Metagenome Family F096756

Basic Information
Family ID	F096756
Family Type	Metagenome
Number of Sequences	104
Average Sequence Length	38 residues
Representative Sequence	MIGLEKESLIRTRLIMKRKALKEDMCGRKASGAQEV
Number of Associated Samples	61
Number of Associated Scaffolds	104

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	23.08 %
% of genes near scaffold ends (potentially truncated)	22.12 %
% of genes from short scaffolds (< 2000 bps)	100.00 %
Associated GOLD sequencing projects	61
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.42

Most Common Taxonomy
Group	Unclassified (53.846 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (94.231 % of family members)
Environment Ontology (ENVO)	Unclassified (94.231 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (94.231 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 104 Family Scaffolds
PF13650	Asp_protease_2	1.92

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.85 %
All Organisms	root	All Organisms	46.15 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.85 %
cellular organisms	root	All Organisms → cellular organisms	46.15 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.85 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	44.23 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	1.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.85 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	44.23 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.85 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	44.23 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.85 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	44.23 %
Aeromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales	1.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.85 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	44.23 %
Aeromonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae	1.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.85 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	44.23 %
Aeromonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas	1.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.85 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	44.23 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	1.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.85 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	44.23 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	1.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.85 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	44.23 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	1.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.85 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	44.23 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	1.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.85 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	40.38 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	3.85 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	1.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.85 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	40.38 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	3.85 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	1.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.85 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	40.38 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	3.85 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	1.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.85 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	40.38 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	3.85 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	1.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.85 %
