| Basic Information | |
|---|---|
| Family ID | F096739 |
| Family Type | Metagenome |
| Number of Sequences | 104 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MFQSLPLTIREVKATEARLNAIYDAAKLGLKGDSLALA |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 29.13 % |
| % of genes near scaffold ends (potentially truncated) | 99.04 % |
| % of genes from short scaffolds (< 2000 bps) | 85.58 % |
| Associated GOLD sequencing projects | 78 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (64.423 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (22.115 % of family members) |
| Environment Ontology (ENVO) | Unclassified (64.423 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (63.462 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.24% β-sheet: 0.00% Coil/Unstructured: 75.76% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF02767 | DNA_pol3_beta_2 | 4.81 |
| PF13392 | HNH_3 | 1.92 |
| PF16793 | RepB_primase | 0.96 |
| PF16510 | P22_portal | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0592 | DNA polymerase III sliding clamp (beta) subunit, PCNA homolog | Replication, recombination and repair [L] | 4.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 64.42 % |
| All Organisms | root | All Organisms | 35.58 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001851|RCM31_10211477 | Not Available | 791 | Open in IMG/M |
| 3300002091|JGI24028J26656_1021252 | Not Available | 639 | Open in IMG/M |
| 3300002220|MLSBCLC_10550514 | Not Available | 650 | Open in IMG/M |
| 3300005805|Ga0079957_1072762 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 1977 | Open in IMG/M |
| 3300006030|Ga0075470_10190050 | Not Available | 590 | Open in IMG/M |
| 3300006917|Ga0075472_10526996 | Not Available | 589 | Open in IMG/M |
| 3300006919|Ga0070746_10025334 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3229 | Open in IMG/M |
| 3300007094|Ga0102532_1149024 | Not Available | 1164 | Open in IMG/M |
| 3300007344|Ga0070745_1252734 | Not Available | 637 | Open in IMG/M |
| 3300007542|Ga0099846_1119534 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 962 | Open in IMG/M |
| 3300007542|Ga0099846_1248490 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
| 3300007639|Ga0102865_1241293 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
| 3300008266|Ga0114363_1195275 | Not Available | 627 | Open in IMG/M |
| 3300008448|Ga0114876_1147857 | Not Available | 861 | Open in IMG/M |
| 3300008448|Ga0114876_1219167 | Not Available | 623 | Open in IMG/M |
| 3300008450|Ga0114880_1182202 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 723 | Open in IMG/M |
| 3300008459|Ga0114865_1182133 | Not Available | 605 | Open in IMG/M |
| 3300009009|Ga0105105_10299258 | Not Available | 869 | Open in IMG/M |
| 3300009158|Ga0114977_10058629 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2373 | Open in IMG/M |
| 3300009158|Ga0114977_10252001 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1019 | Open in IMG/M |
| 3300009158|Ga0114977_10284879 | Not Available | 945 | Open in IMG/M |
| 3300009158|Ga0114977_10691500 | Not Available | 543 | Open in IMG/M |
| 3300009159|Ga0114978_10502533 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 712 | Open in IMG/M |
