Metagenome Family F096739

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F096739
Family Type	Metagenome
Number of Sequences	104
Average Sequence Length	38 residues
Representative Sequence	MFQSLPLTIREVKATEARLNAIYDAAKLGLKGDSLALA
Number of Associated Samples	83
Number of Associated Scaffolds	104

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	29.13 %
% of genes near scaffold ends (potentially truncated)	99.04 %
% of genes from short scaffolds (< 2000 bps)	85.58 %
Associated GOLD sequencing projects	78
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (64.423 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (22.115 % of family members)
Environment Ontology (ENVO)	Unclassified (64.423 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (63.462 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 24.24% β-sheet: 0.00% Coil/Unstructured: 75.76%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.38
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 104 Family Scaffolds
PF02767	DNA_pol3_beta_2	4.81
PF13392	HNH_3	1.92
PF16793	RepB_primase	0.96
PF16510	P22_portal	0.96

COG ID	Name	Functional Category	% Frequency in 104 Family Scaffolds
COG0592	DNA polymerase III sliding clamp (beta) subunit, PCNA homolog	Replication, recombination and repair [L]	4.81

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	64.42 %
All Organisms	root	All Organisms	35.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	64.42 %
Viruses	superkingdom	All Organisms → Viruses	31.73 %
cellular organisms	root	All Organisms → cellular organisms	3.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	64.42 %
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	31.73 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	3.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	64.42 %
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	31.73 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.92 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	64.42 %
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	31.73 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.96 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	64.42 %
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	31.73 %
Planctomycetia	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	0.96 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	64.42 %
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	30.77 %
Planctomycetales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales	0.96 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	64.42 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	30.77 %
Planctomycetaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae	0.96 %
Rhodoferax	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Rhodoferax	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	64.42 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	30.77 %
unclassified Planctomycetaceae	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae	0.96 %
Rhodoferax fermentans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Rhodoferax → Rhodoferax fermentans	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	64.42 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	30.77 %
Planctomycetaceae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium	0.96 %
Rhodoferax fermentans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Rhodoferax → Rhodoferax fermentans	0.96 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300001851\|RCM31_10211477	Not Available	791	Open in IMG/M
3300002091\|JGI24028J26656_1021252	Not Available	639	Open in IMG/M
3300002220\|MLSBCLC_10550514	Not Available	650	Open in IMG/M
3300005805\|Ga0079957_1072762	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium	1977	Open in IMG/M
3300006030\|Ga0075470_10190050	Not Available	590	Open in IMG/M
3300006917\|Ga0075472_10526996	Not Available	589	Open in IMG/M
3300006919\|Ga0070746_10025334	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	3229	Open in IMG/M