malvids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids	40.38 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	3.85 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	1.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.85 %
Malvales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales	40.38 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	1.92 %
BOP clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade	0.96 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.85 %
Malvaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae	40.38 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	1.92 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	0.96 %
Oryzoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.85 %
Malvoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae	40.38 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	1.92 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	0.96 %
Oryzeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.85 %
Gossypium	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium	40.38 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	1.92 %
Oryzinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae	0.96 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.85 %
Gossypium australe	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	40.38 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	1.92 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	0.96 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.85 %
Gossypium australe	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	40.38 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	1.92 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	0.96 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	0.96 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005338\|Ga0068868_102121359	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	535	Open in IMG/M
3300005459\|Ga0068867_102063261	Not Available	540	Open in IMG/M
3300006881\|Ga0068865_100623748	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	914	Open in IMG/M
3300009148\|Ga0105243_10766514	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	947	Open in IMG/M
3300013296\|Ga0157374_12054207	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	598	Open in IMG/M
3300014745\|Ga0157377_10375285	Not Available	961	Open in IMG/M
3300015267\|Ga0182122_1052684	Not Available	551	Open in IMG/M
3300015267\|Ga0182122_1063699	Not Available	521	Open in IMG/M
3300015267\|Ga0182122_1068132	Not Available	511	Open in IMG/M
3300015268\|Ga0182154_1019386	Not Available	723	Open in IMG/M
3300015268\|Ga0182154_1020469	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	713	Open in IMG/M
3300015268\|Ga0182154_1032091	Not Available	635	Open in IMG/M
3300015269\|Ga0182113_1055728	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	597	Open in IMG/M
3300015274\|Ga0182188_1015747	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	718	Open in IMG/M
3300015274\|Ga0182188_1049122	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	537	Open in IMG/M
3300015275\|Ga0182172_1051173	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	568	Open in IMG/M
3300015275\|Ga0182172_1053068	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	562	Open in IMG/M
3300015275\|Ga0182172_1059238	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	544	Open in IMG/M