| 3300009160|Ga0114981_10607949 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
| 3300009163|Ga0114970_10147829 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1415 | Open in IMG/M |
| 3300009163|Ga0114970_10198606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1181 | Open in IMG/M |
| 3300009163|Ga0114970_10789581 | Not Available | 500 | Open in IMG/M |
| 3300009165|Ga0105102_10786940 | Not Available | 540 | Open in IMG/M |
| 3300009169|Ga0105097_10914270 | Not Available | 504 | Open in IMG/M |
| 3300009183|Ga0114974_10271422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1007 | Open in IMG/M |
| 3300009187|Ga0114972_10040405 | Not Available | 3244 | Open in IMG/M |
| 3300010160|Ga0114967_10151913 | Not Available | 1285 | Open in IMG/M |
| 3300010160|Ga0114967_10458098 | Not Available | 628 | Open in IMG/M |
| 3300010354|Ga0129333_10392560 | Not Available | 1229 | Open in IMG/M |
| 3300010354|Ga0129333_11539835 | Not Available | 544 | Open in IMG/M |
| 3300010885|Ga0133913_10169278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5836 | Open in IMG/M |
| 3300010885|Ga0133913_10626416 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2822 | Open in IMG/M |
| 3300010885|Ga0133913_13572918 | Not Available | 1011 | Open in IMG/M |
| 3300010970|Ga0137575_10043135 | Not Available | 716 | Open in IMG/M |
| 3300015050|Ga0181338_1021561 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1006 | Open in IMG/M |
| 3300017700|Ga0181339_1005624 | Not Available | 1581 | Open in IMG/M |
| 3300017716|Ga0181350_1017466 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2028 | Open in IMG/M |
| 3300017716|Ga0181350_1170179 | Not Available | 501 | Open in IMG/M |
| 3300017722|Ga0181347_1119646 | Not Available | 737 | Open in IMG/M |
| 3300017736|Ga0181365_1176404 | Not Available | 500 | Open in IMG/M |
| 3300017754|Ga0181344_1225362 | Not Available | 522 | Open in IMG/M |
| 3300017766|Ga0181343_1071640 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1001 | Open in IMG/M |
| 3300017766|Ga0181343_1107204 | Not Available | 791 | Open in IMG/M |
| 3300017766|Ga0181343_1114094 | Not Available | 762 | Open in IMG/M |
| 3300017766|Ga0181343_1199192 | Not Available | 549 | Open in IMG/M |
| 3300017774|Ga0181358_1159659 | Not Available | 764 | Open in IMG/M |
| 3300017774|Ga0181358_1233587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 585 | Open in IMG/M |
| 3300017777|Ga0181357_1017540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2848 | Open in IMG/M |
| 3300017778|Ga0181349_1130034 | Not Available | 921 | Open in IMG/M |
| 3300017778|Ga0181349_1172064 | Not Available | 765 | Open in IMG/M |
| 3300017780|Ga0181346_1142305 | Not Available | 904 | Open in IMG/M |
| 3300017785|Ga0181355_1373398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
| 3300020151|Ga0211736_10448489 | Not Available | 518 | Open in IMG/M |
| 3300020157|Ga0194049_1000081 | Not Available | 37064 | Open in IMG/M |
| 3300020541|Ga0208359_1067195 | Not Available | 509 | Open in IMG/M |
| 3300020556|Ga0208486_1027424 | Not Available | 861 | Open in IMG/M |
| 3300021519|Ga0194048_10317335 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 559 | Open in IMG/M |
| 3300021520|Ga0194053_10112545 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1130 | Open in IMG/M |
