NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F096744

Metagenome / Metatranscriptome Family F096744

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F096744
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 49 residues
Representative Sequence RVTTHRGHTVQTFQSLELALEAAESLGPDHYVIDRHGLQIWNPQRKLLRNEE
Number of Associated Samples 74
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 6.73 %
% of genes near scaffold ends (potentially truncated) 78.85 %
% of genes from short scaffolds (< 2000 bps) 90.38 %
Associated GOLD sequencing projects 65
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.231 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(39.423 % of family members)
Environment Ontology (ENVO) Unclassified
(66.346 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(59.615 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 13.75%    β-sheet: 17.50%    Coil/Unstructured: 68.75%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF01243Putative_PNPOx 3.85
PF02627CMD 2.88
PF00873ACR_tran 2.88
PF16518GrlR 2.88
PF00582Usp 1.92
PF11799IMS_C 1.92
PF02518HATPase_c 1.92
PF00536SAM_1 0.96
PF02874ATP-synt_ab_N 0.96
PF12697Abhydrolase_6 0.96
PF02800Gp_dh_C 0.96
PF04909Amidohydro_2 0.96
PF01381HTH_3 0.96
PF16983MFS_MOT1 0.96
PF00005ABC_tran 0.96
PF01180DHO_dh 0.96
PF13280WYL 0.96
PF13545HTH_Crp_2 0.96
PF04780DUF629 0.96
PF03781FGE-sulfatase 0.96
PF10129OpgC_C 0.96
PF069833-dmu-9_3-mt 0.96
PF00155Aminotran_1_2 0.96
PF05235CHAD 0.96
PF01144CoA_trans 0.96
PF13356Arm-DNA-bind_3 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 2.88
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 2.88
COG0042tRNA-dihydrouridine synthaseTranslation, ribosomal structure and biogenesis [J] 0.96
COG0057Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenaseCarbohydrate transport and metabolism [G] 0.96
COG0069Glutamate synthase domain 2Amino acid transport and metabolism [E] 0.96
COG0167Dihydroorotate dehydrogenaseNucleotide transport and metabolism [F] 0.96
COG1262Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domainPosttranslational modification, protein turnover, chaperones [O] 0.96
COG1304FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomeraseEnergy production and conversion [C] 0.96
COG1788Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunitLipid transport and metabolism [I] 0.96
COG2057Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunitLipid transport and metabolism [I] 0.96
COG2070NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase familyGeneral function prediction only [R] 0.96
COG2764Zn-dependent glyoxalase, PhnB familyEnergy production and conversion [C] 0.96
COG3025Inorganic triphosphatase YgiF, contains CYTH and CHAD domainsInorganic ion transport and metabolism [P] 0.96
COG3865Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferaseGeneral function prediction only [R] 0.96
COG4670Acyl CoA:acetate/3-ketoacid CoA transferaseLipid transport and metabolism [I] 0.96
COG5607CHAD domain, binds inorganic polyphosphatesFunction unknown [S] 0.96


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.23 %
UnclassifiedrootN/A5.77 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2070309004|prs_FIHLEPW02S7T9LAll Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Paracoccus → Paracoccus pantotrophus508Open in IMG/M
3300003369|JGI24140J50213_10109473All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium908Open in IMG/M
3300005434|Ga0070709_10385339All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1043Open in IMG/M
3300005610|Ga0070763_10829488All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium547Open in IMG/M