3300015276\|Ga0182170_1038420	Not Available	617	Open in IMG/M
3300015276\|Ga0182170_1069675	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	519	Open in IMG/M
3300015279\|Ga0182174_1020824	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	754	Open in IMG/M
3300015279\|Ga0182174_1081482	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	511	Open in IMG/M
3300015281\|Ga0182160_1015995	Not Available	798	Open in IMG/M
3300015281\|Ga0182160_1025057	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	708	Open in IMG/M
3300015283\|Ga0182156_1065789	Not Available	549	Open in IMG/M
3300015283\|Ga0182156_1066938	Not Available	546	Open in IMG/M
3300015283\|Ga0182156_1074857	Not Available	528	Open in IMG/M
3300015286\|Ga0182176_1035327	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	664	Open in IMG/M
3300015287\|Ga0182171_1046846	Not Available	608	Open in IMG/M
3300015288\|Ga0182173_1041303	Not Available	624	Open in IMG/M
3300015288\|Ga0182173_1068515	Not Available	539	Open in IMG/M
3300015288\|Ga0182173_1079700	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	515	Open in IMG/M
3300015289\|Ga0182138_1023105	Not Available	739	Open in IMG/M
3300015291\|Ga0182125_1096099	Not Available	500	Open in IMG/M
3300015292\|Ga0182141_1028624	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	711	Open in IMG/M
3300015292\|Ga0182141_1081677	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	525	Open in IMG/M
3300015294\|Ga0182126_1071504	Not Available	550	Open in IMG/M
3300015295\|Ga0182175_1046107	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	632	Open in IMG/M
3300015295\|Ga0182175_1062964	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	577	Open in IMG/M
3300015295\|Ga0182175_1093378	Not Available	511	Open in IMG/M
3300015296\|Ga0182157_1023140	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	778	Open in IMG/M
3300015296\|Ga0182157_1059288	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	596	Open in IMG/M
3300015298\|Ga0182106_1064842	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	580	Open in IMG/M
3300015298\|Ga0182106_1103323	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	501	Open in IMG/M
3300015299\|Ga0182107_1068300	Not Available	574	Open in IMG/M
3300015299\|Ga0182107_1104954	Not Available	501	Open in IMG/M
3300015300\|Ga0182108_1025436	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	770	Open in IMG/M
3300015300\|Ga0182108_1083373	Not Available	543	Open in IMG/M
3300015302\|Ga0182143_1023150	Not Available	781	Open in IMG/M
3300015302\|Ga0182143_1027862	Not Available	742	Open in IMG/M
3300015302\|Ga0182143_1066673	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	578	Open in IMG/M
3300015303\|Ga0182123_1021980	Not Available	769	Open in IMG/M
3300015304\|Ga0182112_1037759	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	683	Open in IMG/M
3300015304\|Ga0182112_1060145	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	598	Open in IMG/M
3300015307\|Ga0182144_1067930	Not Available	582	Open in IMG/M
3300015307\|Ga0182144_1098348	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	518	Open in IMG/M
3300015308\|Ga0182142_1110019	Not Available	510	Open in IMG/M
3300015314\|Ga0182140_1102256	Not Available	523	Open in IMG/M
3300015321\|Ga0182127_1096567	Not Available	546	Open in IMG/M
3300015323\|Ga0182129_1074041	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	577	Open in IMG/M
3300015323\|Ga0182129_1078887	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	566	Open in IMG/M
