| Basic Information | |
|---|---|
| Family ID | F096701 |
| Family Type | Metagenome |
| Number of Sequences | 104 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MPNEIAPRQSTLACILTDIHFWVPVAVLIGGLVLLTFLR |
| Number of Associated Samples | 73 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 85.58 % |
| % of genes near scaffold ends (potentially truncated) | 20.19 % |
| % of genes from short scaffolds (< 2000 bps) | 67.31 % |
| Associated GOLD sequencing projects | 58 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.962 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (46.154 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.423 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (51.923 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.27% β-sheet: 0.00% Coil/Unstructured: 53.73% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF00583 | Acetyltransf_1 | 35.58 |
| PF07857 | TMEM144 | 29.81 |
| PF12697 | Abhydrolase_6 | 2.88 |
| PF00294 | PfkB | 1.92 |
| PF12695 | Abhydrolase_5 | 1.92 |
| PF00561 | Abhydrolase_1 | 0.96 |
| PF13544 | Obsolete Pfam Family | 0.96 |
| PF04366 | Ysc84 | 0.96 |
| PF08240 | ADH_N | 0.96 |
| PF12704 | MacB_PCD | 0.96 |
| PF14602 | Hexapep_2 | 0.96 |
| PF00482 | T2SSF | 0.96 |
| PF13673 | Acetyltransf_10 | 0.96 |
| PF13692 | Glyco_trans_1_4 | 0.96 |
| PF04389 | Peptidase_M28 | 0.96 |
| PF03279 | Lip_A_acyltrans | 0.96 |
| PF00535 | Glycos_transf_2 | 0.96 |
| PF00156 | Pribosyltran | 0.96 |
| PF13432 | TPR_16 | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG1560 | Palmitoleoyl-ACP: Kdo2-lipid-IV acyltransferase (lipid A biosynthesis) | Lipid transport and metabolism [I] | 0.96 |
| COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 0.96 |
| COG4261 | Predicted acyltransferase, LPLAT superfamily | General function prediction only [R] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.96 % |
| Unclassified | root | N/A | 24.04 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001089|JGI12683J13190_1001094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3945 | Open in IMG/M |
| 3300001545|JGI12630J15595_10051268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus saanensis | 825 | Open in IMG/M |
| 3300001593|JGI12635J15846_10759870 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 557 | Open in IMG/M |
| 3300002906|JGI25614J43888_10000230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 15378 | Open in IMG/M |
| 3300002910|JGI25615J43890_1080930 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 568 | Open in IMG/M |
| 3300005435|Ga0070714_100386844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1320 | Open in IMG/M |
| 3300005439|Ga0070711_101596529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus | 570 | Open in IMG/M |
| 3300005518|Ga0070699_100414308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1219 | Open in IMG/M |
| 3300005526|Ga0073909_10200401 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 862 | Open in IMG/M |
| 3300005537|Ga0070730_10001240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 24891 | Open in IMG/M |
| 3300005537|Ga0070730_10233741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1218 | Open in IMG/M |