3300005764|Ga0066903_106977196All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium shewense586Open in IMG/M
3300006041|Ga0075023_100297499All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium663Open in IMG/M
3300006059|Ga0075017_100227612All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1357Open in IMG/M
3300006904|Ga0075424_101161557All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium822Open in IMG/M
3300009803|Ga0105065_1036473All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium651Open in IMG/M
3300010009|Ga0133908_103822Not Available1392Open in IMG/M
3300010048|Ga0126373_11140409All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium846Open in IMG/M
3300010048|Ga0126373_11429902All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria757Open in IMG/M
3300010049|Ga0123356_12415613All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium658Open in IMG/M
3300012971|Ga0126369_10451729All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1334Open in IMG/M
3300013296|Ga0157374_12642511All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium530Open in IMG/M
3300014325|Ga0163163_12144922All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium618Open in IMG/M
3300014491|Ga0182014_10111236All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1623Open in IMG/M
3300014495|Ga0182015_10144772All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1618Open in IMG/M
3300014838|Ga0182030_10252098All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei2016Open in IMG/M
3300015372|Ga0132256_101680433All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium744Open in IMG/M
3300016270|Ga0182036_10054828All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2524Open in IMG/M
3300016270|Ga0182036_10310226All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCBAU 156151203Open in IMG/M
3300016270|Ga0182036_10734714All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria800Open in IMG/M
3300016270|Ga0182036_10819475All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae759Open in IMG/M
3300016294|Ga0182041_10381688All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1193Open in IMG/M
3300016294|Ga0182041_11603835All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium601Open in IMG/M
3300016319|Ga0182033_10659152All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium914Open in IMG/M
3300016319|Ga0182033_11167223All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium689Open in IMG/M
3300016341|Ga0182035_10499781All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1038Open in IMG/M
3300016341|Ga0182035_11092892All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300016341|Ga0182035_11162683All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium688Open in IMG/M
3300016357|Ga0182032_10789313All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium802Open in IMG/M
3300016357|Ga0182032_11176548All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium659Open in IMG/M
3300016371|Ga0182034_10723214All Organisms → cellular organisms → Bacteria → Proteobacteria848Open in IMG/M
3300016371|Ga0182034_10919205All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium753Open in IMG/M
3300016371|Ga0182034_11383487All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium615Open in IMG/M
3300016371|Ga0182034_11591329All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium573Open in IMG/M
3300016387|Ga0182040_11237610All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium629Open in IMG/M
3300016404|Ga0182037_10501564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1018Open in IMG/M
3300016422|Ga0182039_10206136All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1572Open in IMG/M