3300007094\|Ga0102532_1149024	Not Available	1164	Open in IMG/M
3300007344\|Ga0070745_1252734	Not Available	637	Open in IMG/M
3300007542\|Ga0099846_1119534	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	962	Open in IMG/M
3300007542\|Ga0099846_1248490	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	618	Open in IMG/M
3300007639\|Ga0102865_1241293	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	538	Open in IMG/M
3300008266\|Ga0114363_1195275	Not Available	627	Open in IMG/M
3300008448\|Ga0114876_1147857	Not Available	861	Open in IMG/M
3300008448\|Ga0114876_1219167	Not Available	623	Open in IMG/M
3300008450\|Ga0114880_1182202	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	723	Open in IMG/M
3300008459\|Ga0114865_1182133	Not Available	605	Open in IMG/M
3300009009\|Ga0105105_10299258	Not Available	869	Open in IMG/M
3300009158\|Ga0114977_10058629	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2373	Open in IMG/M
3300009158\|Ga0114977_10252001	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1019	Open in IMG/M
3300009158\|Ga0114977_10284879	Not Available	945	Open in IMG/M
3300009158\|Ga0114977_10691500	Not Available	543	Open in IMG/M
3300009159\|Ga0114978_10502533	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	712	Open in IMG/M
3300009160\|Ga0114981_10607949	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	581	Open in IMG/M
3300009163\|Ga0114970_10147829	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1415	Open in IMG/M
3300009163\|Ga0114970_10198606	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1181	Open in IMG/M
3300009163\|Ga0114970_10789581	Not Available	500	Open in IMG/M
3300009165\|Ga0105102_10786940	Not Available	540	Open in IMG/M
3300009169\|Ga0105097_10914270	Not Available	504	Open in IMG/M
3300009183\|Ga0114974_10271422	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1007	Open in IMG/M
3300009187\|Ga0114972_10040405	Not Available	3244	Open in IMG/M
3300010160\|Ga0114967_10151913	Not Available	1285	Open in IMG/M
3300010160\|Ga0114967_10458098	Not Available	628	Open in IMG/M
3300010354\|Ga0129333_10392560	Not Available	1229	Open in IMG/M
3300010354\|Ga0129333_11539835	Not Available	544	Open in IMG/M
3300010885\|Ga0133913_10169278	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5836	Open in IMG/M
3300010885\|Ga0133913_10626416	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2822	Open in IMG/M
3300010885\|Ga0133913_13572918	Not Available	1011	Open in IMG/M
3300010970\|Ga0137575_10043135	Not Available	716	Open in IMG/M
3300015050\|Ga0181338_1021561	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1006	Open in IMG/M
3300017700\|Ga0181339_1005624	Not Available	1581	Open in IMG/M
3300017716\|Ga0181350_1017466	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2028	Open in IMG/M
3300017716\|Ga0181350_1170179	Not Available	501	Open in IMG/M
3300017722\|Ga0181347_1119646	Not Available	737	Open in IMG/M
3300017736\|Ga0181365_1176404	Not Available	500	Open in IMG/M
3300017754\|Ga0181344_1225362	Not Available	522	Open in IMG/M
3300017766\|Ga0181343_1071640	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1001	Open in IMG/M
3300017766\|Ga0181343_1107204	Not Available	791	Open in IMG/M
3300017766\|Ga0181343_1114094	Not Available	762	Open in IMG/M
3300017766\|Ga0181343_1199192	Not Available	549	Open in IMG/M
3300017774\|Ga0181358_1159659	Not Available	764	Open in IMG/M
3300017774\|Ga0181358_1233587	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	585	Open in IMG/M
3300017777\|Ga0181357_1017540	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2848	Open in IMG/M
3300017778\|Ga0181349_1130034	Not Available	921	Open in IMG/M
3300017778\|Ga0181349_1172064	Not Available	765	Open in IMG/M
3300017780\|Ga0181346_1142305	Not Available	904	Open in IMG/M
3300017785\|Ga0181355_1373398	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	520	Open in IMG/M
3300020151\|Ga0211736_10448489	Not Available	518	Open in IMG/M
3300020157\|Ga0194049_1000081	Not Available	37064	Open in IMG/M
3300020541\|Ga0208359_1067195	Not Available	509	Open in IMG/M