3300015341\|Ga0182187_1175047	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	528	Open in IMG/M
3300015341\|Ga0182187_1184276	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	518	Open in IMG/M
3300015342\|Ga0182109_1030188	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	1031	Open in IMG/M
3300015344\|Ga0182189_1032947	Not Available	1004	Open in IMG/M
3300015344\|Ga0182189_1089326	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	713	Open in IMG/M
3300015344\|Ga0182189_1113851	Not Available	654	Open in IMG/M
3300015344\|Ga0182189_1146481	Not Available	597	Open in IMG/M
3300015344\|Ga0182189_1193531	Not Available	536	Open in IMG/M
3300015344\|Ga0182189_1209569	Not Available	520	Open in IMG/M
3300015345\|Ga0182111_1086804	Not Available	746	Open in IMG/M
3300015345\|Ga0182111_1088721	Not Available	740	Open in IMG/M
3300015345\|Ga0182111_1238200	Not Available	507	Open in IMG/M
3300015351\|Ga0182161_1095548	Not Available	754	Open in IMG/M
3300015351\|Ga0182161_1203868	Not Available	561	Open in IMG/M
3300015355\|Ga0182159_1162511	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	702	Open in IMG/M
3300015355\|Ga0182159_1176483	Not Available	678	Open in IMG/M
3300015355\|Ga0182159_1298934	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	539	Open in IMG/M
3300015355\|Ga0182159_1312594	Not Available	529	Open in IMG/M
3300015361\|Ga0182145_1196481	Not Available	500	Open in IMG/M
3300017404\|Ga0182203_1014873	Not Available	1053	Open in IMG/M
3300017407\|Ga0182220_1102595	Not Available	510	Open in IMG/M
3300017409\|Ga0182204_1018544	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	873	Open in IMG/M
3300017409\|Ga0182204_1119146	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	502	Open in IMG/M
3300017410\|Ga0182207_1063327	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	708	Open in IMG/M
3300017411\|Ga0182208_1120245	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	515	Open in IMG/M
3300017413\|Ga0182222_1081758	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	541	Open in IMG/M
3300017415\|Ga0182202_1056087	Not Available	672	Open in IMG/M
3300017420\|Ga0182228_1115444	Not Available	524	Open in IMG/M
3300017424\|Ga0182219_1127192	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	518	Open in IMG/M
3300017425\|Ga0182224_1102624	Not Available	588	Open in IMG/M
3300017427\|Ga0182190_1016976	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1069	Open in IMG/M
3300017427\|Ga0182190_1031847	Not Available	874	Open in IMG/M
3300017433\|Ga0182206_1148717	Not Available	514	Open in IMG/M
3300017436\|Ga0182209_1071962	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	668	Open in IMG/M
3300017442\|Ga0182221_1053961	Not Available	717	Open in IMG/M
3300017442\|Ga0182221_1080058	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	636	Open in IMG/M
3300017443\|Ga0182193_1041841	Not Available	842	Open in IMG/M
3300017443\|Ga0182193_1077022	Not Available	693	Open in IMG/M
3300017681\|Ga0182226_1104876	Not Available	535	Open in IMG/M
3300017685\|Ga0182227_1068527	Not Available	652	Open in IMG/M
3300017685\|Ga0182227_1110204	Not Available	544	Open in IMG/M
3300017686\|Ga0182205_1112658	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	580	Open in IMG/M
3300017690\|Ga0182223_1032792	Not Available	724	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	94.23%
Rhizoplane	Host-Associated → Plants → Rhizoplane	2.88%