| 3300005545|Ga0070695_100026526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3585 | Open in IMG/M |
| 3300007255|Ga0099791_10357236 | Not Available | 700 | Open in IMG/M |
| 3300007258|Ga0099793_10014904 | All Organisms → cellular organisms → Bacteria | 3097 | Open in IMG/M |
| 3300007265|Ga0099794_10325191 | Not Available | 798 | Open in IMG/M |
| 3300007265|Ga0099794_10624375 | Not Available | 571 | Open in IMG/M |
| 3300009038|Ga0099829_10448781 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300009088|Ga0099830_10360491 | Not Available | 1170 | Open in IMG/M |
| 3300009088|Ga0099830_10736475 | Not Available | 812 | Open in IMG/M |
| 3300010159|Ga0099796_10307684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 673 | Open in IMG/M |
| 3300011269|Ga0137392_11061684 | Not Available | 665 | Open in IMG/M |
| 3300011269|Ga0137392_11337847 | Not Available | 575 | Open in IMG/M |
| 3300011270|Ga0137391_10344430 | Not Available | 1281 | Open in IMG/M |
| 3300012189|Ga0137388_10925083 | Not Available | 806 | Open in IMG/M |
| 3300012189|Ga0137388_11125949 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300012202|Ga0137363_10290185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1340 | Open in IMG/M |
| 3300012202|Ga0137363_10309190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1299 | Open in IMG/M |
| 3300012202|Ga0137363_11804845 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 504 | Open in IMG/M |
| 3300012203|Ga0137399_10553979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 966 | Open in IMG/M |
| 3300012203|Ga0137399_10778475 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300012203|Ga0137399_11489182 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300012361|Ga0137360_10982527 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300012362|Ga0137361_10131694 | Not Available | 2215 | Open in IMG/M |
| 3300012683|Ga0137398_10373943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 967 | Open in IMG/M |
| 3300012685|Ga0137397_11202641 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300012917|Ga0137395_10516057 | Not Available | 861 | Open in IMG/M |
| 3300012918|Ga0137396_10736513 | Not Available | 726 | Open in IMG/M |
| 3300012925|Ga0137419_10231795 | All Organisms → cellular organisms → Bacteria | 1383 | Open in IMG/M |
| 3300012927|Ga0137416_10324870 | Not Available | 1282 | Open in IMG/M |
| 3300012927|Ga0137416_11391539 | Not Available | 635 | Open in IMG/M |
| 3300015241|Ga0137418_10011673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8095 | Open in IMG/M |
| 3300015241|Ga0137418_10027976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5220 | Open in IMG/M |
| 3300015264|Ga0137403_10008736 | All Organisms → cellular organisms → Bacteria | 11332 | Open in IMG/M |
| 3300020140|Ga0179590_1007128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2268 | Open in IMG/M |
| 3300020199|Ga0179592_10297446 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 718 | Open in IMG/M |
| 3300020579|Ga0210407_10010939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6761 | Open in IMG/M |
| 3300020579|Ga0210407_10027880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4200 | Open in IMG/M |