3300016445|Ga0182038_10113081All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCBAU 156152000Open in IMG/M
3300017823|Ga0187818_10063937All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1584Open in IMG/M
3300017959|Ga0187779_10122467All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1584Open in IMG/M
3300018060|Ga0187765_10445575All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium809Open in IMG/M
3300021560|Ga0126371_12438997All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium633Open in IMG/M
3300023068|Ga0224554_1019247Not Available2131Open in IMG/M
3300025650|Ga0209385_1089803All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1019Open in IMG/M
3300026879|Ga0207763_1017054All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium724Open in IMG/M
3300026945|Ga0207743_1002528All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2291Open in IMG/M
3300026959|Ga0207852_1012669All Organisms → cellular organisms → Bacteria → Proteobacteria903Open in IMG/M
3300027266|Ga0209215_1035695All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae671Open in IMG/M
3300027842|Ga0209580_10661424Not Available517Open in IMG/M
3300027898|Ga0209067_10359507All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium809Open in IMG/M
3300027908|Ga0209006_10000691All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales31430Open in IMG/M
3300027948|Ga0209858_1002460All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1210Open in IMG/M
3300028577|Ga0265318_10043336All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. BTAi11705Open in IMG/M
3300031545|Ga0318541_10044490All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2258Open in IMG/M
3300031546|Ga0318538_10329638All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium824Open in IMG/M
3300031564|Ga0318573_10802036All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium506Open in IMG/M
3300031573|Ga0310915_10151186Not Available1605Open in IMG/M
3300031573|Ga0310915_10225101All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1316Open in IMG/M
3300031573|Ga0310915_10980551All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium590Open in IMG/M
3300031719|Ga0306917_10229081All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1417Open in IMG/M
3300031724|Ga0318500_10708949All Organisms → cellular organisms → Bacteria → Proteobacteria513Open in IMG/M
3300031744|Ga0306918_10065153All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae2479Open in IMG/M
3300031744|Ga0306918_11168923Not Available595Open in IMG/M
3300031744|Ga0306918_11380507All Organisms → cellular organisms → Bacteria → Proteobacteria540Open in IMG/M
3300031763|Ga0318537_10288604All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium607Open in IMG/M
3300031777|Ga0318543_10057615All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1600Open in IMG/M
3300031796|Ga0318576_10395643All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium653Open in IMG/M
3300031833|Ga0310917_10076102All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2117Open in IMG/M
3300031879|Ga0306919_10777146All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium736Open in IMG/M
3300031880|Ga0318544_10150128All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium893Open in IMG/M
3300031890|Ga0306925_10111887All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2914Open in IMG/M
3300031890|Ga0306925_10659276All Organisms → cellular organisms → Bacteria1099Open in IMG/M
3300031890|Ga0306925_12080415All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium533Open in IMG/M