Rhizosphere	Host-Associated → Plants → Rhizosphere	2.88%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	94.23%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	2.88%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	2.88%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	94.23%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	2.88%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	2.88%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	94.23%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	2.88%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.92%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.96%

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated	Open in IMG/M
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017681	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.42
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.42
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F096756

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068868_1021213591	3300005338	Miscanthus Rhizosphere	MKVFMIGWEKESLDRTRLIMKRKALKEDTRGRKASGAQEI*
Ga0068867_1020632612	3300005459	Miscanthus Rhizosphere	MKVFMIGWEKESLDRTGLIMKRKSLKEDTHGRKASGAQEI*
Ga0068865_1006237482	3300006881	Miscanthus Rhizosphere	MIGLEKESLIRTGLIMKKKALKEDMCGRKASGAQEV*
Ga0105243_107665141	3300009148	Miscanthus Rhizosphere	KTKVFMIGWEKESLDRTGLIMKRKALKEDTRGRKASGAQEI*
Ga0157374_120542072	3300013296	Miscanthus Rhizosphere	MIGWEKESLDRTGLIMKRKALKEYKCGRKASGAQEI*
Ga0157377_103752851	3300014745	Miscanthus Rhizosphere	MKVFMIGWEKESLDRTRLIMKRKTLKEDTRGRKASGAQEI*
Ga0182122_10526841	3300015267	Miscanthus Phyllosphere	MIGLEKELLIRTGLIMKRKATKESMLGRKANGVQAD*
Ga0182122_10636993	3300015267	Miscanthus Phyllosphere	MIGLEKELLIRTGLIMKRKATKESVLGRKVNGVQED*
Ga0182122_10681322	3300015267	Miscanthus Phyllosphere	FMIGLEKESFIRAGPVMKRKAPKKDIWGRKASGAQEV*
Ga0182154_10193863	3300015268	Miscanthus Phyllosphere	GSALKKIKVFMIGLEKESLIRTGLIMKRKAPKEDMCGRKASGA*
Ga0182154_10204692	3300015268	Miscanthus Phyllosphere	MIGLGKESLIKTGLIMKRKALKEDICGRKASGAQEI*
Ga0182154_10320912	3300015268	Miscanthus Phyllosphere	MIGLEKESLFRTRLIMKRKALKGDMCGRKASGAQEV*
Ga0182113_10557282	3300015269	Miscanthus Phyllosphere	MIGLEKELLIRTRLIMKRKATKESMLGRKANGVQED*
Ga0182188_10157471	3300015274	Miscanthus Phyllosphere	MIGLGKESLIKTGLIMKRKALKEDIHGRKASGAQEI*
Ga0182188_10491221	3300015274	Miscanthus Phyllosphere	MIGLRKELLVRTGLIMKRKALKEDIHGRKASGAQEV*
Ga0182172_10511732	3300015275	Miscanthus Phyllosphere	MIGLEKESLIRTGLIMKKKALKEDMCARETSGAQEV*
Ga0182172_10530682	3300015275	Miscanthus Phyllosphere	MIGWEKESLDRTRLIMKRKALKEYTCGRKASGAQEI*
Ga0182172_10592382	3300015275	Miscanthus Phyllosphere	VLKKIKVFMISLEKESLIRTGLIMKRKAPKEDMCGRKASGAQEV*
Ga0182170_10384202	3300015276	Miscanthus Phyllosphere	MIGLEKESLIRTGLIMKRKAMKEDMCGRKASGAQEV*
Ga0182170_10696751	3300015276	Miscanthus Phyllosphere	MIGWGKESLDRTGLIMKRKALKEYTHGRKASGAQEI*
Ga0182174_10208242	3300015279	Miscanthus Phyllosphere	MIGLEKESLIRTRLIMKKKAMKEDMCGRKASDAQEV*
Ga0182174_10814822	3300015279	Miscanthus Phyllosphere	MIGLEKESLIRTRLIMKRKAMKEDMCGKKASGAQEV*
Ga0182160_10159951	3300015281	Miscanthus Phyllosphere	MVGLGKESLIKIGLIMKRKAMKEDIRGRKASGAKEV*
Ga0182160_10250571	3300015281	Miscanthus Phyllosphere	MIGWGKELLDRTGLIMKRKALKEDICGRKASGAQEV*
Ga0182156_10657891	3300015283	Miscanthus Phyllosphere	MISLEKESLIRTGLIMKRKATKESMLGRKANGVQE
Ga0182156_10669382	3300015283	Miscanthus Phyllosphere	MDQHLKMKVFMISWEKELLDRTMLIMKRKALKEDTWGRKASGA*
Ga0182156_10748571	3300015283	Miscanthus Phyllosphere	MIGWGKESLDRTRLIMKRKALKEYTHGRKASGAQEI*
Ga0182176_10353272	3300015286	Miscanthus Phyllosphere	MIGLEKESLIRNGLIMKRKALKEDMCGKKASGAQEV*
Ga0182171_10468462	3300015287	Miscanthus Phyllosphere	MIGWGKESLDRTRLIMKRKALKEYIHGRKASGAQEI*