| 3300020579|Ga0210407_10054069 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3000 | Open in IMG/M |
| 3300020579|Ga0210407_10722533 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300020579|Ga0210407_11184812 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300020580|Ga0210403_10006151 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10103 | Open in IMG/M |
| 3300020581|Ga0210399_10714175 | Not Available | 823 | Open in IMG/M |
| 3300020583|Ga0210401_10082495 | All Organisms → cellular organisms → Bacteria | 3026 | Open in IMG/M |
| 3300021088|Ga0210404_10004081 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5894 | Open in IMG/M |
| 3300021168|Ga0210406_10003039 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 18679 | Open in IMG/M |
| 3300021170|Ga0210400_10006862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9510 | Open in IMG/M |
| 3300021171|Ga0210405_10075833 | All Organisms → cellular organisms → Bacteria | 2649 | Open in IMG/M |
| 3300021171|Ga0210405_10943305 | Not Available | 653 | Open in IMG/M |
| 3300021404|Ga0210389_11088048 | Not Available | 618 | Open in IMG/M |
| 3300021478|Ga0210402_11420202 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300021559|Ga0210409_10117029 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2452 | Open in IMG/M |
| 3300024330|Ga0137417_1270541 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300024330|Ga0137417_1436734 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
| 3300025905|Ga0207685_10587592 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 596 | Open in IMG/M |
| 3300025916|Ga0207663_11274606 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 592 | Open in IMG/M |
| 3300026304|Ga0209240_1000065 | All Organisms → cellular organisms → Bacteria | 37369 | Open in IMG/M |
| 3300026319|Ga0209647_1351331 | Not Available | 500 | Open in IMG/M |
| 3300026320|Ga0209131_1000965 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 19835 | Open in IMG/M |
| 3300026514|Ga0257168_1133035 | Not Available | 554 | Open in IMG/M |
| 3300026555|Ga0179593_1087593 | All Organisms → cellular organisms → Bacteria | 3159 | Open in IMG/M |
| 3300026555|Ga0179593_1369644 | All Organisms → cellular organisms → Bacteria | 3712 | Open in IMG/M |
| 3300027643|Ga0209076_1009424 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2472 | Open in IMG/M |
| 3300027645|Ga0209117_1000218 | All Organisms → cellular organisms → Bacteria | 33084 | Open in IMG/M |
| 3300027671|Ga0209588_1275963 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 509 | Open in IMG/M |
| 3300027674|Ga0209118_1103496 | Not Available | 803 | Open in IMG/M |
| 3300027821|Ga0209811_10220579 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300027846|Ga0209180_10483816 | Not Available | 694 | Open in IMG/M |
| 3300027846|Ga0209180_10638174 | Not Available | 585 | Open in IMG/M |
| 3300027857|Ga0209166_10001018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 25203 | Open in IMG/M |
| 3300027862|Ga0209701_10116138 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1661 | Open in IMG/M |
| 3300027903|Ga0209488_10359025 | Not Available | 1082 | Open in IMG/M |
| 3300027903|Ga0209488_10408277 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300027903|Ga0209488_10467395 | Not Available | 927 | Open in IMG/M |
| 3300028047|Ga0209526_10161060 | All Organisms → cellular organisms → Bacteria | 1568 | Open in IMG/M |
| 3300028536|Ga0137415_10086385 | All Organisms → cellular organisms → Bacteria | 2994 | Open in IMG/M |
| 3300028536|Ga0137415_10280603 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1471 | Open in IMG/M |
| 3300028536|Ga0137415_10331951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1324 | Open in IMG/M |
| 3300031715|Ga0307476_10021694 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4179 | Open in IMG/M |
| 3300031718|Ga0307474_10805635 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 743 | Open in IMG/M |
| 3300031753|Ga0307477_10021300 | All Organisms → cellular organisms → Bacteria | 4428 | Open in IMG/M |
| 3300031753|Ga0307477_10055035 | All Organisms → cellular organisms → Bacteria | 2736 | Open in IMG/M |
| 3300031753|Ga0307477_10145023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1656 | Open in IMG/M |
| 3300031753|Ga0307477_10213108 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
| 3300031754|Ga0307475_10059329 | All Organisms → cellular organisms → Bacteria | 2898 | Open in IMG/M |
| 3300031754|Ga0307475_10097079 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2294 | Open in IMG/M |
| 3300031820|Ga0307473_10631766 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300031823|Ga0307478_10135730 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1942 | Open in IMG/M |
| 3300031823|Ga0307478_11263605 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 614 | Open in IMG/M |
| 3300031962|Ga0307479_10006987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10395 | Open in IMG/M |
| 3300031962|Ga0307479_10542062 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300031962|Ga0307479_10587793 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300031962|Ga0307479_11526262 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300032174|Ga0307470_10891136 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 698 | Open in IMG/M |
| 3300032180|Ga0307471_100628852 | Not Available | 1234 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 46.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.35% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 16.35% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.77% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001089 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
| 3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12683J13190_10010942 | 3300001089 | Forest Soil | MPKETAPQQSRFASILTDIHFWVPVAVLIGGLVLLKFLR* |
| JGI12630J15595_100512682 | 3300001545 | Forest Soil | MQPNKTASRTASILTDIHFWVPVAVLIAGLLLLRSLH* |
| JGI12635J15846_107598702 | 3300001593 | Forest Soil | MRNETASRQSTFACILTDIHFWVPVAVLIAGLLLLRSFR* |
| JGI25614J43888_1000023014 | 3300002906 | Grasslands Soil | MPNEITPRQSTLASVLTDIHFWVPVAVLIGGLVLLTFLH* |
| JGI25615J43890_10809301 | 3300002910 | Grasslands Soil | MPNEITSRQSTLASVLTDIHFWVPVAVLIGGLVLLTFLR* |
| Ga0070714_1003868442 | 3300005435 | Agricultural Soil | MPNETAPRQQRTLASILTDIHFWVPVAVLIGGLTLLTFLR* |
| Ga0070711_1015965291 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MPPEITRQQIAPKQSTLACILTDVHFWVPVGVLIAGLLLLRSIH* |
| Ga0070699_1004143081 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNETAPRQSTLACILTDIHFWVPVGVLIAGLLLLRSLS* |
| Ga0073909_102004012 | 3300005526 | Surface Soil | MSNETTTRPSTLACILTDIHFWVPVGVLVAGLLLLRSLS* |
| Ga0070730_100012405 | 3300005537 | Surface Soil | MSNEISPRPSTFASILTDIHFWVPVAVLIGGLVLLTYLR* |
| Ga0070730_102337412 | 3300005537 | Surface Soil | MPNANANAPRQSTLHCILTDIHFWVPVAVLAAGLILLSLLS* |
| Ga0070695_1000265262 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MPGEIAPKQSTLACILTDVHFWVPVVVLIAGLLLLHSLS* |
| Ga0099791_103572361 | 3300007255 | Vadose Zone Soil | RMPNETAPRRSTFACIFTDIHFWVPVGVLIAGLLLLRSLS* |
| Ga0099793_100149042 | 3300007258 | Vadose Zone Soil | MPNEIAPRQSTLACILTDIHFWVPVAVLIGGLVLLRFIR* |
| Ga0099794_103251912 | 3300007265 | Vadose Zone Soil | MPNEIASRQSTFASILTDVHFWVPVAVLIGGLVLLTFLR* |
| Ga0099794_106243751 | 3300007265 | Vadose Zone Soil | GRMPNEITSRQSTLASVLTDIHFWVPVAVLIGGLVLLTFLR* |
| Ga0099829_104487812 | 3300009038 | Vadose Zone Soil | MPNEIAPRQSTLASVLTDIHFWVPVAVLIGGLVLLTFLR* |
| Ga0099830_103604912 | 3300009088 | Vadose Zone Soil | MPNETAPRQGTLASILTDIHFWVPVAVLIGGLVLLAFLR* |
| Ga0099830_107364752 | 3300009088 | Vadose Zone Soil | MPNEIASRQSTFASVLTDIHFWVPVAVLIGGLVLLTFLR* |
| Ga0099796_103076842 | 3300010159 | Vadose Zone Soil | MPNETAPRQSTLACILTDVHFWVPVGVLIAGLLLLRSLS* |
| Ga0137392_110616841 | 3300011269 | Vadose Zone Soil | QKGRMPNEITPRQSTLASVLTDIHFWVPVAVLIGGLVLLTFLH* |
| Ga0137392_113378472 | 3300011269 | Vadose Zone Soil | MPNETAPRQGTLASILTDIHFWVPVAVLIGGLVLLTFLR* |
| Ga0137391_103444301 | 3300011270 | Vadose Zone Soil | MPNEITSPQSTLASVLTDIHFWVPVAVLIGGLVLLTFLR* |
| Ga0137388_109250832 | 3300012189 | Vadose Zone Soil | FRKGRMPNEIASRQSTFASILTDVHFWVPVAVLIGGLVLLTFLR* |
| Ga0137388_111259492 | 3300012189 | Vadose Zone Soil | MPNEIAPRQSTLACILTDIHFWVPVAVLIGGLVLLTFLR* |
| Ga0137363_102901852 | 3300012202 | Vadose Zone Soil | MPNETAPRQSTFASILTDIHFWVPVAVLIGGLVLLTFLR* |
| Ga0137363_103091902 | 3300012202 | Vadose Zone Soil | MPTDIAPKQSRLVCILTDVHFWVPVAVLIAGLLLLHSLS* |
| Ga0137363_118048452 | 3300012202 | Vadose Zone Soil | MPNEIAPRQSTLASILTDIHFWVPVAVLIGGLVLLRFIR* |
| Ga0137399_105539792 | 3300012203 | Vadose Zone Soil | MPNETAPQQSTLACILTDIHFWVPVSVLIAGLLLLRSLS* |
| Ga0137399_107784752 | 3300012203 | Vadose Zone Soil | MPTDIAPKQSRLACILTDVHFWVPVAVLIAGILLLHSLS* |
| Ga0137399_114891822 | 3300012203 | Vadose Zone Soil | MPNETAPRQSTLACILSDIHFWVPLGVLIAGLLLLRSL |
| Ga0137360_109825272 | 3300012361 | Vadose Zone Soil | MPNETAPRQSTLACILTDIHFWVPVGVLIAGLLLLR |
| Ga0137361_101316942 | 3300012362 | Vadose Zone Soil | MPTDIAPKQSTLACILTDVHFWVPVAVLIAGLLLLHSLS* |
| Ga0137398_103739432 | 3300012683 | Vadose Zone Soil | MPNETAPHQSTLACILTDIHFWVPLGVLIAGLLLLRSLS* |
| Ga0137397_112026412 | 3300012685 | Vadose Zone Soil | MPNEAAPRQTTLACIPTDIHFWVPVGVLIAGLLLLRSLS* |
| Ga0137395_105160571 | 3300012917 | Vadose Zone Soil | RMPNETAPRQSTLACILTDIHFWVPLGVLIAGLLLLRSLS* |
| Ga0137396_107365132 | 3300012918 | Vadose Zone Soil | MPNEITPRQSTLASILTDIHFWVPVAVLIGGLVLLTFLR* |
| Ga0137419_102317952 | 3300012925 | Vadose Zone Soil | MPNETAPQQSTLACILTDIHFWVPLGVLIAGLLLLRSLS* |
| Ga0137416_103248702 | 3300012927 | Vadose Zone Soil | MPKEIAPRQSTLACILTDIHFWVPVAVLIGGLVLLTFLR* |
| Ga0137416_113915392 | 3300012927 | Vadose Zone Soil | MPGDIAPKQSTLACILTDVHFWVPVVVLIAGLLLLHSLS* |
| Ga0137418_100116732 | 3300015241 | Vadose Zone Soil | MPNEITSRQSTLACILTDIHFWVPVAVLIGGLVLLTFLR* |
| Ga0137418_100279765 | 3300015241 | Vadose Zone Soil | MPNETAPRQSTLACILSDIHFWVPLGVLIAGLLLLRSLS* |
| Ga0137403_100087365 | 3300015264 | Vadose Zone Soil | MPNETAPRQSTLACILTDIHFWVPLGVLIAGLLLLRSLS* |
| Ga0179590_10071282 | 3300020140 | Vadose Zone Soil | MPNETAPHQSTLACILTDIHFWVPLGVLIAGLLLLRSLS |
| Ga0179592_102974462 | 3300020199 | Vadose Zone Soil | MPTDIAPKQSTLACILTDVHFWVPVAVLIAGLLLLHSLS |
| Ga0210407_100109394 | 3300020579 | Soil | MPNEIAPRQSTLASILTDIHFWVPVAVLIGGLVLLAFLR |
| Ga0210407_100278804 | 3300020579 | Soil | MPNETAPRQSTFASILTDIHFWVPVAVLIGGLVLLTFLR |
| Ga0210407_100540693 | 3300020579 | Soil | MPNEIAPRQSTLASILTDIHFWVPVAVLIGGLVLLMFLR |
| Ga0210407_107225332 | 3300020579 | Soil | MPNEIAPRQSTLTSILTDIHFWVPVAVLIGGLVLLTFLR |
| Ga0210407_111848122 | 3300020579 | Soil | MPNEIAPRQSTFASILTDIHFWVPVAVLIGGLVLLTFLH |
| Ga0210403_100061512 | 3300020580 | Soil | MPNDIAPRQSTLASILTDIHFWVPVAVLIGGLVLLAFLR |
| Ga0210399_107141751 | 3300020581 | Soil | RLFLRKGGMPTEIAPKQSTLASILSDIHFWVPVAVLIAGLLLLRSLH |
| Ga0210401_100824953 | 3300020583 | Soil | MLKEIAPKQSTLASIFTDVHFWVPVAVLIAGLLLLRSLH |
| Ga0210404_100040812 | 3300021088 | Soil | MQPKDGLPQPSRFASIFTDIHFWVPVAVLIGGLVLLTFLH |
| Ga0210406_100030395 | 3300021168 | Soil | MPTEIAPKQSTLASILSDIHFWVPVAVLIAGLLLLRSLH |
| Ga0210400_100068624 | 3300021170 | Soil | MQPKNGSPQQSTLASIFTDIHFWVPVAVLIGGLVLLTFLH |
| Ga0210405_100758333 | 3300021171 | Soil | MRNEPASRQSTFVCILTDIHFWVPVVVLVAGLLLLRSLR |
| Ga0210405_109433052 | 3300021171 | Soil | MPNEIAPRQSTLASILTDIHFWVPVALLVGGLVLLAFLR |
| Ga0210389_110880481 | 3300021404 | Soil | MSNTNTAAPKTQSRVSTILSDVQFWVPVVVLIAGLLLLRFIH |
| Ga0210402_114202022 | 3300021478 | Soil | MPNEIASRQSTFASILTDIHFWVPVAVLIGGLVLLTFLR |
| Ga0210409_101170291 | 3300021559 | Soil | KGYMRNEPASRQSTFVCILTDIHFWVPVVVLVAGLLLLRSLR |
| Ga0137417_12705412 | 3300024330 | Vadose Zone Soil | MQPKDGLPQQSRFASIFTDIHFWVPVAVLIGGLVLLTFLH |
| Ga0137417_14367342 | 3300024330 | Vadose Zone Soil | MPNEIAPRQSTLACILTDIHFWVPVAVLIGGLVLLT |
| Ga0207685_105875921 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MPPEITRQEIAPKQSTLACILTDVHFWVPVGVLIAGLLLLRSIH |
| Ga0207663_112746062 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MPPEITRQQIAPKQSTLACILTDVHFWVPVGVLIAGLLLLRSIH |
| Ga0209240_10000657 | 3300026304 | Grasslands Soil | MPNEITPRQSTLASVLTDIHFWVPVAVLIGGLVLLTFLH |
| Ga0209647_13513311 | 3300026319 | Grasslands Soil | KAGMPGEIAPKQSTLASIFTDVHFWVPVAVLIAGLFLLSYIQ |
| Ga0209131_10009654 | 3300026320 | Grasslands Soil | MPPEITRQQIAPKQSTLACILTDVHFWVPVAVLIAGLLLLRSLH |
| Ga0257168_11330352 | 3300026514 | Soil | MPNEITSRQSTLASVLTDIHFWVPVAVLIGGLVLLTFLR |
| Ga0179593_10875933 | 3300026555 | Vadose Zone Soil | MPDEAAPRQSTLACVLTDIHFWVPLGVLIAGLLLLRSLS |
| Ga0179593_13696441 | 3300026555 | Vadose Zone Soil | MPNETAPRQSTLACILSDIHFWVPLGVLIAGLLLLRSSQLTSACNR |
| Ga0209076_10094242 | 3300027643 | Vadose Zone Soil | MPNEIAPRQSTLACILTDIHFWVPVAVLIGGLVLLRFIR |
| Ga0209117_100021812 | 3300027645 | Forest Soil | MPKETAPQQSRFASILTDIHFWVPVAVLIGGLVLLKFLR |
| Ga0209588_12759632 | 3300027671 | Vadose Zone Soil | GRMPNEITSRQSTLASVLTDIHFWVPVAVLIGGLVLLTFLR |
| Ga0209118_11034961 | 3300027674 | Forest Soil | IAAPLFRKGGMPKETAPQQSRFASILTDIHFWVPVAVLIGGLVLLKFLR |
| Ga0209811_102205791 | 3300027821 | Surface Soil | MSNETTTRPSTLACILTDIHFWVPVGVLVAGLLLLRSLS |
| Ga0209180_104838161 | 3300027846 | Vadose Zone Soil | MPNEIASRQSTFASILTDVHFWVPVAVLIGGLVLLTFLR |
| Ga0209180_106381741 | 3300027846 | Vadose Zone Soil | MPNETAPRQGTLASILTDIHFWVPVAVLIGGLVLLAFLR |
| Ga0209166_1000101821 | 3300027857 | Surface Soil | MSNEISPRPSTFASILTDIHFWVPVAVLIGGLVLLTYLR |
| Ga0209701_101161382 | 3300027862 | Vadose Zone Soil | MPNEIASRQSTFASVLTDIHFWVPVAVLIGGLVLLTFLR |
| Ga0209488_103590252 | 3300027903 | Vadose Zone Soil | PNETAPRQGTLASILTDIHFWVPVAVLIGGLVLLAFLR |
| Ga0209488_104082771 | 3300027903 | Vadose Zone Soil | MPTDIAPKQSTLACIFTDVHFWVPVAVLIAGLLLL |
| Ga0209488_104673952 | 3300027903 | Vadose Zone Soil | LRPSLGKGRMPNETAPRQSTLACILTDIHFWVPVGVLIAGLLLLRSLS |
| Ga0209526_101610603 | 3300028047 | Forest Soil | MQPKDGLPQQSRFASIFTDIHFWVPVAVLIGGLVLLTFL |
| Ga0137415_100863852 | 3300028536 | Vadose Zone Soil | MQTKDGLPQQSRFASIFTDIHFWVPVAVLAGGLVLLTFLH |
| Ga0137415_102806032 | 3300028536 | Vadose Zone Soil | MPNEITSRQSTLACILTDIHFWVPVAVLIGGLVLLTFLR |
| Ga0137415_103319512 | 3300028536 | Vadose Zone Soil | MPNETAPRQSTLACILTDIHFWVPLGVLIAGLLLLRSLS |
| Ga0307476_100216944 | 3300031715 | Hardwood Forest Soil | MPNESAPRQSTFASILTDVHFWVPVGVLIAGLLLLRWLS |
| Ga0307474_108056352 | 3300031718 | Hardwood Forest Soil | MPDEIAPRQSTLASILTDIHFWVPVAVLIGGLVLLAFLR |
| Ga0307477_100213003 | 3300031753 | Hardwood Forest Soil | MPNESAPRQSTFASIVTDIHFWVPVGVLIAGLLLLRWLS |
| Ga0307477_100550352 | 3300031753 | Hardwood Forest Soil | MPNEIAPRQSTLASILTDIHFWVPVAVLIGGLVLLTFLS |
| Ga0307477_101450232 | 3300031753 | Hardwood Forest Soil | MPNEIASRQSMLASILTDIHFWVPVAVLIGGLVLLTFLR |
| Ga0307477_102131082 | 3300031753 | Hardwood Forest Soil | MPNEVAPRQSTLASILTDIHFWVPVAVLIGGLVLLTFLR |
| Ga0307475_100593293 | 3300031754 | Hardwood Forest Soil | MPNEIASRQSMLASVLTDIHFWVPVAVLIGGLVLLTFLR |
| Ga0307475_100970792 | 3300031754 | Hardwood Forest Soil | MLNEIAPRQSTPARILTDIHFWVPVAVLIGGLVLLTFLR |
| Ga0307473_106317662 | 3300031820 | Hardwood Forest Soil | MPNEIAPRQSTFASILTDIHFWVPVAVLIGGLVLLTFLR |
| Ga0307478_101357302 | 3300031823 | Hardwood Forest Soil | MPDEIAPRQSTLASILTDIHFWVPVALLIGGLVLLAFLR |
| Ga0307478_112636052 | 3300031823 | Hardwood Forest Soil | MPNEVAPRQSTIACILTDIHFWVPVAVLIAGLLLLRSLS |
| Ga0307479_100069871 | 3300031962 | Hardwood Forest Soil | MPNEIAPRQSTLASILTDIHFWVPVAVLIAGLALLTLLR |
| Ga0307479_105420622 | 3300031962 | Hardwood Forest Soil | MPNEIAPRQGTFASILTDIHFWVPVAVLIGGLVLLTFLR |
| Ga0307479_105877932 | 3300031962 | Hardwood Forest Soil | MPNEIAPRQSTLASILTDTHFWVPVAVLIGGLVLLTFLR |
| Ga0307479_115262621 | 3300031962 | Hardwood Forest Soil | MQPKDGLPQPSRFASIFTDIHFWVPVAVLIGGLVLLTFL |
| Ga0307470_108911362 | 3300032174 | Hardwood Forest Soil | MPNETSPRRNTIASILTDIHFWVPVVVLIGGLTLLTFLR |
| Ga0307471_1006288522 | 3300032180 | Hardwood Forest Soil | MPNEIAPRQSTVASILTDIHFWVPVVVLVGGLVLLTFLR |
| ⦗Top⦘ |