3300020556\|Ga0208486_1027424	Not Available	861	Open in IMG/M
3300021519\|Ga0194048_10317335	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	559	Open in IMG/M
3300021520\|Ga0194053_10112545	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1130	Open in IMG/M
3300021600\|Ga0194059_1047983	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1406	Open in IMG/M
3300021956\|Ga0213922_1075415	Not Available	707	Open in IMG/M
3300021963\|Ga0222712_10622927	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	620	Open in IMG/M
3300022190\|Ga0181354_1056856	Not Available	1301	Open in IMG/M
3300022407\|Ga0181351_1035206	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2124	Open in IMG/M
3300024356\|Ga0255169_1071580	Not Available	576	Open in IMG/M
3300024515\|Ga0255183_1097935	Not Available	578	Open in IMG/M
3300025585\|Ga0208546_1001761	Not Available	6651	Open in IMG/M
3300025585\|Ga0208546_1003726	All Organisms → cellular organisms → Bacteria	4381	Open in IMG/M
3300025635\|Ga0208147_1039071	Not Available	1235	Open in IMG/M
3300027659\|Ga0208975_1044069	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1388	Open in IMG/M
3300027733\|Ga0209297_1304129	Not Available	593	Open in IMG/M
3300027734\|Ga0209087_1072449	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1513	Open in IMG/M
3300027736\|Ga0209190_1375565	Not Available	518	Open in IMG/M
3300027759\|Ga0209296_1298179	Not Available	642	Open in IMG/M
3300027763\|Ga0209088_10331076	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	608	Open in IMG/M
3300027792\|Ga0209287_10442242	Not Available	501	Open in IMG/M
3300027798\|Ga0209353_10016314	Not Available	3519	Open in IMG/M
3300027896\|Ga0209777_10085807	Not Available	2719	Open in IMG/M
3300027963\|Ga0209400_1102476	Not Available	1329	Open in IMG/M
3300028394\|Ga0304730_1100120	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1260	Open in IMG/M
3300031232\|Ga0302323_102018703	Not Available	655	Open in IMG/M
3300032092\|Ga0315905_11520100	Not Available	524	Open in IMG/M
3300032092\|Ga0315905_11555591	Not Available	516	Open in IMG/M
3300032173\|Ga0315268_11945762	Not Available	601	Open in IMG/M
3300033978\|Ga0334977_0456925	Not Available	587	Open in IMG/M
3300033979\|Ga0334978_0476841	Not Available	583	Open in IMG/M
3300033994\|Ga0334996_0221669	Not Available	993	Open in IMG/M
3300034012\|Ga0334986_0126823	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Rhodoferax → Rhodoferax fermentans	1497	Open in IMG/M
3300034061\|Ga0334987_0690689	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	586	Open in IMG/M
3300034071\|Ga0335028_0637468	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	567	Open in IMG/M
3300034093\|Ga0335012_0130082	Not Available	1387	Open in IMG/M
3300034101\|Ga0335027_0842757	Not Available	526	Open in IMG/M
3300034104\|Ga0335031_0476481	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	765	Open in IMG/M
3300034105\|Ga0335035_0563682	Not Available	610	Open in IMG/M
3300034106\|Ga0335036_0755305	Not Available	568	Open in IMG/M
3300034106\|Ga0335036_0813271	Not Available	539	Open in IMG/M
3300034108\|Ga0335050_0358221	Not Available	671	Open in IMG/M
3300034118\|Ga0335053_0037286	All Organisms → cellular organisms → Bacteria → Proteobacteria	3495	Open in IMG/M
3300034121\|Ga0335058_0115624	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1570	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	99.04%
Engineered	Engineered	0.96%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	98.08%
Terrestrial	Environmental → Terrestrial	0.96%
Wastewater	Engineered → Wastewater	0.96%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	84.62%
Marine	Environmental → Aquatic → Marine	13.46%
Peat	Environmental → Terrestrial → Peat	0.96%
Industrial Wastewater	Engineered → Wastewater → Industrial Wastewater	0.96%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	49.04%
Lentic	Environmental → Aquatic → Freshwater → Lentic	25.00%
Coastal	Environmental → Aquatic → Marine → Coastal	11.54%