Ga0182173_10413032	3300015288	Miscanthus Phyllosphere	VKVFMIGLEKESLIRTGLIMKKKAMKEDMCGRKASGAQEV*
Ga0182173_10685151	3300015288	Miscanthus Phyllosphere	MIGLEKESLIRIGLIMKRKAPKEDMCDRKASGAQE
Ga0182173_10797002	3300015288	Miscanthus Phyllosphere	MIGWGKESLDRTGLIMKRKALKEYTRGRKASGAQEI*
Ga0182138_10231051	3300015289	Miscanthus Phyllosphere	MIGLEKELLTRTGLIMKRKAMKEDIFGRKVNGVQE
Ga0182125_10960992	3300015291	Miscanthus Phyllosphere	MIDLEKESLVRTGLVMKKKALKEDMCGRKASGAQEI*
Ga0182141_10286242	3300015292	Miscanthus Phyllosphere	MKVFMISSEKESLDRTGLIMKRKALKEDMCGRKASGAQEV*
Ga0182141_10816772	3300015292	Miscanthus Phyllosphere	GWEKESLDRTGLIMKRKALKEDTRGRKASGAQEI*
Ga0182126_10715042	3300015294	Miscanthus Phyllosphere	MKVFMIGWEKESLDRTGLIMKRKALKEDTHGRKASGA*
Ga0182175_10461072	3300015295	Miscanthus Phyllosphere	MIGLEKESLIRTGLIMKKALKEDMCGRKANGAQEV*
Ga0182175_10629641	3300015295	Miscanthus Phyllosphere	MIGLGKESLIRTGLIMKRKALKEDMCGRKASGAEGV*
Ga0182175_10933782	3300015295	Miscanthus Phyllosphere	MKVFMIGWEKESLDRTRLIMKRKALKEDTRGRKANGALED*
Ga0182157_10231401	3300015296	Miscanthus Phyllosphere	SVHNRLEKESLIKTGLIIKRKALKEEMCGRKASGAQGI*
Ga0182157_10592881	3300015296	Miscanthus Phyllosphere	MIGLEKESLIRTRLIMKREATKESMLGRNENGVQED*
Ga0182106_10648422	3300015298	Miscanthus Phyllosphere	MIGLEKESLIRTGLIMKRKAVKEDMCGRKASGAQEV*
Ga0182106_11033232	3300015298	Miscanthus Phyllosphere	MKVFMIGWEKESLDRTGLIMKRKALKEDTCGRKVSGAQEI*
Ga0182107_10683001	3300015299	Miscanthus Phyllosphere	MDQRLKMEVFMIGWEKESLDRTGLIMKRKTLKEDTCGRKASGAQEI*
Ga0182107_11049542	3300015299	Miscanthus Phyllosphere	DWRLKTNVFIISWEKESLDRTGLIMKRKALKEDTRGRKASGAQEI*
Ga0182108_10254362	3300015300	Miscanthus Phyllosphere	NMDRCLKTKVFMTGWEKESLDRTGLIMKREALKEDTRGRKASGA*
Ga0182108_10833732	3300015300	Miscanthus Phyllosphere	MIGLEKESLDRIGLIMKRKALKEDTCGRKASGAQEI*
Ga0182143_10231501	3300015302	Miscanthus Phyllosphere	MKVFMIGWEKESLDRTRLIMKRKALKEYTRGRKASGA*
Ga0182143_10278622	3300015302	Miscanthus Phyllosphere	MKVFMISWEKEPLERTGLIMKRKALKEYTCGRKASGAQEI*
Ga0182143_10666732	3300015302	Miscanthus Phyllosphere	MKVFMIGWEKESLDRTRLIMKRKSLKEDTCGRKASGAQEI*
Ga0182123_10219801	3300015303	Miscanthus Phyllosphere	MIGLEKESLIRTGLIMKRKAMKEDMCGRKANGVQED*
Ga0182112_10377592	3300015304	Miscanthus Phyllosphere	IGLGKESLIRIGLIMKRKAMREDMCGRKASGAQEV*
Ga0182112_10601451	3300015304	Miscanthus Phyllosphere	MKVFMIGREKESLDRTGLTMKRKALKEDTHGRKASGAQEI*
Ga0182144_10679301	3300015307	Miscanthus Phyllosphere	MKVFMISWEKEPLERTGLIMKRKALKEDTRGRKASGAQEI*
Ga0182144_10983482	3300015307	Miscanthus Phyllosphere	MIGLEKELLIRTGLIMKRKALKRDICARKASGAQEV*
Ga0182142_11100192	3300015308	Miscanthus Phyllosphere	MDQCLKTKVFMIGLEKESLVRTGLIMKRKALKEDTCGRKASGAQEI*
Ga0182140_11022561	3300015314	Miscanthus Phyllosphere	MIGLGKETLIRTGLIMKRKALKEDIRGRKVSGAQED*
Ga0182127_10965672	3300015321	Miscanthus Phyllosphere	MFMIGLEKESLIRTRLIMKRKAMKEDMCGKKASGA*
Ga0182129_10740412	3300015323	Miscanthus Phyllosphere	MIGWGKESLDRTGLIMKRKALKEYTHGKKASGAQEI*
Ga0182129_10788872	3300015323	Miscanthus Phyllosphere	MIGWEKESLDRTGLIMKRKALKEDTHGRKASGAQEI*
Ga0182187_11750472	3300015341	Miscanthus Phyllosphere	MIGLGKESLIRTGLIMKRKALKEDVCGRKASGAQEV*
Ga0182187_11842762	3300015341	Miscanthus Phyllosphere	MIGLGKESLIRTGLIMKRKALKEDIYGRKANGAQEV*
Ga0182109_10301883	3300015342	Miscanthus Phyllosphere	MIGLGKESLIRIGLIMKRKAMREDMCGRKASGAQEV*
Ga0182189_10329472	3300015344	Miscanthus Phyllosphere	MKVFMIGWEKESFDRTGLIMKRKVLKEDTRGRKASGA*
Ga0182189_10893262	3300015344	Miscanthus Phyllosphere	MIGLGKESLIRTRLIMKRKALKEDIRGRKVSGAQED*
Ga0182189_11138512	3300015344	Miscanthus Phyllosphere	MIGLGKESLIKIELIMKRKAMKEDIRGRKASGAQEV*
