |
Ga0105238_110809522 | 3300009551 | Corn Rhizosphere | VRTSLAAEPLLALAVTVTSEQHVDSVLASIVEGLASQ |
Ga0126374_108391551 | 3300009792 | Tropical Forest Soil | VGTSTGRATSLTAEPLLSLAVTVTSEQRVESVLQSIV |
Ga0126380_100559623 | 3300010043 | Tropical Forest Soil | VGTSLAAEPLLALAVTVTAEQRVDSVLQSIVQGLA |
Ga0126380_108556211 | 3300010043 | Tropical Forest Soil | MSTPRATSLAAESLLSLAVTVTSEQQVEPVLQSIVQGL |
Ga0126384_116065711 | 3300010046 | Tropical Forest Soil | MSTPPARSLAAEALLSLAVTITSEQRVESVLQAIVHGLASQPGV |
Ga0126382_104873071 | 3300010047 | Tropical Forest Soil | MSTPPATSLAAESLLSLAVTVTSEQRVEPVLQSIVQGLAS |
Ga0126382_112944201 | 3300010047 | Tropical Forest Soil | VGTSLAAERLLALAVTVTSEQRVDSVLQSIVQGLASQPG |
Ga0126373_111157902 | 3300010048 | Tropical Forest Soil | VGTSLSAEPLLSLAVTVTSEQRVEPVLQSIVEGLAA |
Ga0126373_120723292 | 3300010048 | Tropical Forest Soil | VGTSLAAEPLLALAVTVTSEQRVDSVLQSIVHGLASQ |
Ga0126370_100337425 | 3300010358 | Tropical Forest Soil | MSTPPATSLAAESLLSLAVTVTSEQRVESVLQSIVQGLAA |
Ga0126370_109856671 | 3300010358 | Tropical Forest Soil | LAAESLLSLAVTVTSEQRVDSVLQSIVQGLAAQPGMAL |
Ga0126370_118849691 | 3300010358 | Tropical Forest Soil | VGASLTAESLLSLAVTVTSEQRVESVLQSIVQGLAAQPGMALA |
Ga0126370_123499172 | 3300010358 | Tropical Forest Soil | VGTSLTAEPLLTLAVTVTSEQRVESVLQSIVQGLASQPGVA |
Ga0126372_111373421 | 3300010360 | Tropical Forest Soil | VGSSLAAESLLSLAVTVTSEQRVESVLHSIVQGLASQPE |
Ga0126372_115333221 | 3300010360 | Tropical Forest Soil | VGTPTRLATSLAAGPLLSLAVSVTSEQCVESVLQSIVQGLASQ |
Ga0126372_116577932 | 3300010360 | Tropical Forest Soil | VRTSLAAERLLGLAVSVTSEQRVASVLQSIVQGLASQPGV |
Ga0126372_123998531 | 3300010360 | Tropical Forest Soil | VGTSTGPARSLAAEPLLSLAVTVTSEQRVESVLQGIVQGLALQPG |
Ga0126372_124998211 | 3300010360 | Tropical Forest Soil | MSRPSATSLTAESLLSLAVAVTSEQHVESVLQSIVQGLA |
Ga0126378_115966272 | 3300010361 | Tropical Forest Soil | VGTSLAAEPLLSLAVTVTSEQRVESVLQSIVQGLASQ |
Ga0126379_102267981 | 3300010366 | Tropical Forest Soil | MSAPPATSLAVDSLLSLAVTVTSEQRVESVLQSIVQG |
Ga0126379_119633341 | 3300010366 | Tropical Forest Soil | VGTSLAAEPLLSLAVTVTSEQRVDSVLQSIVRGLA |
Ga0126381_1021862751 | 3300010376 | Tropical Forest Soil | LREGFVGTSLSAEPLLSLAVTVTSEQRVEPVLKSIVEGLAAQPGVA |
Ga0126381_1022552263 | 3300010376 | Tropical Forest Soil | VGTSLAAEPLLALAVTVTSEQRVDSVLQSIVQGLAAQPGVALA |
Ga0126383_109849891 | 3300010398 | Tropical Forest Soil | MSTPSATSLAVDSLLSLAVTVTSEQRVESVLQSIVQGLASQPG |
Ga0134121_110813222 | 3300010401 | Terrestrial Soil | VGTSLAAEPLLALAVTVTSEQRVDSVLHSIVQGLAS |
Ga0137362_109702621 | 3300012205 | Vadose Zone Soil | VDTPLAAEPLLSLAVSVTSEQRVQSVLKKIVEGLASQPGVA |
Ga0126369_112111812 | 3300012971 | Tropical Forest Soil | MVGTSLAAEPLLALAVTVTSEQRVDSVLQSIVQGLASQPGV |
Ga0126369_133382582 | 3300012971 | Tropical Forest Soil | VGTSLAAESLLSLAVTVTSEQRVDSVLRSIVQGLV |
Ga0126369_135289351 | 3300012971 | Tropical Forest Soil | MSAPPATSLAAGSLLSLAVTVTAEQRVESVLQSIVQGLASQAG |
Ga0157370_112946662 | 3300013104 | Corn Rhizosphere | VETSITAGPLLSLAVTVTAEQHVESVLRKIVEGLASQP |
Ga0182036_109707521 | 3300016270 | Soil | VGTSLSAEPLLSLAVTVTSEQRVEPVLQSIVEGLAAQPG |
Ga0182035_104513672 | 3300016341 | Soil | MRSSLAAESLLSLAVTVTSEQRVESVLQSIVQGLAT |
Ga0182035_113424861 | 3300016341 | Soil | VGTSLAAESLLSLAVAVTSEQRVEPVLQSIVQGLASQ |
Ga0182035_113505591 | 3300016341 | Soil | MGSSLAAESLLSLAVTVTSEQRAESVLQSIDQGLAAQPGMALARI |
Ga0182034_120039531 | 3300016371 | Soil | VGTSLAAEPLLALAVTVTSKHRVESVLLSRVQRSAAQP |
Ga0182037_109096501 | 3300016404 | Soil | VGSSLAAESLLSLAVTVTSEQRVESVLQSIVQGLAAQPGMALA |
Ga0182037_119948651 | 3300016404 | Soil | VGTSLSAEPLLSLAVTVTSEQRVESVLQSIVQGLAAQPG |
Ga0182039_103572311 | 3300016422 | Soil | VGTSLSAEPLLSLAVTVTSEQRVEPVLQSIVQGLAAQPGVAL |
Ga0182038_112201601 | 3300016445 | Soil | VGSSLAAESLLSLAVSVTSEQRVESVLQSIVQGLASQ |
Ga0215015_106023242 | 3300021046 | Soil | VETSLAPEPLLSLAVLVTAEHRVDPVLQKIVQGLAAEPG |
Ga0210405_100185176 | 3300021171 | Soil | VGSSLAAESLLSLAVTVTSEQRVESVLQSIVQGLAAQPGMALARI |
Ga0213872_103274872 | 3300021361 | Rhizosphere | VGASLAAEPLLALAVTVTSEVRVDSVLKSIVQGLASQPGVALA |
Ga0210402_107078911 | 3300021478 | Soil | VGSSLAAESLLSLAVTVTSEQRVESVLQSTVQGLAAQPGMAL |
Ga0126371_109262212 | 3300021560 | Tropical Forest Soil | VGTSLAAEPLLALAVTVTSEQRVDSVLQSIVQGLA |
Ga0126371_132375701 | 3300021560 | Tropical Forest Soil | VGTSTRPATSLAAESLLSLAVTVTSEQRVESVLQSIV |
Ga0207694_109175592 | 3300025924 | Corn Rhizosphere | VRTSLAAEPLLALAVTVTSEQHVDSVLASIVEGLAS |
Ga0207665_115211421 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VSMLPATSLAADALLSLAVTVTSEQYVESVLHIIVDGLAAQ |
Ga0207689_106135662 | 3300025942 | Miscanthus Rhizosphere | VVTSLAPEPLLALAVTVTSEQQVDSVLQSIVQGLA |
Ga0207641_118554471 | 3300026088 | Switchgrass Rhizosphere | VGSSLAPEPLLALAVTVTSEQQVDSVLQSIVQGLASQPGVAL |
Ga0318541_101693211 | 3300031545 | Soil | MSTPPVTSLAAEPLLSLAVTVTSEQRVESVLQSIVRGLAAQ |
Ga0318538_101253542 | 3300031546 | Soil | VGTSLAAEPLLALAVTVTSEQRVDSVLQSIVQGLASQPGVA |
Ga0318573_102869252 | 3300031564 | Soil | VGTSLAAEPLLALAVTVTSEQQVDSVLQSIVQGLASQP |
Ga0310915_103150811 | 3300031573 | Soil | VGTSLAAEPLLSLAVTVTSEQRVESVLQSIVHGLAS |
Ga0318555_104036122 | 3300031640 | Soil | VGTSTRPATSLTAESLLSLAVTVTSEQRVESALQSIVHGL |
Ga0318560_102116853 | 3300031682 | Soil | MSTPPVTSLAAEPLLSLAVTVTSEQRVESVLQSIVR |
Ga0318493_103824552 | 3300031723 | Soil | VGTSTRPATSLTAESLLSLAVTVTSEQRVESALQSIVHG |
Ga0318494_106444801 | 3300031751 | Soil | MGSSLAAESLLSLAVTVTSEQRVESVLQSIVQGLAAQPG |
Ga0318547_108465111 | 3300031781 | Soil | MRSSLAAESLLSLAVTVTSEQRVESVLQSIVQGLAAQPGMALA |
Ga0318552_105597321 | 3300031782 | Soil | VGTSLSAEPLLSLAVTVTSEQRVEPVLKSIVEGLAAQ |
Ga0318557_105556371 | 3300031795 | Soil | MGSSLAAESLLSLAVTVTSEQRVESVLQSIVQGLASQPGMA |
Ga0318568_107977542 | 3300031819 | Soil | VGTSTRPATSLTAESLLSLAVTVTSEQRVESALQS |
Ga0310917_101736931 | 3300031833 | Soil | MGSSLAAESLLSLAVTVTSEQRVESVLQSIVQGLAAQPGMAL |
Ga0318551_106808381 | 3300031896 | Soil | VGTSTRPATSLTAESLLSLAVTVTSEQRVESALQSIV |
Ga0306923_122310631 | 3300031910 | Soil | MGSSLAAESLLSLAVTVTSEQRVESVLQSIVQGLAAQLG |
Ga0306921_108188481 | 3300031912 | Soil | VGTSLEAELLLSIAVTITSEQRVESVLQKTVQGLAAQP |
Ga0310916_109355851 | 3300031942 | Soil | VGTSLSAEPLLSLAVTVTSEQRVEPVLQSIVEGLAAQPGVA |
Ga0310910_100795091 | 3300031946 | Soil | VGTSLAAEPLLSLAVAVTSQQRVESVLQSIVQGLASQP |
Ga0310910_107567512 | 3300031946 | Soil | VGTSLSAEPLLSLAVTVTSEQRVEPVLKSIVEGLAAQP |
Ga0310910_109197031 | 3300031946 | Soil | MGSSMAAESLLSLAVTVTSEQRVESVLQSIVQGLASQPGVA |
Ga0306926_109709171 | 3300031954 | Soil | MGSSLAAESLLSLAVTVTSEQRVESVLQSIVQGLAAQPGM |
Ga0306926_127451901 | 3300031954 | Soil | VGTSLSAEPLLSLAVTVTSEQRVEPVLQSIVEGLA |
Ga0307479_106644061 | 3300031962 | Hardwood Forest Soil | VDTSLAAEPLLSLAVTVTSEQRVESVLRNIVQGLAS |
Ga0306922_102978081 | 3300032001 | Soil | VGTSLAAEPLLSLAVTVTSEQRVESVLLSIVQGLASQ |
Ga0306922_124254491 | 3300032001 | Soil | MGSSLAAESLLSLAVTVTSEQRVESVLQSIVQGLAAQPGMALARI |
Ga0318545_101399732 | 3300032042 | Soil | VGTSTRPATSLTAESLLSLAVTVTSEQRVESALQSI |
Ga0318533_102986281 | 3300032059 | Soil | MGSSLAAESLLSLAVTVTSEQRVESVLQSIVEGLA |
Ga0318533_113329942 | 3300032059 | Soil | VGTSLSAEPLLSLAVTVTSEQRVESVLQSIVQGLAAQPGMA |
Ga0306924_126137391 | 3300032076 | Soil | MGSSLAAESLLSLAVTVTSEQRVESVLQSIVQGLAA |
Ga0318577_104526011 | 3300032091 | Soil | VATSLSAEPLLSLAVTVTSEQRVEPVLKSIVEGLAAQP |
Ga0307470_106424371 | 3300032174 | Hardwood Forest Soil | VGTSLSAEPLLALAVTVTSEQHVDSVLQSIVQGLASQPG |
Ga0307470_114367311 | 3300032174 | Hardwood Forest Soil | MSTPPTTSLAAESLLSLAVTVTSEQRVESVLQSIVQGLAS |
Ga0307471_1016810122 | 3300032180 | Hardwood Forest Soil | VSTPPATSLAAESLLSLAVTVTSEQYVESVFHSIVDGLAAQPGVA |
Ga0335080_114076451 | 3300032828 | Soil | VRTSLAAEPLLALAVTVTSEQCVDSVLQSIVQGLASQPGVAL |
Ga0318519_107966831 | 3300033290 | Soil | MGSSLAAESLLSLAVTVTSEQRVESVLQSIVQGLAAQ |
⦗Top⦘ |