Sediment	Environmental → Aquatic → Freshwater → Sediment	3.85%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	1.92%
River	Environmental → Aquatic → Freshwater → River	1.92%
Lotic	Environmental → Aquatic → Freshwater → Lotic	0.96%
Pond	Environmental → Aquatic → Freshwater → Pond	0.96%
Creek	Environmental → Aquatic → Freshwater → Creek	0.96%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.96%
Unclassified	Environmental → Aquatic → Marine → Unclassified	0.96%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.96%
Petrochemical	Engineered → Wastewater → Industrial Wastewater → Petrochemical	0.96%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	48.08%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	23.08%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	11.54%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	3.85%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	1.92%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	1.92%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	0.96%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	0.96%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.96%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	0.96%
Unclassified	Environmental → Aquatic → Freshwater → Pond → Unclassified	0.96%
Unclassified	Environmental → Aquatic → Freshwater → Creek → Unclassified	0.96%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	0.96%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	0.96%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.96%
Unclassified	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified	0.96%

Habitat	Taxonomy	Distribution
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	22.12%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	20.19%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	14.42%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	9.62%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	4.81%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	3.85%
Anoxic Zone Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater	3.85%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	1.92%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	1.92%
Freshwater To Marine Saline Gradient	Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient	1.92%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	0.96%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	0.96%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	0.96%
Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic	0.96%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	0.96%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	0.96%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	0.96%
Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake	0.96%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	0.96%
Marine Plankton	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton	0.96%
Pond Fresh Water	Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water	0.96%
Freshwater	Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater	0.96%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	0.96%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	0.96%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	0.96%
Hydrocarbon Resource Environments	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments	0.96%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300001851	Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b	Environmental	Open in IMG/M
3300002091	Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenome	Environmental	Open in IMG/M
3300002220	Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011	Engineered	Open in IMG/M
3300005805	Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA	Environmental	Open in IMG/M
3300006030	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA	Environmental	Open in IMG/M
3300006917	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA	Environmental	Open in IMG/M
3300006919	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21	Environmental	Open in IMG/M
3300007094	Freshwater lake microbial communities from Singapore - a non-axenic Oscillatoriales culture (M13A)	Environmental	Open in IMG/M
3300007344	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4	Environmental	Open in IMG/M
3300007542	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG	Environmental	Open in IMG/M
3300007639	Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02	Environmental	Open in IMG/M
3300008266	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA	Environmental	Open in IMG/M
3300008448	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs	Environmental	Open in IMG/M
3300008450	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs	Environmental	Open in IMG/M
3300008459	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - July 8, 2014 all contigs	Environmental	Open in IMG/M
3300009009	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015	Environmental	Open in IMG/M
3300009158	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG	Environmental	Open in IMG/M
3300009159	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG	Environmental	Open in IMG/M
3300009160	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG	Environmental	Open in IMG/M
3300009163	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG	Environmental	Open in IMG/M
3300009165	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015	Environmental	Open in IMG/M
3300009169	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015	Environmental	Open in IMG/M
3300009183	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG	Environmental	Open in IMG/M
3300009187	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG	Environmental	Open in IMG/M
3300010160	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG	Environmental	Open in IMG/M
3300010354	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA	Environmental	Open in IMG/M
3300010885	northern Canada Lakes Co-assembly	Environmental	Open in IMG/M
3300010970	Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016	Environmental	Open in IMG/M
3300015050	Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017700	Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.D	Environmental	Open in IMG/M
3300017716	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D	Environmental	Open in IMG/M
3300017722	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N	Environmental	Open in IMG/M
3300017736	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N	Environmental	Open in IMG/M
3300017754	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D	Environmental	Open in IMG/M
3300017766	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D	Environmental	Open in IMG/M
3300017774	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017777	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N	Environmental	Open in IMG/M
3300017778	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017780	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N	Environmental	Open in IMG/M
3300017785	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N	Environmental	Open in IMG/M
3300020151	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1	Environmental	Open in IMG/M
3300020157	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L224-25m	Environmental	Open in IMG/M
3300020541	Freshwater microbial communities from Lake Mendota, WI - 26AUG2009 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020556	Freshwater microbial communities from Lake Mendota, WI - 03AUG2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300021519	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m	Environmental	Open in IMG/M
3300021520	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L227-8m	Environmental	Open in IMG/M
3300021600	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L626-11m	Environmental	Open in IMG/M
3300021956	Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG	Environmental	Open in IMG/M
3300021963	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D	Environmental	Open in IMG/M
3300022190	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N	Environmental	Open in IMG/M
3300022407	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D	Environmental	Open in IMG/M
3300024356	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepC_8d	Environmental	Open in IMG/M
3300024515	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8d	Environmental	Open in IMG/M
3300025585	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes)	Environmental	Open in IMG/M
3300025635	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes)	Environmental	Open in IMG/M
3300027659	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)	Environmental	Open in IMG/M
3300027733	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027734	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027736	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027759	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027763	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027792	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes)	Environmental	Open in IMG/M
3300027798	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)	Environmental	Open in IMG/M
3300027896	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes)	Environmental	Open in IMG/M
3300027963	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300028394	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2)	Environmental	Open in IMG/M
3300031232	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3	Environmental	Open in IMG/M
3300032092	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121	Environmental	Open in IMG/M
3300032173	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top	Environmental	Open in IMG/M
3300033978	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002	Environmental	Open in IMG/M
3300033979	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003	Environmental	Open in IMG/M
3300033994	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046	Environmental	Open in IMG/M
3300034012	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027	Environmental	Open in IMG/M
3300034061	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028	Environmental	Open in IMG/M
3300034071	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110	Environmental	Open in IMG/M
3300034093	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072	Environmental	Open in IMG/M
3300034101	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107	Environmental	Open in IMG/M
3300034104	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120	Environmental	Open in IMG/M
3300034105	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127	Environmental	Open in IMG/M
3300034106	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131	Environmental	Open in IMG/M
3300034108	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157	Environmental	Open in IMG/M
3300034118	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165	Environmental	Open in IMG/M
3300034121	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
RCM31_102114771	3300001851	Marine Plankton	MTFKSLPLTVREIKATEATLERIYNAAYLGLKNDSLALAAGMLPVEFN
JGI24028J26656_10212521	3300002091	Lentic	MFDNFESFPYEVRKLEATEARLQRIYDAAKLGLKGDTLALAA
MLSBCLC_105505141	3300002220	Hydrocarbon Resource Environments	MHTLVSLPFEPRILQATESRLKAIYDAAKLGLRGDALALS
Ga0079957_10727626	3300005805	Lake	MTFQSLPYDPRPLTATEARLEAIYAAAKLGLKGDSL
Ga0075470_101900501	3300006030	Aqueous	MTFQSLPLTARKLEATEARLQRIYEAAKLGLKGDSLALK
Ga0075472_105269961	3300006917	Aqueous	MTFQSLPLTARKLEATEARLQRIYEAAKLGLKGDSLALKA
Ga0070746_100253341	3300006919	Aqueous	MTFVSLPYEPRVIAATEARLEQIYQTAKLGLKGDA
Ga0102532_11490243	3300007094	Freshwater Lake	MTFVSLPYEPRVIAATEARLEQIYQTAKLGLKGDAL
Ga0070745_12527341	3300007344	Aqueous	MKSFHYEPREIKATEARLRSIYDAAYLGLKGDSLALAAG
Ga0099846_11195341	3300007542	Aqueous	MFKSLPFEPREIKATEARLQAIYDAAALGLKGDSLA
Ga0099846_12484901	3300007542	Aqueous	MIFSLPLAVRDVKATEARLQSIYDAAALGLKGDALALAA
Ga0102865_12412931	3300007639	Estuarine	MFHSLPFEPRKVVATEARLNKIYDAAKLGLKGDALALAS