Ga0182189_11464812	3300015344	Miscanthus Phyllosphere	MIGLGKESLIRIGLIMKRKALKESMLGRKASGAQEV*
Ga0182189_11935312	3300015344	Miscanthus Phyllosphere	MDRCLKTKVFMTGWEKESLDRTGLIMKREALKEDTRGRKASGA*
Ga0182189_12095693	3300015344	Miscanthus Phyllosphere	VLKKIKVFMIGLEKESLIKTGLIMKREATKESMLGRK
Ga0182111_10868041	3300015345	Miscanthus Phyllosphere	MDWRLKTKVFMISWEKESLDRTRLIMKRKALKEDTCGRKASGAQEI*
Ga0182111_10887211	3300015345	Miscanthus Phyllosphere	MIGWEKESLDRTGLIMKRNALKEDTHGRKASGAQEI*
Ga0182111_12382001	3300015345	Miscanthus Phyllosphere	MIGLGKESLIKTGLIMKGKALKEDICGRKASGAQEI*
Ga0182161_10955483	3300015351	Miscanthus Phyllosphere	MKVFMISLEKESLIKTGLIMKREALKEDICCRKASGA*
Ga0182161_12038682	3300015351	Miscanthus Phyllosphere	MIGLEKESLIKTGLIMKRKALKESMLGRKASGAQEV*
Ga0182159_11625112	3300015355	Miscanthus Phyllosphere	MIGLEKESLIRTGLIMKRKAMKEDMCGRKANGAQEV*
Ga0182159_11764831	3300015355	Miscanthus Phyllosphere	MMGLEKESLIRTVLIMKRKALKEDICGRKASGAQEV*
Ga0182159_12989342	3300015355	Miscanthus Phyllosphere	MIGWEKESLDRTRLIMKRKALKEDTHGRKASGAQEI*
Ga0182159_13125942	3300015355	Miscanthus Phyllosphere	MIGLEKESLIRTRLIMKRKALKEDICGRKASGDQEV*
Ga0182145_11964812	3300015361	Miscanthus Phyllosphere	MIGWEEESLDRTGPIMKKEALKEDTRGRKARGAQEI*
Ga0182203_10148732	3300017404	Miscanthus Phyllosphere	MKVFMIGWEKESLDRTGLIMKRKALKEDTHGRKASGA
Ga0182220_11025952	3300017407	Miscanthus Phyllosphere	MIGLKKELLTRTGLIMKRKALKEDICGKKASGAQEV
Ga0182204_10185442	3300017409	Miscanthus Phyllosphere	MKVFMIGWEKESLDRTRLIMQRKALKEDTRSRKASGA
Ga0182204_11191463	3300017409	Miscanthus Phyllosphere	MIGLEKESLIKTGLIMKRDALKEGTCGRKASGAQEV
Ga0182207_10633271	3300017410	Miscanthus Phyllosphere	MKVIMIGWKKESLDRTRLIMKRKALKEDTRGRKASGA
Ga0182208_11202452	3300017411	Miscanthus Phyllosphere	MIGLEKESLIRTGLIMKRKALKEDMCGSKASGVQEV
Ga0182222_10817581	3300017413	Miscanthus Phyllosphere	MIGLEKESLIRTRLIMKRKALKEDMCGRKASGAQEV
Ga0182202_10560871	3300017415	Miscanthus Phyllosphere	MKVFMIGWEKESLGRTGLIMKRKALKEDTHGREASGAQEI
Ga0182228_11154441	3300017420	Miscanthus Phyllosphere	HHNNMDWRLKTKVFIISWEKESLDRTGLIMKRKALKEDTRGRKASGAQEI
Ga0182219_11271922	3300017424	Miscanthus Phyllosphere	MIGLEKESLIKTGLIMKRKALKEDMCGRKASGALEV
Ga0182224_11026242	3300017425	Miscanthus Phyllosphere	MIGLEKESLIRTGLIMKREATKESMLGRKANGVQED
Ga0182190_10169762	3300017427	Miscanthus Phyllosphere	MKVFMIGWEKESLDRTGLIMKRKALREDTCSRKASGAQEI
Ga0182190_10318472	3300017427	Miscanthus Phyllosphere	MIGLEKESLIRTRLIMKRKAMKEDMCGRKASDTQEV
Ga0182206_11487171	3300017433	Miscanthus Phyllosphere	MIVLEKESLIRTGLIMERKAPKKDMCGRKASGAQEV
Ga0182209_10719621	3300017436	Miscanthus Phyllosphere	MKVFMIGWEKESLGRIRLIMRRKALKEYTRGRKASGAQEI
Ga0182221_10539612	3300017442	Miscanthus Phyllosphere	MIGLEKESLIRTGLIMKRKAMKEDMCGRKASGAQEV
Ga0182221_10800581	3300017442	Miscanthus Phyllosphere	MKVFMISWEKESLDRTRLIMKRKALKEDTRGRKASGA
Ga0182193_10418412	3300017443	Miscanthus Phyllosphere	MTGWEKESLDRTRLIMKREALKEDTRGRKASGAQEI
Ga0182193_10770222	3300017443	Miscanthus Phyllosphere	MIGLGKESLIKIEPIMKKKTMKEGMCGRKASGAQEV
Ga0182226_11048761	3300017681	Miscanthus Phyllosphere	MVGLEKESLIRTRLIMKRKAMKEDMCGRKVSGAQEI
Ga0182227_10685272	3300017685	Miscanthus Phyllosphere	MKVFMISWEKESLDRTGLIMKRKALKEDTCGRKASGAQEI
Ga0182227_11102041	3300017685	Miscanthus Phyllosphere	AQDAYHHNNIDRRLKMEVFMIGWEKESLDRTGLIMKRKALKEDTRGRKASGAQEI
Ga0182205_11126582	3300017686	Miscanthus Phyllosphere	MKVFMIGWEKESLDRTRLIMKRKALKEDTRGRKASGA
Ga0182223_10327921	3300017690	Miscanthus Phyllosphere	HYNNMDRCLKMKVFMIIWEKESLDRTGLIMRRKTLKKDTHGGKASGAQEI

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign