Basic Information | |
---|---|
Family ID | F096718 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 104 |
Average Sequence Length | 44 residues |
Representative Sequence | AFSAVFSAKSMKEGTVMPRIIGRNLLLDAPSAKVDTGFA |
Number of Associated Samples | 99 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 0.00 % |
% of genes from short scaffolds (< 2000 bps) | 0.00 % |
Associated GOLD sequencing projects | 98 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.22 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (100.000 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (10.577 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.808 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (43.269 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.37% β-sheet: 0.00% Coil/Unstructured: 74.63% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.22 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF01479 | S4 | 10.58 |
PF00472 | RF-1 | 0.96 |
PF14437 | MafB19-deam | 0.96 |
PF12705 | PDDEXK_1 | 0.96 |
COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
---|---|---|---|
COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 0.96 |
COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 0.96 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 100.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.58% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.77% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.81% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.81% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.81% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.88% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.88% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.88% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.88% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 1.92% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.92% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.92% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.92% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.92% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.92% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.92% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.92% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.92% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.92% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.96% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.96% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.96% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.96% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.96% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.96% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.96% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.96% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.96% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.96% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.96% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.96% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.96% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.96% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.96% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.96% |
Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.96% |
Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.96% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
2170459015 | Litter degradation PV4 | Engineered | Open in IMG/M |
3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
3300003369 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-22A | Environmental | Open in IMG/M |
3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300003861 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005511 | Combined assembly of arab plate scrape MF_Col (Combined Assembly) | Host-Associated | Open in IMG/M |
3300005513 | Combined assembly of arab plate scrape CL_Cvi (Combined Assembly) | Host-Associated | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009651 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-063 | Environmental | Open in IMG/M |
3300009787 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fa - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
3300010869 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300011999 | Permafrost microbial communities from Nunavut, Canada - A28_65cm_6M | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025457 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026354 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B | Environmental | Open in IMG/M |
3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300027310 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB (SPAdes) | Environmental | Open in IMG/M |
3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
3300028866 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2 | Environmental | Open in IMG/M |
3300029992 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_3 | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030003 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_3 | Environmental | Open in IMG/M |
3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300030045 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_3 | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Host-Associated | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031837 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1 | Environmental | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300033826 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 E2 1-5 | Environmental | Open in IMG/M |
3300034196 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_18 | Environmental | Open in IMG/M |
3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
3300034384 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
E4A_09409320 | 2170459003 | Grass Soil | PAFLAVFSAKSMKEGTVMPRIIRRNLLLDAPSAKVDADFA |
4PV_00798420 | 2170459015 | Switchgrass, Maize And Mischanthus Litter | VFSAKSMKEGAVIPRIIGRNLLLEAPSANVDTGFA |
JGI25616J43925_104007072 | 3300002917 | Grasslands Soil | SPLSTITHPIGTSPAFPAFWAAFSAKSMKDGALMSRLFVKSLLLEEHSAKVDTGFA* |
JGI24140J50213_102006672 | 3300003369 | Arctic Peat Soil | THPIGTSPDFPAFFAVFSAKSMKEGAVMPRIIGRNLLLGTHSAKVDTGFA* |
JGI25404J52841_100063501 | 3300003659 | Tabebuia Heterophylla Rhizosphere | ISAWAVGSRSVRVRLPALATTSLPRTITHPIGTSPDFSAISADFSAKSMKEGAFMPRIARGNLLLDGPSAKVDSGFA* |
Ga0031654_101314391 | 3300003861 | Freshwater Lake Sediment | MTSLLSTITHPIGTSPDFPALSAAFSAKSMKDGAVMPRIISKSLVVEAHSAKVESGFA* |
Ga0062595_1010464182 | 3300004479 | Soil | ITHPIGTSPDFPAFSAAFSAKSMKDGAVMSRIIGKSLVLEAHSAKVDTGFA* |
Ga0070673_1021459722 | 3300005364 | Switchgrass Rhizosphere | FPAFSAVLSAKSMKEGAFMPRIIGRNLLLAAPSANVDAGFA* |
Ga0070659_1015830121 | 3300005366 | Corn Rhizosphere | AFPAFSAVFSAKSMKEGAFMPRILGKNLLVGTPFSKSGFGFA* |
Ga0070678_1019045732 | 3300005456 | Miscanthus Rhizosphere | LAAFLAVFSAKSMKEGAVIPRIIGRNLLLEAPSANVDTGFA* |
Ga0070706_1012862301 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | DFRAVSAAFSAKSMKDGAVMARIQAKCLLIKLHSAKVDTGFA* |
Ga0077121_108240902 | 3300005511 | Arabidopsis Rhizosphere | AFPAFSAVLSAKSMKEGAFKPRIIARNLLVAPPSARVNTGFA* |
Ga0077120_12462021 | 3300005513 | Arabidopsis Rhizosphere | SPAFPALSAAFSAKSMKEGAVNGSFPAQNSATELHSAKVDTGFA* |
Ga0070684_1000088628 | 3300005535 | Corn Rhizosphere | SRTITHPIGTSPDFPAFSAAFSAKSMKDGAVMSRIIGKSLVLEAHSAKVDTGFA* |
Ga0070686_1001780752 | 3300005544 | Switchgrass Rhizosphere | FPAFSAVLSAKSMKEGAVMPRIIERNLLLAAPSAKVDAGFA* |
Ga0070665_1011195912 | 3300005548 | Switchgrass Rhizosphere | FSAKSMKEGAFMPRIASGNLLLDGPSAKVDSRFA* |
Ga0070665_1023035522 | 3300005548 | Switchgrass Rhizosphere | PALSAVLSAKSMKEGAFKPRIIRRNLLVAAPSAEVLTEFA* |
Ga0070665_1023983521 | 3300005548 | Switchgrass Rhizosphere | TITHPIGTSPAFRAVSAAFSAKSMKDGAVMSRNARKSLVGNGHSAKVDTGFA* |
Ga0068857_1017176912 | 3300005577 | Corn Rhizosphere | AVFSAKSMKEGAFMPRIIGKNLLVHGPSAKVDSGFA* |
Ga0068852_1025275392 | 3300005616 | Corn Rhizosphere | SAVLSAKSMKEGAFKPRIIRRNLLVAAPSAEVHTEFA* |
Ga0070764_101025672 | 3300005712 | Soil | FSAVFSAKSMKEGTLMPRIIGRNLLLTAPSAKVDTGFA* |
Ga0068861_1026674951 | 3300005719 | Switchgrass Rhizosphere | THPIGTSPDFPAISAAFSAKSIKEGAFMPRIAGGNLLVDGPSAKVDSGFA* |
Ga0070717_120378072 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | DLPAFFAVFSAKSMKDGTVMPRIIGKNLLLDAPSAKVDADFA* |
Ga0066696_110791772 | 3300006032 | Soil | AVFSAKSMKEGAVMPRIIARNLLLDAPSAKVDTGFA* |
Ga0075365_109679182 | 3300006038 | Populus Endosphere | VLSAKSMKEGAVIPRIIGRNLLLEAPSANVDAGFA* |
Ga0075028_1000562281 | 3300006050 | Watersheds | AVSAAFSAKSMKDGADMSRIARRTLLLQTPSAKVDTGFA* |
Ga0075364_106586462 | 3300006051 | Populus Endosphere | PALAAFLAVLSAKSMKEGVVIPRIIGRNLLLEAPSANVDAGFA* |
Ga0075435_1019570222 | 3300007076 | Populus Rhizosphere | AISADFSAKSMKEGAFMPRIASGNLLLDGPSAKVDSGFA* |
Ga0111539_130490732 | 3300009094 | Populus Rhizosphere | LAVFSAKSMKEGAFVPRIIGGNLLLTAPSAKVDARFA* |
Ga0105859_11978391 | 3300009651 | Permafrost Soil | KVRLPDVAITSLLSAITHPIGTSPDFRAVSAAFSAKSMKEEAVMARIQAKCLLIEVHSAKVDAGFA* |
Ga0116226_120937942 | 3300009787 | Host-Associated | HPIGTSPAFPAFSADFSAKSIKEGAVMPRIIGGNLLSGASAARVNDGFA* |
Ga0126359_16234442 | 3300010869 | Boreal Forest Soil | AFSAKSMKEGAVMARIQAKCLLIEVHSAKVDAGFA* |
Ga0126350_103033951 | 3300010880 | Boreal Forest Soil | THPIGTSPDFPAFSAVFSAKSIKDGAVMPRIIGKYLLLAAPSARVDTGFA* |
Ga0105246_125033961 | 3300011119 | Miscanthus Rhizosphere | IGTSPAFPAFFAVFSAKSMKEGGIMPRIIGQNLLLGRPSANVDTGFA* |
Ga0137392_109219471 | 3300011269 | Vadose Zone Soil | FPAFSAVFSAKSMKEGAVIPRIIGTNLLLDAPSAKVNPGFA* |
Ga0137393_115280102 | 3300011271 | Vadose Zone Soil | VSAAFSAKSMKEGVVMPRLCAKSLLLQAHSAKVEPGFA* |
Ga0120148_10699761 | 3300011999 | Permafrost | MTXXXXSRTITHPIGTSPDFPAFSAAFSAKSMKDGAVMSRITGKSLVLEAHSAKVDTGFA |
Ga0137399_106652882 | 3300012203 | Vadose Zone Soil | HPIGTSPDFPAFSAAFSAKSMKDGAVMPRNIGETLLLNVPSAKVDTGFA* |
Ga0137362_116301542 | 3300012205 | Vadose Zone Soil | LPAFFAVFSAKSMKEGTVMPRIIGRNLLLDAPSAKVDADFA* |
Ga0137372_109265422 | 3300012350 | Vadose Zone Soil | VKVRFPADAMTSPLSTITHPTGTSPAFPAFWAAFSAKSMKDGALMPRLFVKSLLLEGHSAKVDTGFA* |
Ga0157310_102522282 | 3300012916 | Soil | AFPAFSAVFSAKSMKEGAVMPRIIERNLLLTAPSANVDAGFA* |
Ga0137394_106843801 | 3300012922 | Vadose Zone Soil | THPIGTSPDFPVFSAFFSAKSMKEGAVMPRIIGRNLLLDAPSAKVEPDFA* |
Ga0137359_114562622 | 3300012923 | Vadose Zone Soil | TITHPIGTSPDFPAFSAAFSAKSMKDGAVMSRIIGKSLVLGAHSAKVDTGFA* |
Ga0137413_117572541 | 3300012924 | Vadose Zone Soil | AFPAFSAVFSAKSMKEGVVMPRIIGRNLLLAAPSAKVDTGFA* |
Ga0137413_118378851 | 3300012924 | Vadose Zone Soil | TITHPIGTSPDFPAFSAAFSAKSMKDGAVMPRLAGKTLLGKAHSAKVDAGFA* |
Ga0137419_104941981 | 3300012925 | Vadose Zone Soil | AFSAKSMKEGAVMARIQAKCLLIKVHSAKVDTGFA* |
Ga0137407_114561702 | 3300012930 | Vadose Zone Soil | RFPAEAMTSPARTITHPIGTSPDFPAFLAAFSAKSMKDGAVMPRIARKSLVLNVNSAKVDAGFA* |
Ga0164308_103385412 | 3300012985 | Soil | FSAFFSAKSMKEGAVMPRIIARNLLLDAPSAKVDPDFA* |
Ga0164308_104239841 | 3300012985 | Soil | AAFLAVFSAKSMKEGAVIPRIIGRNLLLEAPSANVDTGFA* |
Ga0157374_123538531 | 3300013296 | Miscanthus Rhizosphere | ITHPIGTSPDFPAFLAVFSAKSMKEGTVMPRIIGRNLLLDAYSAKVDAGFA* |
Ga0163162_121584952 | 3300013306 | Switchgrass Rhizosphere | PAFSAVFSAKSMKEGAVMPRIIERNLLLTAPSANVDAGFA* |
Ga0163163_120965792 | 3300014325 | Switchgrass Rhizosphere | FPAFSAVFSAKSMKEGGVMPRIIERNLLVAAPSANVDAGFA* |
Ga0182024_125711301 | 3300014501 | Permafrost | AFSAKSMKVGSVMPRIARITLLVDAASAKVDTGFA* |
Ga0132257_1013625252 | 3300015373 | Arabidopsis Rhizosphere | FSAFFSAKSMKEGAVMPRIIARNLLVDAPSAKVDPDFA* |
Ga0163161_111177631 | 3300017792 | Switchgrass Rhizosphere | IGTSPDFAAISADFSAKSMKEGAFMPRIASGNLLLDGPSAKVDSRFA |
Ga0187847_100541711 | 3300017948 | Peatland | IGTSPDFPAFLAVLSAKSMKDGAVMPRIIRKYLLLDAASAKVDAGFA |
Ga0184605_103942712 | 3300018027 | Groundwater Sediment | HPIGTSPDFPAFLAAFSAKSMKDGAVMPRIHAKSLLLGAHPAKVEPGFA |
Ga0193713_10300612 | 3300019882 | Soil | FSAVFSAKSMKEGAVMPRIIRRNLLLETHSAKVDTGFA |
Ga0193729_10601362 | 3300019887 | Soil | SPDFRAVSAAFSAKSMKEGAVMARIQAKCLLIELHSAKVDTGFA |
Ga0210385_107612292 | 3300021402 | Soil | AVFSAKSMKEGTVMPRIIGINLLREAPSAKVDTGFA |
Ga0210410_107881112 | 3300021479 | Soil | TITHPIGTSPAFPAFSAVFSAKSMKDGAVMPRIIGKYLLLAAASAKVDTDFA |
Ga0210409_116177672 | 3300021559 | Soil | PAFPAFFAVFSAKSMKEGAVIPRIIGRNLLLEGHSAKVDTDFA |
Ga0213853_109234411 | 3300021861 | Watersheds | DFSAVSAAFSAKSMKEGAVMARIKAKCLLIELHSAKVDTGFA |
Ga0213853_111989072 | 3300021861 | Watersheds | AVLSAKSMKEGGIMPRIIGQNLLLHRPSANVDTGFA |
Ga0208850_10506061 | 3300025457 | Arctic Peat Soil | FSAAFSAKSMKDGAVMSRLYAKSLLLEAHSAKVDTGFA |
Ga0207685_102846891 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | VFSAFFSAKSMKEGAVMPRIIARNLLLDAPSAKVDPDFA |
Ga0207663_113457791 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | FRAFSAAFSAKSMKDDAVMPRIARRNLLLDTPSAKVDAGFA |
Ga0207660_100582593 | 3300025917 | Corn Rhizosphere | TSPAFPAFAAVFSAKSMKEGAFMPRIIGKNLLLDAPSAKVDSGFA |
Ga0207646_104067192 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MTHPIGTSPDFPVFSAFFSAKSMKEGAVMPRIIARNLLLDAPSAKVDPDFA |
Ga0207664_103557362 | 3300025929 | Agricultural Soil | IGTSPAFPALSAAFSAKSMKEGAVNGSFPAQNSATELHSAKVDTGFA |
Ga0207640_108883672 | 3300025981 | Corn Rhizosphere | AFPAFSAVFSAKSMKEGGVMPRIIERNLLVAAPSANVDAGFA |
Ga0257180_10413321 | 3300026354 | Soil | DFPVFSAFFSAKSMKEGAVMPRIIGRNLLLDAPSAKVDPDFA |
Ga0257177_10804002 | 3300026480 | Soil | PAFWAAFSAKSMKDGALMSRLFVKSLLLEEHSAKVDTGFA |
Ga0257164_10382711 | 3300026497 | Soil | FPVFSAFFSAKSMKEGAVMPRIIGRNLLLDAPSAKVEPDFA |
Ga0209690_11772521 | 3300026524 | Soil | AFSAVFSAKSMKEGTVMPRIIGRNLLLAAPSANVDAGFA |
Ga0209056_103274691 | 3300026538 | Soil | FPAVSAAFSAKSMKEGAVMPRLCPKSLLLQSHSAKVEPGFA |
Ga0207983_10492052 | 3300027310 | Soil | PAFLAVFSAKSMKEGAVMPRIIGRNLLVEAPSAKVDTGFA |
Ga0209527_10632722 | 3300027583 | Forest Soil | PAFPAFSAVLSAKSMKEGTVMPRIIGKNLLLDATSAKVDTDFA |
Ga0209329_10679392 | 3300027605 | Forest Soil | VFSAKSMKEGAVIPRIIGRNLLLDGHSAKVDTGFA |
Ga0209422_11551652 | 3300027629 | Forest Soil | AFAAFFAVFSAKSMKEGAVIPRIIGRNLLLGGHSAKVDTGFA |
Ga0208989_101376811 | 3300027738 | Forest Soil | VFSAKSMKEGAVMPRIIGTNLLLDAASAKVDIGFA |
Ga0268266_118887361 | 3300028379 | Switchgrass Rhizosphere | TITHPIGTSPAFRAVSAAFSAKSMKDGAVMSRNARKSLVGNGHSAKVDTGFA |
Ga0268265_104964051 | 3300028380 | Switchgrass Rhizosphere | AFPAFSAVLSAKSMKEGAFKPRIIARNLLVAAPSAEVLTDIA |
Ga0302226_104491231 | 3300028801 | Palsa | FSAAFNAKSMKVGAVMSRIAGKSLILESHSAKVDTGFA |
Ga0302278_104566471 | 3300028866 | Bog | LPAFLAVFSAKSMKEGTVMPRIIGKNLLLGAHSAKVDTGFA |
Ga0302276_100168305 | 3300029992 | Bog | FLAVFSAKSMKEGTVMPRIIGKNLLLGAHSAKVDTGFA |
Ga0311339_106230412 | 3300029999 | Palsa | ITHPIGTSPAFPAFSADFRAKSIKEGAAMPRIIERNLLLAAASANVDTGFA |
Ga0302172_102337772 | 3300030003 | Fen | AVFSAKSMKEGGIMPRIIGQNLLLHLPSANVDTGFA |
Ga0311348_108422891 | 3300030019 | Fen | AVFSAKSMKEGGIMPRIIGQNLLLHRPSANVDTGFA |
Ga0302282_11801181 | 3300030045 | Fen | PAFSAAFSAKSMKDGAVMPRIIRKTLLGNGASAKVDTGFA |
Ga0311370_119646521 | 3300030503 | Palsa | AFSAAFSAKSMKDGAVMPRIAGRTLLWDGPSAKVDTDFA |
Ga0311355_118898132 | 3300030580 | Palsa | AFSAVFSAKSMKEGTVMPRIIGRNLLLDAPSAKVDTGFA |
Ga0265316_107021302 | 3300031344 | Rhizosphere | AVFSAKSMKEGAVIPRIIGRNLLLDSHSAKVDTGFA |
Ga0310686_1134389082 | 3300031708 | Soil | SAAFSAKSMKDGAVMPRIARRTLLWEVPSAKVDAGFA |
Ga0307476_107743661 | 3300031715 | Hardwood Forest Soil | PDFPAFSAVFSAKSMKDGAVMPRIIGKYLLLATPSAKVDAGFA |
Ga0307516_107805432 | 3300031730 | Ectomycorrhiza | FAAFLAVFSAKSLKEGAVIPRIIGRNLLVEAPSANVDTGFA |
Ga0307477_105718411 | 3300031753 | Hardwood Forest Soil | PDFPAFSAVFSAKSMKEGAVMPRIIGRNLLVDAPSAKVDLGPYVR |
Ga0302315_104754702 | 3300031837 | Palsa | IGTSPAFPAFLAVLSAKSMKDGAVMPRIIGKYLLLDAPSAKVDAGFA |
Ga0308173_108357531 | 3300032074 | Soil | AVLSAKSMKEGAFKPRIIPRNLLVAAPSAEVLTDFA |
Ga0307472_1004634561 | 3300032205 | Hardwood Forest Soil | SAVFSAKSMKEGAVMPRIIGRNLLVKQPSAKVDTGFA |
Ga0334847_000276_3269_3394 | 3300033826 | Soil | LPAFFAVFSAKSMKEGTVMPRIIGKNLLVDAPSAKVDADFA |
Ga0370503_0102857_807_962 | 3300034196 | Untreated Peat Soil | MTQPIGTSPSFSARSAAASAKSMKDGADMPRLDRKTLLEERASAKVDAGFA |
Ga0372943_0163831_32_223 | 3300034268 | Soil | LPAVAMTSKSLTITHPIGTSPDFPAFSAVFSAKSMKEGAVMPRIIRRNLLMLAASAKVDTGFA |
Ga0372946_0069964_1463_1612 | 3300034384 | Soil | HPIGTSPAFAAFSAVFSAKSMKEGAVMPRIIGTNLLLDAASAKVDIGFA |
⦗Top⦘ |