| 3300021600|Ga0194059_1047983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1406 | Open in IMG/M |
| 3300021956|Ga0213922_1075415 | Not Available | 707 | Open in IMG/M |
| 3300021963|Ga0222712_10622927 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 620 | Open in IMG/M |
| 3300022190|Ga0181354_1056856 | Not Available | 1301 | Open in IMG/M |
| 3300022407|Ga0181351_1035206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2124 | Open in IMG/M |
| 3300024356|Ga0255169_1071580 | Not Available | 576 | Open in IMG/M |
| 3300024515|Ga0255183_1097935 | Not Available | 578 | Open in IMG/M |
| 3300025585|Ga0208546_1001761 | Not Available | 6651 | Open in IMG/M |
| 3300025585|Ga0208546_1003726 | All Organisms → cellular organisms → Bacteria | 4381 | Open in IMG/M |
| 3300025635|Ga0208147_1039071 | Not Available | 1235 | Open in IMG/M |
| 3300027659|Ga0208975_1044069 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1388 | Open in IMG/M |
| 3300027733|Ga0209297_1304129 | Not Available | 593 | Open in IMG/M |
| 3300027734|Ga0209087_1072449 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1513 | Open in IMG/M |
| 3300027736|Ga0209190_1375565 | Not Available | 518 | Open in IMG/M |
| 3300027759|Ga0209296_1298179 | Not Available | 642 | Open in IMG/M |
| 3300027763|Ga0209088_10331076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
| 3300027792|Ga0209287_10442242 | Not Available | 501 | Open in IMG/M |
| 3300027798|Ga0209353_10016314 | Not Available | 3519 | Open in IMG/M |
| 3300027896|Ga0209777_10085807 | Not Available | 2719 | Open in IMG/M |
| 3300027963|Ga0209400_1102476 | Not Available | 1329 | Open in IMG/M |
| 3300028394|Ga0304730_1100120 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1260 | Open in IMG/M |
| 3300031232|Ga0302323_102018703 | Not Available | 655 | Open in IMG/M |
| 3300032092|Ga0315905_11520100 | Not Available | 524 | Open in IMG/M |
| 3300032092|Ga0315905_11555591 | Not Available | 516 | Open in IMG/M |
| 3300032173|Ga0315268_11945762 | Not Available | 601 | Open in IMG/M |
| 3300033978|Ga0334977_0456925 | Not Available | 587 | Open in IMG/M |
| 3300033979|Ga0334978_0476841 | Not Available | 583 | Open in IMG/M |
| 3300033994|Ga0334996_0221669 | Not Available | 993 | Open in IMG/M |
| 3300034012|Ga0334986_0126823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Rhodoferax → Rhodoferax fermentans | 1497 | Open in IMG/M |
| 3300034061|Ga0334987_0690689 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
| 3300034071|Ga0335028_0637468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 567 | Open in IMG/M |
| 3300034093|Ga0335012_0130082 | Not Available | 1387 | Open in IMG/M |
| 3300034101|Ga0335027_0842757 | Not Available | 526 | Open in IMG/M |
| 3300034104|Ga0335031_0476481 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 765 | Open in IMG/M |
| 3300034105|Ga0335035_0563682 | Not Available | 610 | Open in IMG/M |
| 3300034106|Ga0335036_0755305 | Not Available | 568 | Open in IMG/M |
| 3300034106|Ga0335036_0813271 | Not Available | 539 | Open in IMG/M |
| 3300034108|Ga0335050_0358221 | Not Available | 671 | Open in IMG/M |
| 3300034118|Ga0335053_0037286 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3495 | Open in IMG/M |