3300031897|Ga0318520_10251847All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1054Open in IMG/M
3300031910|Ga0306923_12532466All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium505Open in IMG/M
3300031912|Ga0306921_10897474All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1006Open in IMG/M
3300031941|Ga0310912_11082764All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium613Open in IMG/M
3300031942|Ga0310916_10511917All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1022Open in IMG/M
3300031942|Ga0310916_10521176All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1012Open in IMG/M
3300031945|Ga0310913_10739993All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium695Open in IMG/M
3300031945|Ga0310913_11143103All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria543Open in IMG/M
3300031946|Ga0310910_10255196All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1372Open in IMG/M
3300031946|Ga0310910_11223798All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium582Open in IMG/M
3300031954|Ga0306926_10989459All Organisms → cellular organisms → Bacteria → Proteobacteria1002Open in IMG/M
3300031954|Ga0306926_11445495All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium796Open in IMG/M
3300031954|Ga0306926_11933516All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300031954|Ga0306926_12445055All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium574Open in IMG/M
3300031959|Ga0318530_10174134All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium879Open in IMG/M
3300032001|Ga0306922_11217682All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium766Open in IMG/M
3300032001|Ga0306922_11663835All Organisms → cellular organisms → Bacteria → Proteobacteria633Open in IMG/M
3300032035|Ga0310911_10094920All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1628Open in IMG/M
3300032035|Ga0310911_10359762All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria841Open in IMG/M
3300032059|Ga0318533_11003589All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium612Open in IMG/M
3300032059|Ga0318533_11056020All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium595Open in IMG/M
3300032064|Ga0318510_10410429All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium578Open in IMG/M
3300032068|Ga0318553_10780826All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300032091|Ga0318577_10593560All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium526Open in IMG/M
3300032261|Ga0306920_100854112Not Available1333Open in IMG/M
3300032261|Ga0306920_101500235All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium963Open in IMG/M
3300032261|Ga0306920_101600496All Organisms → cellular organisms → Bacteria927Open in IMG/M
3300032261|Ga0306920_103177535All Organisms → cellular organisms → Bacteria → Proteobacteria615Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil39.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil26.92%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.85%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.88%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.92%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.92%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog1.92%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.92%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.92%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.96%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.96%