Ga0114363_11952751	3300008266	Freshwater, Plankton	MKSLPLTAREVKATEAVLTRIYDNAKLGLRGRSLALACDLRPEEY
Ga0114876_11478571	3300008448	Freshwater Lake	MFESLPYEPRELKATEARLQRGYEAAALGLKGDSLALAA
Ga0114876_12191671	3300008448	Freshwater Lake	MFYSLPFEARKVEATEARLNRIYDAAKLGLKGDSLAMAA
Ga0114880_11822021	3300008450	Freshwater Lake	VFKSIPFTPRKVEATEARLQAIYDAAALGLKGDSLALA
Ga0114865_11821331	3300008459	Freshwater Lake	MKSFHYEPREIKATEARLRSIYDAAYLGLKGDSLAL
Ga0105105_102992581	3300009009	Freshwater Sediment	MFESFPLSIRQIKATESRLKAIYDAAKLGLSGDSL
Ga0114977_100586298	3300009158	Freshwater Lake	MFKSLPLTVRHVQATESRLQAIYDAAKLGLKGDTLALA
Ga0114977_102520011	3300009158	Freshwater Lake	LFKSLPLTVRHVQATESRLQAIYDAAKLGLKGDTLALASGMR
Ga0114977_102848793	3300009158	Freshwater Lake	MQMFDNFHSFVYEPRKLEATEARLERIYNAAKLGLKG
Ga0114977_106915001	3300009158	Freshwater Lake	MFDNYHSYVYEPRKLEATEARLERIYNAAKLGLKGD
Ga0114978_105025331	3300009159	Freshwater Lake	MFYSIPFTPRKIEATEARLHAIYDAAKLGLHGDALALAAGMLPTE
Ga0114981_106079492	3300009160	Freshwater Lake	MFKSLPLTVRHVQATESRLQAIYDAAKLGLKGDTLAL
Ga0114970_101478293	3300009163	Freshwater Lake	MKSLPLEIREIRATEARLQQIYEAARLGLKGDSLA
Ga0114970_101986061	3300009163	Freshwater Lake	VLAKENHLFKSLPLTVRHVQATESRLQAIYDAAKLGLKGDTLAL
Ga0114970_107895812	3300009163	Freshwater Lake	MFKSLPFAPRVVKATEQRLNAIYTASNLGLKGDSL
Ga0105102_107869401	3300009165	Freshwater Sediment	MFYSLPYSPRQIQATESRLNAIYDAAKLGLKGDTLA
Ga0105097_109142701	3300009169	Freshwater Sediment	MSFHSLPLVINEVRATEAVLNRIYDAAKLGLKGDNLAL
Ga0114974_102714222	3300009183	Freshwater Lake	MKSLPLEIREIRATEARLQQIYDAARLGLKGDSLALA
Ga0114972_100404056	3300009187	Freshwater Lake	MFDNFHSYVYEPRKLEATEARLQRIYDAAKLGLKGDTL
Ga0114967_101519132	3300010160	Freshwater Lake	MFDNFHSYVYEPRKLEATEARLQRIYDAAKLGLKGDT
Ga0114967_104580982	3300010160	Freshwater Lake	MQMFDNFHSYVYEPRKLEATEARLQRIYDAAKLGLKGD
Ga0129333_103925601	3300010354	Freshwater To Marine Saline Gradient	MTFQSLPLTARKLEATEARLQRIYEAAKLGLKGDSLA
Ga0129333_115398351	3300010354	Freshwater To Marine Saline Gradient	MFKSLPITVREIKATEAVLERIYDAAYLGLKEDSLALAAG
Ga0133913_1016927812	3300010885	Freshwater Lake	MFKSLPLTVRHVQATESRLQAIYDAAKLGLKGDTLALASGMRPE
Ga0133913_106264161	3300010885	Freshwater Lake	MFYSIPFTPRKIEATEARLHAIYDAAKLGLHGDAL
Ga0133913_135729181	3300010885	Freshwater Lake	MFDNFHSYVYEPRKLEATEARLQRIYDAAKLGLKG
Ga0137575_100431352	3300010970	Pond Fresh Water	MFQSLPLTIREVKATEARLNAIYEAAKLGLKGDSLALA
Ga0181338_10215612	3300015050	Freshwater Lake	MFESLPFAPRKVEATEARLHRIYEAAKLGLKGDSLAL
Ga0181339_10056246	3300017700	Freshwater Lake	MFDNFHSYVYEPRKLEATEARLQRIYDAAKLGLKGD
Ga0181350_10174661	3300017716	Freshwater Lake	MAYNSRMFHSLPFEPRKVVATEARLNKIYEAAKLG
Ga0181350_11701791	3300017716	Freshwater Lake	MSYYSIPYAPRRLEATEARLDAIYSAAKLGLKGDTL
Ga0181347_11196461	3300017722	Freshwater Lake	MFYSLPFEARKVEATEARLNRIYDAAKLGLKGDSL
Ga0181365_11764042	3300017736	Freshwater Lake	MFYSLPFEPRKVVATEARLNKIYDAAKLGLKGDALALA
Ga0181344_12253621	3300017754	Freshwater Lake	MFDNFHSYVYEPRKLEATEARLQRIYNAAKLGLKGNTLAF
Ga0181343_10716402	3300017766	Freshwater Lake	MAYNSHMFHSLPFEPRKVVATEARLNKIYEAAKLGLKGDA
Ga0181343_11072042	3300017766	Freshwater Lake	MRSLPLTIREVKATEATLNRIYDAAKLGLKGDSLALAAG
Ga0181343_11140942	3300017766	Freshwater Lake	MFQSFHYEPRKLEATEARLEAIMKAAKLGLKGDSLAL
Ga0181343_11991921	3300017766	Freshwater Lake	MFYSLPFEARKVEATEARLNRIYDAAKLGLKGDSLAMAAGM
Ga0181358_11596591	3300017774	Freshwater Lake	MSFYSLPLVINEIRATEAVLNRIYDAAKIGLKGDSLALAAGL
Ga0181358_12335871	3300017774	Freshwater Lake	MFHSLPFEPRKVVATEARLNKIYDAAKLGLKGDALAL
Ga0181357_10175401	3300017777	Freshwater Lake	MFYSLPYEARKVEATEARLNRIYDAAKLGLKGDTLAMAAGM
Ga0181349_11300342	3300017778	Freshwater Lake	MFRNIPFEPRVLRATEARLESIYLAAKAGLKGDSLALAS
Ga0181349_11720641	3300017778	Freshwater Lake	MFKSLPFTPRVVKATEQRLNAIYAASNLGLKGDALALA
Ga0181346_11423051	3300017780	Freshwater Lake	MFQSLPLTIREVKATEARLNAIYDAAKLGLKGDSLALA
Ga0181355_13733981	3300017785	Freshwater Lake	MFHSLPFEPRKVVATEARLNKIYEAAKLGLKGDALA
Ga0211736_104484891	3300020151	Freshwater	MFDNFHSYVYEPRKLEATEARLQRIYDAAKLGLKGDTLALAAGM