| 3300034121|Ga0335058_0115624 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1570 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 22.12% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 20.19% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 14.42% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 9.62% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.81% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.85% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 3.85% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.92% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.92% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.92% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.96% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.96% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.96% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.96% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.96% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.96% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.96% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.96% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.96% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.96% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.96% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.96% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
| 3300002091 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenome | Environmental | Open in IMG/M |
| 3300002220 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300007094 | Freshwater lake microbial communities from Singapore - a non-axenic Oscillatoriales culture (M13A) | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008459 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - July 8, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300010970 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016 | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017700 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.D | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020157 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L224-25m | Environmental | Open in IMG/M |
| 3300020541 | Freshwater microbial communities from Lake Mendota, WI - 26AUG2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020556 | Freshwater microbial communities from Lake Mendota, WI - 03AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021520 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L227-8m | Environmental | Open in IMG/M |
| 3300021600 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L626-11m | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300024356 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepC_8d | Environmental | Open in IMG/M |
| 3300024515 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8d | Environmental | Open in IMG/M |
| 3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
| 3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| RCM31_102114771 | 3300001851 | Marine Plankton | MTFKSLPLTVREIKATEATLERIYNAAYLGLKNDSLALAAGMLPVEFN |
| JGI24028J26656_10212521 | 3300002091 | Lentic | MFDNFESFPYEVRKLEATEARLQRIYDAAKLGLKGDTLALAA |
| MLSBCLC_105505141 | 3300002220 | Hydrocarbon Resource Environments | MHTLVSLPFEPRILQATESRLKAIYDAAKLGLRGDALALS |
| Ga0079957_10727626 | 3300005805 | Lake | MTFQSLPYDPRPLTATEARLEAIYAAAKLGLKGDSL |
| Ga0075470_101900501 | 3300006030 | Aqueous | MTFQSLPLTARKLEATEARLQRIYEAAKLGLKGDSLALK |
| Ga0075472_105269961 | 3300006917 | Aqueous | MTFQSLPLTARKLEATEARLQRIYEAAKLGLKGDSLALKA |
| Ga0070746_100253341 | 3300006919 | Aqueous | MTFVSLPYEPRVIAATEARLEQIYQTAKLGLKGDA |
| Ga0102532_11490243 | 3300007094 | Freshwater Lake | MTFVSLPYEPRVIAATEARLEQIYQTAKLGLKGDAL |
| Ga0070745_12527341 | 3300007344 | Aqueous | MKSFHYEPREIKATEARLRSIYDAAYLGLKGDSLALAAG |
| Ga0099846_11195341 | 3300007542 | Aqueous | MFKSLPFEPREIKATEARLQAIYDAAALGLKGDSLA |
| Ga0099846_12484901 | 3300007542 | Aqueous | MIFSLPLAVRDVKATEARLQSIYDAAALGLKGDALALAA |
| Ga0102865_12412931 | 3300007639 | Estuarine | MFHSLPFEPRKVVATEARLNKIYDAAKLGLKGDALALAS |
| Ga0114363_11952751 | 3300008266 | Freshwater, Plankton | MKSLPLTAREVKATEAVLTRIYDNAKLGLRGRSLALACDLRPEEY |
| Ga0114876_11478571 | 3300008448 | Freshwater Lake | MFESLPYEPRELKATEARLQRGYEAAALGLKGDSLALAA |
| Ga0114876_12191671 | 3300008448 | Freshwater Lake | MFYSLPFEARKVEATEARLNRIYDAAKLGLKGDSLAMAA |
| Ga0114880_11822021 | 3300008450 | Freshwater Lake | VFKSIPFTPRKVEATEARLQAIYDAAALGLKGDSLALA |
| Ga0114865_11821331 | 3300008459 | Freshwater Lake | MKSFHYEPREIKATEARLRSIYDAAYLGLKGDSLAL |
| Ga0105105_102992581 | 3300009009 | Freshwater Sediment | MFESFPLSIRQIKATESRLKAIYDAAKLGLSGDSL |
| Ga0114977_100586298 | 3300009158 | Freshwater Lake | MFKSLPLTVRHVQATESRLQAIYDAAKLGLKGDTLALA |
| Ga0114977_102520011 | 3300009158 | Freshwater Lake | LFKSLPLTVRHVQATESRLQAIYDAAKLGLKGDTLALASGMR |
| Ga0114977_102848793 | 3300009158 | Freshwater Lake | MQMFDNFHSFVYEPRKLEATEARLERIYNAAKLGLKG |
| Ga0114977_106915001 | 3300009158 | Freshwater Lake | MFDNYHSYVYEPRKLEATEARLERIYNAAKLGLKGD |
| Ga0114978_105025331 | 3300009159 | Freshwater Lake | MFYSIPFTPRKIEATEARLHAIYDAAKLGLHGDALALAAGMLPTE |
| Ga0114981_106079492 | 3300009160 | Freshwater Lake | MFKSLPLTVRHVQATESRLQAIYDAAKLGLKGDTLAL |
| Ga0114970_101478293 | 3300009163 | Freshwater Lake | MKSLPLEIREIRATEARLQQIYEAARLGLKGDSLA |
| Ga0114970_101986061 | 3300009163 | Freshwater Lake | VLAKENHLFKSLPLTVRHVQATESRLQAIYDAAKLGLKGDTLAL |
| Ga0114970_107895812 | 3300009163 | Freshwater Lake | MFKSLPFAPRVVKATEQRLNAIYTASNLGLKGDSL |
| Ga0105102_107869401 | 3300009165 | Freshwater Sediment | MFYSLPYSPRQIQATESRLNAIYDAAKLGLKGDTLA |
| Ga0105097_109142701 | 3300009169 | Freshwater Sediment | MSFHSLPLVINEVRATEAVLNRIYDAAKLGLKGDNLAL |
| Ga0114974_102714222 | 3300009183 | Freshwater Lake | MKSLPLEIREIRATEARLQQIYDAARLGLKGDSLALA |
| Ga0114972_100404056 | 3300009187 | Freshwater Lake | MFDNFHSYVYEPRKLEATEARLQRIYDAAKLGLKGDTL |
| Ga0114967_101519132 | 3300010160 | Freshwater Lake | MFDNFHSYVYEPRKLEATEARLQRIYDAAKLGLKGDT |
| Ga0114967_104580982 | 3300010160 | Freshwater Lake | MQMFDNFHSYVYEPRKLEATEARLQRIYDAAKLGLKGD |
| Ga0129333_103925601 | 3300010354 | Freshwater To Marine Saline Gradient | MTFQSLPLTARKLEATEARLQRIYEAAKLGLKGDSLA |
| Ga0129333_115398351 | 3300010354 | Freshwater To Marine Saline Gradient | MFKSLPITVREIKATEAVLERIYDAAYLGLKEDSLALAAG |
| Ga0133913_1016927812 | 3300010885 | Freshwater Lake | MFKSLPLTVRHVQATESRLQAIYDAAKLGLKGDTLALASGMRPE |
| Ga0133913_106264161 | 3300010885 | Freshwater Lake | MFYSIPFTPRKIEATEARLHAIYDAAKLGLHGDAL |
| Ga0133913_135729181 | 3300010885 | Freshwater Lake | MFDNFHSYVYEPRKLEATEARLQRIYDAAKLGLKG |
| Ga0137575_100431352 | 3300010970 | Pond Fresh Water | MFQSLPLTIREVKATEARLNAIYEAAKLGLKGDSLALA |
| Ga0181338_10215612 | 3300015050 | Freshwater Lake | MFESLPFAPRKVEATEARLHRIYEAAKLGLKGDSLAL |
| Ga0181339_10056246 | 3300017700 | Freshwater Lake | MFDNFHSYVYEPRKLEATEARLQRIYDAAKLGLKGD |
| Ga0181350_10174661 | 3300017716 | Freshwater Lake | MAYNSRMFHSLPFEPRKVVATEARLNKIYEAAKLG |
| Ga0181350_11701791 | 3300017716 | Freshwater Lake | MSYYSIPYAPRRLEATEARLDAIYSAAKLGLKGDTL |
| Ga0181347_11196461 | 3300017722 | Freshwater Lake | MFYSLPFEARKVEATEARLNRIYDAAKLGLKGDSL |
| Ga0181365_11764042 | 3300017736 | Freshwater Lake | MFYSLPFEPRKVVATEARLNKIYDAAKLGLKGDALALA |
| Ga0181344_12253621 | 3300017754 | Freshwater Lake | MFDNFHSYVYEPRKLEATEARLQRIYNAAKLGLKGNTLAF |
| Ga0181343_10716402 | 3300017766 | Freshwater Lake | MAYNSHMFHSLPFEPRKVVATEARLNKIYEAAKLGLKGDA |
| Ga0181343_11072042 | 3300017766 | Freshwater Lake | MRSLPLTIREVKATEATLNRIYDAAKLGLKGDSLALAAG |
| Ga0181343_11140942 | 3300017766 | Freshwater Lake | MFQSFHYEPRKLEATEARLEAIMKAAKLGLKGDSLAL |
| Ga0181343_11991921 | 3300017766 | Freshwater Lake | MFYSLPFEARKVEATEARLNRIYDAAKLGLKGDSLAMAAGM |
| Ga0181358_11596591 | 3300017774 | Freshwater Lake | MSFYSLPLVINEIRATEAVLNRIYDAAKIGLKGDSLALAAGL |
| Ga0181358_12335871 | 3300017774 | Freshwater Lake | MFHSLPFEPRKVVATEARLNKIYDAAKLGLKGDALAL |
| Ga0181357_10175401 | 3300017777 | Freshwater Lake | MFYSLPYEARKVEATEARLNRIYDAAKLGLKGDTLAMAAGM |
| Ga0181349_11300342 | 3300017778 | Freshwater Lake | MFRNIPFEPRVLRATEARLESIYLAAKAGLKGDSLALAS |
| Ga0181349_11720641 | 3300017778 | Freshwater Lake | MFKSLPFTPRVVKATEQRLNAIYAASNLGLKGDALALA |
| Ga0181346_11423051 | 3300017780 | Freshwater Lake | MFQSLPLTIREVKATEARLNAIYDAAKLGLKGDSLALA |
| Ga0181355_13733981 | 3300017785 | Freshwater Lake | MFHSLPFEPRKVVATEARLNKIYEAAKLGLKGDALA |
| Ga0211736_104484891 | 3300020151 | Freshwater | MFDNFHSYVYEPRKLEATEARLQRIYDAAKLGLKGDTLALAAGM |
| Ga0194049_100008150 | 3300020157 | Anoxic Zone Freshwater | MFQSLPLTIRKVEATESRLQSIYDAAKLGLKGDTLAL |
| Ga0208359_10671951 | 3300020541 | Freshwater | MFKSLPLTIREVKATEAVLNRVYDAAKRGLKGDNLALAAG |
| Ga0208486_10274242 | 3300020556 | Freshwater | MFHSIPFTPRKVEATESRLKAIYDAAKLGLKGDALA |
| Ga0194048_103173351 | 3300021519 | Anoxic Zone Freshwater | MSVLSIPFTPREIKATESRLQAIYDAAKLGLKNDNLA |
| Ga0194053_101125453 | 3300021520 | Anoxic Zone Freshwater | MFHSIPFTPRKVEATESRLKAVYDAAKLGLKGDALAL |
| Ga0194059_10479832 | 3300021600 | Anoxic Zone Freshwater | MFKSLPLTVRHVQATESRLQAIYDAAKLGLKGDTLALASG |
| Ga0213922_10754151 | 3300021956 | Freshwater | MFQSLPLTIREVKATEARLEAIYAAAKKGLKGDSLAL |
| Ga0222712_106229271 | 3300021963 | Estuarine Water | MISIPFTPREVQATEWRLQQIYDAAALGLKGDKLALA |
| Ga0181354_10568562 | 3300022190 | Freshwater Lake | MFNSYPYEVRKLEATEVRLEAIKEAAKLGLKGDALAIAAG |
| Ga0181351_10352061 | 3300022407 | Freshwater Lake | MFKSLPHAPRQLNATEARLQAIYDAAALGLKGDNLALF |
| Ga0255169_10715801 | 3300024356 | Freshwater | MFKSLPLTTREIKATEAVLERIYDAAYLGLKEDSLALAA |
| Ga0255183_10979351 | 3300024515 | Freshwater | MFESFPLSIRQVKATESRLKAIYDAAKLGLSGDTLALAA |
| Ga0208546_10017617 | 3300025585 | Aqueous | MTFQSLPLTARKLEATEARLQRIYEAAKLGLKGDSLALKAG |
| Ga0208546_10037261 | 3300025585 | Aqueous | MTFQSLPLTARKLEATEARLQRIYEAAKLGLKGDS |
| Ga0208546_10450641 | 3300025585 | Aqueous | MTFQSLPLTIRKIEATEARLNRIYDAAKRGLKGDTLALAAGMRPEEY |
| Ga0208147_10390713 | 3300025635 | Aqueous | MFNSLPYEPRVLAATEDRLTQIYEAAKLGLKGDALALA |
| Ga0208975_10440693 | 3300027659 | Freshwater Lentic | MGIHSLPLTVRKLEATESRLQAIYDAAKLGLKGDTLALA |
| Ga0209297_13041291 | 3300027733 | Freshwater Lake | MRMFDNFHSYVYEPRKLEATEARLQRIYDAAKLGLKGDTLAL |
| Ga0209087_10724491 | 3300027734 | Freshwater Lake | MFYSIPFTPRKVEATESRLKAVYDAAKLGLKGDALA |
| Ga0209190_13755651 | 3300027736 | Freshwater Lake | MRMFDNFHSYVYEPRKLEATEARLERIYNAAKLGLKGDTL |
| Ga0209296_12981791 | 3300027759 | Freshwater Lake | MFQSFHYEPRKLQATEARLEAIMKAAKLGLKGDSLA |
| Ga0209088_103310762 | 3300027763 | Freshwater Lake | MFHSLPFEPRKIVATEARLNKIYEAAKLGLKGDALALAN |
| Ga0209287_104422421 | 3300027792 | Freshwater Sediment | MSFHSLPLVINEVRATEAVLNRIYDAAKLGLKGDNLALAA |
| Ga0209353_100163149 | 3300027798 | Freshwater Lake | MFDNFHSYVYEPRKLEATEARLQRIYDAAKLGLKGDTLA |
| Ga0209777_100858071 | 3300027896 | Freshwater Lake Sediment | MEFISLLYEPRKLQATEKNLQAVYDAAKLGLKGDALAL |
| Ga0209400_11024761 | 3300027963 | Freshwater Lake | MFKSLPLTVRNVQATEARLQSIYDAAKLGLKGDSLALAAG |
| Ga0304730_11001201 | 3300028394 | Freshwater Lake | MFESLPFAPRKVEATEARLNRIYEAAKLGLKGDSL |
| Ga0302323_1020187031 | 3300031232 | Fen | VTIPNTARAVKATESRLERIYAAARAGLKGDTLALSAGM |
| Ga0315905_115201001 | 3300032092 | Freshwater | MSTFVTIPFEPRSIRATEKVLTKIYEAAYLGLKGDSLALAS |
| Ga0315905_115555911 | 3300032092 | Freshwater | MFKSLPLTIREVKATEAVLNRVYDAARMGLKGDSLALRAG |
| Ga0315268_119457621 | 3300032173 | Sediment | MFYSIPFTPRKVQATESRLKAVYDAAKLGLKGDTL |
| Ga0334977_0456925_2_109 | 3300033978 | Freshwater | MTFQSLPLTARKLEATEARLQRIYEAAKLGLKGDSL |
| Ga0334978_0476841_478_582 | 3300033979 | Freshwater | MTFLSIPFTPREVKATESRLQKIYDAAKLGLKNDS |
| Ga0334996_0221669_1_114 | 3300033994 | Freshwater | MFHSIPFTPRKVEATESRLKAVYDAAKLGLKGDALALA |
| Ga0334986_0126823_2_133 | 3300034012 | Freshwater | MFKSLPLTIREVKATEAVLNRVYDAAKRGLKGDNLALAAGLLPS |
| Ga0334987_0690689_472_585 | 3300034061 | Freshwater | MFKSIPFSPRKVEATEARLQAIYDAAALGLKGDSLALA |
| Ga0335028_0637468_1_105 | 3300034071 | Freshwater | MSLKSLPFAPREVKATEKTLQAIYDAAALGLKGDT |
| Ga0335012_0130082_1267_1386 | 3300034093 | Freshwater | MFKSLPLTVREVRATEANLERIYASATLGLKGDSLALASG |
| Ga0335027_0842757_3_107 | 3300034101 | Freshwater | MFETLPYEPRQLQATEDRLHRIYNAAKLGLKGDNL |
| Ga0335031_0476481_2_118 | 3300034104 | Freshwater | MFHSLPFEPRKVVATEARLNKIYEAAKLGLKGDALALAS |
| Ga0335035_0563682_3_116 | 3300034105 | Freshwater | MKSLPLEIREIRATEARLQQIYEAARLGLKGDSLALAS |
| Ga0335036_0755305_448_567 | 3300034106 | Freshwater | MFKSLPLTVRTIEATEAVLERIYDAAYLGLKEDSLALAAG |
| Ga0335036_0813271_1_129 | 3300034106 | Freshwater | MFKSLPLTVRTIEATEAVLERIYNAAYLGLKEDSLALAAGLLP |
| Ga0335050_0358221_1_123 | 3300034108 | Freshwater | MFKSFPLTIREVKATETRLQSIYDAAKMGLKGDTLALASGM |
| Ga0335053_0037286_3356_3493 | 3300034118 | Freshwater | MFKSLPLTTREIKATEAVLERIYDAAYLGLKEDSLALAAGLLPIEY |
| Ga0335058_0115624_1461_1568 | 3300034121 | Freshwater | MFKSLPLTVRHVQATESRLQAIYDAAKLGLKGDTLA |
| ⦗Top⦘ |