Green-Waste CompostEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Green-Waste Compost0.96%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.96%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.96%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.96%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.96%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut0.96%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.96%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.96%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.96%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2070309004Green-waste compost microbial communities at University of California, Davis, USA, from solid state bioreactor - Luquillo Rain Forest, Puerto RicoEnvironmentalOpen in IMG/M
3300003369Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-22AEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009803Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50EnvironmentalOpen in IMG/M
3300010009Microbial communities of stony corals with Black-band disease (BBD) from Carrie Bow Cay Field Station, Belize; BBD Transitions coral #4 sample H4Host-AssociatedOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010049Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3Host-AssociatedOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300023068Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 20-24EnvironmentalOpen in IMG/M
3300025650Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B (SPAdes)EnvironmentalOpen in IMG/M
3300026879Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 50 (SPAdes)EnvironmentalOpen in IMG/M
3300026945Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 55 (SPAdes)EnvironmentalOpen in IMG/M
3300026959Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027266Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027948Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60 (SPAdes)EnvironmentalOpen in IMG/M
3300028577Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaGHost-AssociatedOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
prs_051405102070309004Green-Waste CompostELALETAEALGPDHYVTDRHGLQIWNPQRKLLRNEE
JGI24140J50213_1010947313300003369Arctic Peat SoilHVTTHGGHTVQTFQSLESAIEAAESLGPDHYVVDRHGLQIWNPQRKLLRNEE*
Ga0070709_1038533913300005434Corn, Switchgrass And Miscanthus RhizosphereMPIAATLRFRVTTNRSHTVQTFQPLELALEAAKSLGLNYVIDRQGLQIWSPQRKLLRNEE
Ga0070763_1082948813300005610SoilGHELHAPFRVTTHLGHTAQTFESLELALEAAEALGPDHYVTDRHGFQIWNEQRRLLRNEE
Ga0066903_10697719613300005764Tropical Forest SoilMFQSLELALEAAEALGPDCYVIDGHGLQIWNPQRKLLRN
Ga0075023_10029749913300006041WatershedsMLKGHGVHAPFHVTTHGGHTVQTFQSLELAFEAAEALGPDYYVIDRHGLQIWNQQRKLLRNEE*
Ga0075017_10022761233300006059WatershedsMLKGHGVHAPFHVTTHGGHTVQTFQSLESAIEAAESLGPDHYVVDRHGLQIWNPQRKLLRNEE*
Ga0075424_10116155713300006904Populus RhizosphereQPLELALEAAKSLGLNYVIDRQGLQIWSPQRKLLRNEE*
Ga0105065_103647313300009803Groundwater SandVTTHRGHTVQTFQSLELAIEAAESLGPDHYVIDAHGLQIWNPQRKLLRNEE*
Ga0133908_10382223300010009Host-AssociatedMQSFQSLEAALEAAETLGSDHYVIDRHGLQIWSPQRKLLRNEE*
Ga0126373_1114040913300010048Tropical Forest SoilQTFQSLELALEAAEALGPDHYVIDRHGLQIWNQQRKLLRDEE*
Ga0126373_1142990213300010048Tropical Forest SoilVQTFQSLELALEAAEALGPEHYVIDRHGLQIWNQERKLL
Ga0123356_1241561313300010049Termite GutVRTFDSLELAIEAAGSLGPDHYIIDRHGLQVWNPQRKLLRDEE*
Ga0126369_1045172913300012971Tropical Forest SoilVQTFQSLELAIEAAESLGPNHYIIDRHGLQIWNPERKLLRNEE*
Ga0157374_1264251123300013296Miscanthus RhizosphereHTVQTFQPLELALEAAKSLGLNYVIDRQGLQIWSPQRKLLRNEE*
Ga0163163_1214492223300014325Switchgrass RhizospherePIAATLRFRVTTNRSHTVQTFQPLELALEAAKSLGLNYVIDRQGLQIWSPQRKLLRNEE*
Ga0182014_1011123633300014491BogMLKRHGAHAPFHVTTHGGHTVQTFQSLESAIEAAESLGPDHYVVDRHGLQIWNPQRKLLRNEE*
Ga0182015_1014477213300014495PalsaMPKGHGAHAPFHVTTHGGHTVQTFQSLESAIEAAESLGPDHYVVDRHGLQIWNPQRKLLRNEE*
Ga0182030_1025209813300014838BogMLKGHGVHAPFHVTTNRGHIVQTFQSLESAIEAAESLEPDHYVVDRHGLQIWNPQRKLLRNEE*
Ga0132256_10168043313300015372Arabidopsis RhizosphereMQTFLSLEAALEAAESLGPDHYVIDRHGLQIWNPQRKLLRNEE*
Ga0182036_1005482843300016270SoilAPFRVTTHRGHTVQTFQSLELAIEAAESLGPDHYVVDRHGLQIWNPQRKLLRSEE
Ga0182036_1031022633300016270SoilPFRVTTHRRHTVQTFQSLELALEAAKSSGPDHYVIDRHGLQIWNPQRELLRNEE
Ga0182036_1073471413300016270SoilVQTFESLELALEAAEALGPDHYVTDRHGLQIWNPQRKLLRNEE
Ga0182036_1081947513300016270SoilGHTVQTFQSLELAIEAAESLGPDHYVVDRHGLQIWNPQRKLLRNEE
Ga0182041_1038168813300016294SoilRGHPVQTFQSLELALEAAEALGPDHYVTDRHGLQIWNQQRKLLRNEE
Ga0182041_1160383513300016294SoilLHAPFHVTTHRGHTVLTFQSLELAIEAAQSLGPDHYIIDRHGLQIWNPQRKVLRNEE
Ga0182033_1065915213300016319SoilELAIEAAKFLGPDHYVIDRHGFQIWDPQRKLLRSEE
Ga0182033_1116722313300016319SoilTTHRGHTVQTFQSLELALEAAKSSGPDHYVIDRHGLQIWNPQRELLRNEE
Ga0182035_1049978143300016341SoilAPFRVTTHRGHTVQTFQSLELALEAAEALGPDHYVTDRHGLQIWNQQRKLLRNEE
Ga0182035_1109289213300016341SoilLHAPFRVTTHRGHTVQTFQSLESALEAAESLGPDHYVVDQHGLQIWNQRRDLLRNEE
Ga0182035_1116268323300016341SoilRHDIHAPFYVTTHHGHIVQTFQSLELAIEAAESLGPDHYIIDRHGQQIWDPERKLLRNEE
Ga0182032_1078931313300016357SoilHGLHAPFRVTTHRGHTVQTFQSLELALEAAEALGPDHYVIDRHGLQIWNPQRKVLRNEE
Ga0182032_1117654813300016357SoilVGHSLHAPFRVTTHRGHTVQTFQSLEMALEAAEALGPDHFVIDRHGLQIWNPQRKLLRNE
Ga0182034_1072321413300016371SoilPFRVTTHHGHTVQTFQSLELALEAAEHLGPDHYVIDRHGLQIWNPQRKLLRNEE
Ga0182034_1091920513300016371SoilHGLHAPFRVTTHRGHTVQTFQSLELALEAAESLGPDHYVIDRHGLQIWNPQRKLLRNEE
Ga0182034_1138348733300016371SoilTVLTFQSLELAIEAAQSLGPDHYIIDRHGLQIWNPQRKVLRNEE
Ga0182034_1159132923300016371SoilQTFQSLESALEAAESLGPDHYVVDQHGLQIWNQRRDLLRNEE
Ga0182040_1123761013300016387SoilELALEAAQSLGPDHCVIDRHGLQIWNPQRKLLRNEE
Ga0182037_1050156413300016404SoilLETALEAAQALGPDYYVIDRHGAQIWSSQRKLLRTEE
Ga0182039_1020613613300016422SoilLALEAAEALGPDHYVTDRHGLQIWNQQRKLLRNEE
Ga0182038_1011308113300016445SoilGHGLHGPFRVTTHRGHTVQTFQSLELALEAAKSSGPDHYVIDRHGLQIWNPQRELLRNEE
Ga0187818_1006393723300017823Freshwater SedimentTTHRGHTVQTFQSLESALEAAEALGPDHYVIDRHGLQIWNSQRRLLRNEE
Ga0187779_1012246723300017959Tropical PeatlandMFQSLELALEAAEALGPDHCVIDRHGLQIWNRQRKLLRNEE
Ga0187765_1044557513300018060Tropical PeatlandMFQSLELALEAAAALGPDHYVIDRHGLQIWNQQRKLLRDEE
Ga0126371_1243899733300021560Tropical Forest SoilAPFRVTTHRGHTVQTFQSLELALEAAEALGPDHYVIDRHGLQIWNQQRKLLRDEE
Ga0224554_101924723300023068SoilMQSFQSLEAALEAAETLGSDHYVIDRHGLQIWSPQRKLLRNEE
Ga0209385_108980313300025650Arctic Peat SoilGHTVQTFQSLESAIEAAESLGPDHYVVDRHGLQIWNPQRKLLRNEE
Ga0207763_101705413300026879Tropical Forest SoilPFRVTTRRGHTMQTFQSLELAIEAAESLGPDHYVIDRHGLQIWNPQRKLLRNEE
Ga0207743_100252833300026945Tropical Forest SoilVQTFQSLELALEAAEALGPDHYVIDRHGLQIWNQQRKLLRNEE
Ga0207852_101266923300026959Tropical Forest SoilVHAPFRVTTHRGHTVQTFESLELALEAAEALGPDHYVIDRHGLQIWNQQRKLMRNEE
Ga0209215_103569523300027266Forest SoilPFHVTTHHGHTVQTFQSLELAIEAAESLGPDHYVVDRHGLQIWDPQRKLLRNEE
Ga0209580_1066142413300027842Surface SoilHTVQTFQSLEMAIEAAEALGPDHYVIDRHGLQIWNSQRKLLRNEE
Ga0209067_1035950713300027898WatershedsMLKGHGVHAPFHVTTHGGHTVQTFQSLESAIEAAESLGPDHYVVDRHGLQIWNPQRKLLRNEE
Ga0209006_10000691233300027908Forest SoilVTTHLGHTAQTFESLELALEAAEALGPDHYVTDRHGFQIWNEQRRLLRNEE
Ga0209858_100246023300027948Groundwater SandVTTHRGHTVQTFQSLELAIEAAESLGPDHYVIDAHGLQIWNPQRKLLRNEE
Ga0265318_1004333623300028577RhizosphereMQSFQSLESALEAAETLGSDHYVTDRHGLQIWSPQRKLLRNEE
Ga0318541_1004449053300031545SoilLQTFESLELAIEAAESLGPDHYVIDRHGFQIWNPQRKLLRSEE
Ga0318538_1032963823300031546SoilMFESLELAIEAAKFLGPDHYVIDRHGFQIWDPQRKLLRSEE
Ga0318573_1080203623300031564SoilAPFRVTTRRGHTVQTFQSLELAIEAAETLGPDHYVVDRHGLQIWNPQRKLLRSEE
Ga0310915_1015118613300031573SoilGHYVHSPFRVTTHRGHTVQTFQSLELALEAAEALGPDHYVIDRHGLQIWNPQRKLLRNEE
Ga0310915_1022510113300031573SoilLALEAAKSLGPDHYVIDRHGLQIWNPQRELLRNEE
Ga0310915_1098055113300031573SoilESHGIHAPFRVTTHRGHTVQTFQSLELALEAAEALGPDHYVTDHHGLQIWNPQRKLLRNE
Ga0306917_1022908143300031719SoilPFRVTTHRGHTVQTFQSLELALEAAEALGPDHYVTDRHGLQIWNQQRKLLRNEE
Ga0318500_1070894923300031724SoilLELALEAAESLGPDHYVIDGHGLQIWNPQRKLLRNEE
Ga0306918_1006515313300031744SoilFQSLELALEAAESLGPDHYVIDRHGLQIWNPQRKLLRNEE
Ga0306918_1116892333300031744SoilTHRGHTVQTFQSLELALEAAEALGPGHYVIDRHGLQIWNPQRKLLRNEE
Ga0306918_1138050713300031744SoilTHRGHTVQTFQSLELALEAAESLGPDHYVIDGHGLQIWNPQRKLLRNEE
Ga0318537_1028860413300031763SoilGLHAPFRVTTHRGHTVQTFQSLELALEAAQSLGPDHYVIDRHGLQIWNPQRKLLRNEE
Ga0318543_1005761513300031777SoilHTLQTFESLELAIEAAESLGPDHYVIDRHGFQIWNPQRKLLRSEE
Ga0318576_1039564323300031796SoilIQGHGLHGPFRVTTHRGHTVQTFQSLELALEAAKSLGPDHYVIDRHGLQIWNPQRELLRNEE
Ga0310917_1007610263300031833SoilTFQSLELALEAAKSLGPDHYVIDRHGLQIWNPQRELLRNQE
Ga0306919_1077714623300031879SoilHGPFRVMTHRGHTVQTFQSLELALEAAKSLGPDHYVIDRHGLQIWNPQRELLRNEE
Ga0318544_1015012813300031880SoilEGHGLHAPFRVTTHRGHTVQTFQSLELALEAAQSLGPDHYVIDRHGLQIWNPQRKLLRNE
Ga0306925_1011188733300031890SoilVQTFQSLELALEAAEALGPGHYVIDRHGLQIWNQQRKLLRDEE
Ga0306925_1065927613300031890SoilDDLLHAPFRVTTHRGHTVQTFQSLELALEAAEALGPDHYVIDRHGLQIWNQERKLLRDEE
Ga0306925_1208041513300031890SoilAPFRVTTRRGHTVQTLQSLELALEAAEALGPDHYVIDRHGLQIWNPQRKLVRNEE
Ga0318520_1025184733300031897SoilGLHAPFRVTTHHGHTVQTFQSLELAIEAAESLGPDHYVVDRHGLQIWNPQRKLLRNEE
Ga0306923_1253246623300031910SoilSLHAPFRVTTHRGHTVGTFQSLESALEAAESLGPDHFVIDRHGLQIWNPQRKLLRNEE
Ga0306921_1089747433300031912SoilGHTVQTFQSLELALEAAEALGPDHYVIDRHGLQIWNPQRKLMRNEE
Ga0310912_1108276413300031941SoilKLERGHGIHDPFRVTTHRGHTVQTFHSLELALEAAKSLGPDHYVVDRHGLQIWSRQRELLRNEE
Ga0310916_1051191713300031942SoilVTTHRGHAVQTFQSLELAIEAAETLGPDHYVVDRHGLQIWNPQRKLLRSEE
Ga0310916_1052117613300031942SoilHHGHTLQTFESLELAIEAAESLGPDHYVIDRHGFQIWNPQRKLLRSEE
Ga0310913_1073999323300031945SoilLALEAAEALGPDHYVIDRHGLQIWNPQRKLMRNEE
Ga0310913_1114310323300031945SoilVTTHRGHTVQTFQSLELALEAAEALGPGHYVIDRHGLQIWNQQRKLLRDEE
Ga0310910_1025519643300031946SoilTVQTFQSLELALEAAKSLGPDHYVIDRHGLQIWNPQRELLRNQE
Ga0310910_1122379823300031946SoilLELALEAAEALGPDHYVIDRHGLQIWNPERKLLRDEE
Ga0306926_1098945913300031954SoilFESLELAIEAAKFLGPDHYVIDRHGFQIWDPQRKLLRSEE
Ga0306926_1144549513300031954SoilLELALEAAEALGPDHYVIDRHGLQIWNPQRKLVRNEE
Ga0306926_1193351633300031954SoilSLELALEAAKSLGPDHYVIDRHGLQIWNPQRELLRNQE
Ga0306926_1244505523300031954SoilRVTTHRGHTVQTFQSLELALEAAESLGPDHYVIDRHGLQIWNPQRKLLRNEE
Ga0318530_1017413413300031959SoilGHTLQTFESLELAIEAAESLGPDHYVIDRHGFQIWNPQRKLLRSEE
Ga0306922_1121768223300032001SoilTFQSLELALEAAEALGPDHYVIDRHGLQIWNPQRKLVRNEE
Ga0306922_1166383523300032001SoilMFQSLELALEAAESLGPDHYIIDGHGLQIWNSQRKLLRNEE
Ga0310911_1009492013300032035SoilHHGHTVQTFQSLELAIEAAESLGPDHYVVDRHGLQIWNPQRKLLRNEE
Ga0310911_1035976213300032035SoilVTTHRGHTVQTFQPLELALEAAEALGPDHYVTDRRGLQIWNPERKLLRNEE
Ga0318533_1100358923300032059SoilVQAFQSLELALEAAEALGPDHYVIDRHGLQIWNQQRKLLRDEE
Ga0318533_1105602023300032059SoilLELALEAAKSLGPDHYVIDRHGLQIWNPQRELLRNEE
Ga0318510_1041042913300032064SoilTTHRGHTVQTFQSLELALEAAQSLGPDHYVIDRHGLQIWNPQGKVLRNEE
Ga0318553_1078082613300032068SoilLHGPFRVTTHRGHTVRTFQSLELALEAAKSLGPDHYVIDRHGLQIWNPQRELLRNEE
Ga0318577_1059356013300032091SoilFQSLELALEAAEALGPDHYVIDRHGLQIWNPQRKLLRNEE
Ga0306920_10085411233300032261SoilAGEQHGLHAPFPVTTHRGHTVQTFQSLELALEAAQSLGPDHYVIDRHGLQIWNPQGKVLRNEE
Ga0306920_10150023523300032261SoilMFYATESGIVRTFQSLELAIEAAESLGPDHYIIDRHGQQNWNPERKLLRNEE
Ga0306920_10160049613300032261SoilHIVETFQSLEAALEAAESLGQDHYVVDRHGLQIWNPQRKLLRNEE
Ga0306920_10317753523300032261SoilVQMFQSLELALEAAESLGPDHYIIDGHGLQIWNSQRKLLRNEE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.