Ga0194049_100008150	3300020157	Anoxic Zone Freshwater	MFQSLPLTIRKVEATESRLQSIYDAAKLGLKGDTLAL
Ga0208359_10671951	3300020541	Freshwater	MFKSLPLTIREVKATEAVLNRVYDAAKRGLKGDNLALAAG
Ga0208486_10274242	3300020556	Freshwater	MFHSIPFTPRKVEATESRLKAIYDAAKLGLKGDALA
Ga0194048_103173351	3300021519	Anoxic Zone Freshwater	MSVLSIPFTPREIKATESRLQAIYDAAKLGLKNDNLA
Ga0194053_101125453	3300021520	Anoxic Zone Freshwater	MFHSIPFTPRKVEATESRLKAVYDAAKLGLKGDALAL
Ga0194059_10479832	3300021600	Anoxic Zone Freshwater	MFKSLPLTVRHVQATESRLQAIYDAAKLGLKGDTLALASG
Ga0213922_10754151	3300021956	Freshwater	MFQSLPLTIREVKATEARLEAIYAAAKKGLKGDSLAL
Ga0222712_106229271	3300021963	Estuarine Water	MISIPFTPREVQATEWRLQQIYDAAALGLKGDKLALA
Ga0181354_10568562	3300022190	Freshwater Lake	MFNSYPYEVRKLEATEVRLEAIKEAAKLGLKGDALAIAAG
Ga0181351_10352061	3300022407	Freshwater Lake	MFKSLPHAPRQLNATEARLQAIYDAAALGLKGDNLALF
Ga0255169_10715801	3300024356	Freshwater	MFKSLPLTTREIKATEAVLERIYDAAYLGLKEDSLALAA
Ga0255183_10979351	3300024515	Freshwater	MFESFPLSIRQVKATESRLKAIYDAAKLGLSGDTLALAA
Ga0208546_10017617	3300025585	Aqueous	MTFQSLPLTARKLEATEARLQRIYEAAKLGLKGDSLALKAG
Ga0208546_10037261	3300025585	Aqueous	MTFQSLPLTARKLEATEARLQRIYEAAKLGLKGDS
Ga0208546_10450641	3300025585	Aqueous	MTFQSLPLTIRKIEATEARLNRIYDAAKRGLKGDTLALAAGMRPEEY
Ga0208147_10390713	3300025635	Aqueous	MFNSLPYEPRVLAATEDRLTQIYEAAKLGLKGDALALA
Ga0208975_10440693	3300027659	Freshwater Lentic	MGIHSLPLTVRKLEATESRLQAIYDAAKLGLKGDTLALA
Ga0209297_13041291	3300027733	Freshwater Lake	MRMFDNFHSYVYEPRKLEATEARLQRIYDAAKLGLKGDTLAL
Ga0209087_10724491	3300027734	Freshwater Lake	MFYSIPFTPRKVEATESRLKAVYDAAKLGLKGDALA
Ga0209190_13755651	3300027736	Freshwater Lake	MRMFDNFHSYVYEPRKLEATEARLERIYNAAKLGLKGDTL
Ga0209296_12981791	3300027759	Freshwater Lake	MFQSFHYEPRKLQATEARLEAIMKAAKLGLKGDSLA
Ga0209088_103310762	3300027763	Freshwater Lake	MFHSLPFEPRKIVATEARLNKIYEAAKLGLKGDALALAN
Ga0209287_104422421	3300027792	Freshwater Sediment	MSFHSLPLVINEVRATEAVLNRIYDAAKLGLKGDNLALAA
Ga0209353_100163149	3300027798	Freshwater Lake	MFDNFHSYVYEPRKLEATEARLQRIYDAAKLGLKGDTLA
Ga0209777_100858071	3300027896	Freshwater Lake Sediment	MEFISLLYEPRKLQATEKNLQAVYDAAKLGLKGDALAL
Ga0209400_11024761	3300027963	Freshwater Lake	MFKSLPLTVRNVQATEARLQSIYDAAKLGLKGDSLALAAG
Ga0304730_11001201	3300028394	Freshwater Lake	MFESLPFAPRKVEATEARLNRIYEAAKLGLKGDSL
Ga0302323_1020187031	3300031232	Fen	VTIPNTARAVKATESRLERIYAAARAGLKGDTLALSAGM
Ga0315905_115201001	3300032092	Freshwater	MSTFVTIPFEPRSIRATEKVLTKIYEAAYLGLKGDSLALAS
Ga0315905_115555911	3300032092	Freshwater	MFKSLPLTIREVKATEAVLNRVYDAARMGLKGDSLALRAG
Ga0315268_119457621	3300032173	Sediment	MFYSIPFTPRKVQATESRLKAVYDAAKLGLKGDTL
Ga0334977_0456925_2_109	3300033978	Freshwater	MTFQSLPLTARKLEATEARLQRIYEAAKLGLKGDSL
Ga0334978_0476841_478_582	3300033979	Freshwater	MTFLSIPFTPREVKATESRLQKIYDAAKLGLKNDS
Ga0334996_0221669_1_114	3300033994	Freshwater	MFHSIPFTPRKVEATESRLKAVYDAAKLGLKGDALALA
Ga0334986_0126823_2_133	3300034012	Freshwater	MFKSLPLTIREVKATEAVLNRVYDAAKRGLKGDNLALAAGLLPS
Ga0334987_0690689_472_585	3300034061	Freshwater	MFKSIPFSPRKVEATEARLQAIYDAAALGLKGDSLALA
Ga0335028_0637468_1_105	3300034071	Freshwater	MSLKSLPFAPREVKATEKTLQAIYDAAALGLKGDT
Ga0335012_0130082_1267_1386	3300034093	Freshwater	MFKSLPLTVREVRATEANLERIYASATLGLKGDSLALASG
Ga0335027_0842757_3_107	3300034101	Freshwater	MFETLPYEPRQLQATEDRLHRIYNAAKLGLKGDNL
Ga0335031_0476481_2_118	3300034104	Freshwater	MFHSLPFEPRKVVATEARLNKIYEAAKLGLKGDALALAS
Ga0335035_0563682_3_116	3300034105	Freshwater	MKSLPLEIREIRATEARLQQIYEAARLGLKGDSLALAS
Ga0335036_0755305_448_567	3300034106	Freshwater	MFKSLPLTVRTIEATEAVLERIYDAAYLGLKEDSLALAAG
Ga0335036_0813271_1_129	3300034106	Freshwater	MFKSLPLTVRTIEATEAVLERIYNAAYLGLKEDSLALAAGLLP
Ga0335050_0358221_1_123	3300034108	Freshwater	MFKSFPLTIREVKATETRLQSIYDAAKMGLKGDTLALASGM
Ga0335053_0037286_3356_3493	3300034118	Freshwater	MFKSLPLTTREIKATEAVLERIYDAAYLGLKEDSLALAAGLLPIEY
Ga0335058_0115624_1461_1568	3300034121	Freshwater	MFKSLPLTVRHVQATESRLQAIYDAAKLGLKGDTLA

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F096739

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences