| Basic Information | |
|---|---|
| Family ID | F096409 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MVKLISTESSLMFLDPKFYRHEYMTKIEFHKYSQIFLSKETIYYN |
| Number of Associated Samples | 65 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 1.92 % |
| % of genes near scaffold ends (potentially truncated) | 78.85 % |
| % of genes from short scaffolds (< 2000 bps) | 100.00 % |
| Associated GOLD sequencing projects | 65 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (93.269 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (75.962 % of family members) |
| Environment Ontology (ENVO) | Unclassified (92.308 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (91.346 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.55% β-sheet: 12.33% Coil/Unstructured: 67.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 93.27 % |
| All Organisms | root | All Organisms | 6.73 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 75.96% |
| Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 15.38% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.92% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.96% |
| Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300009992 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG | Host-Associated | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015278 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015284 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015293 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015297 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015306 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015310 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015312 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015313 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015315 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015316 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015317 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015318 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015319 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015320 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015328 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015331 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015333 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015337 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015338 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017408 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017422 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017432 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017435 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017439 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017440 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017445 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017447 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017693 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017694 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028049 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028050 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028053 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028058 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028143 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028150 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028151 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028256 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028467 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028470 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028476 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028527 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028529 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300032915 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070666_112269541 | 3300005335 | Switchgrass Rhizosphere | MVKLISTENSIMFLDPKFYRHEHMTKIEFHKYSQIFLTMETIYYNQSLLNKH* |
| Ga0070667_1008896771 | 3300005367 | Switchgrass Rhizosphere | NRSNNFDKIKPHMVKLISIDRSIVFLDLKFYSHEYMTKIEFHKYSQIFLSKETIYHN* |
| Ga0105120_10247821 | 3300009992 | Switchgrass Associated | RSNNFEKIKPHMVKLISTKSSVMFLDRKFERHKHMTKIEFHKYSQIFLRKKTIYYN* |
| Ga0134125_113605452 | 3300010371 | Terrestrial Soil | MVKLISTESSIMFLVLKFNRHGYMTKIEFYKNFQNFLSKE |
| Ga0134125_122306901 | 3300010371 | Terrestrial Soil | MVKLISTESSITFLDPKFYRLENMTKIEFHKYSQI |
| Ga0134124_127245592 | 3300010397 | Terrestrial Soil | KIKPHMVKLISTESSITFRDPKFYKHEHITKIEFHNFFQICLSKETIYYN* |
| Ga0157379_108517981 | 3300014968 | Switchgrass Rhizosphere | MGKLISAEGSVMFLDPKFYKHEHITKIENHKYSQIFISKETIYYN* |
| Ga0157379_115281441 | 3300014968 | Switchgrass Rhizosphere | KKINNFDKIKPYMVKLISTESSVMYLDTKFYRHEHMTKIEFNKYSQIFLSKETIYYN* |
| Ga0182099_10333252 | 3300015278 | Switchgrass Phyllosphere | MVKLISTESHIVFLDFKFYRHEHMTKIEFRKYSQIFLSK |
| Ga0182099_10584111 | 3300015278 | Switchgrass Phyllosphere | RSNNFDKFKPHMAKLISTESSVTFLNPKFYIHEHMTKIEFQKYSQIFLSNGTIYYN* |
| Ga0182101_10643691 | 3300015284 | Switchgrass Phyllosphere | NYNFDKIKPHMEKLISRESYITFLDLKFYIHEHLTKIEFHKYSQIFLSKETIYHN* |
| Ga0182103_10276861 | 3300015293 | Switchgrass Phyllosphere | MIKPISIGSYIEFMDPKFYRHEHMTEIEFHKNYQNFLGKETIYHN* |
| Ga0182104_10634011 | 3300015297 | Switchgrass Phyllosphere | STESSIMFLDPKFYRHEHMTKIEFHKYYQIFISKETIYYN* |
| Ga0182104_11187261 | 3300015297 | Switchgrass Phyllosphere | MIKLISTESSVMFLDPKFYRYEHMTKIEYRKYSQI |
| Ga0182180_10557741 | 3300015306 | Switchgrass Phyllosphere | NKSNNFDKAKSHTVKLIVQKISIKFMVLKFYRHGYMTKIEFHKKFQIFISKEAIYHN* |
| Ga0182162_10959701 | 3300015310 | Switchgrass Phyllosphere | RSNNFDKIKPHMVKLISTESSIMFLDPKFYRHEHMNKIEFHKYSQICPSKETIYHN* |
| Ga0182182_10231502 | 3300015311 | Switchgrass Phyllosphere | MVKLISTESSIVFLDLKFYRHEYMTEIEFHKFFQIFLSKETIY |
| Ga0182182_10261351 | 3300015311 | Switchgrass Phyllosphere | PHMIKLISTGSYIVFLDPKFYRHEHMTEIEFHKNYQNFLGKETIYHN* |
| Ga0182168_10278101 | 3300015312 | Switchgrass Phyllosphere | MVKLISTESSIMFLDPKFYRQEHMTKIEFHKYSHIFL |
| Ga0182164_11279811 | 3300015313 | Switchgrass Phyllosphere | MAKLISTESYITFLDPKFYIHEHMTKIEFNKNSKIFLRKETIY |
| Ga0182120_10117741 | 3300015315 | Switchgrass Phyllosphere | NRSNNFDKIKPHMVKLISIESSIVFMNPKFYRHEYMTKIEFNKYSNIFLSKENIYYN* |
| Ga0182120_11130381 | 3300015315 | Switchgrass Phyllosphere | MLMNKLPYRSNNFGTIKPHRVKLISTESSIVFLVLKFYRHEYITNIEFHIFSQIFLSKET |
| Ga0182121_10468921 | 3300015316 | Switchgrass Phyllosphere | MVKLISTESYITFLVLNFYRHEYMTKIELHKNSQNFLRKETIYRN |
| Ga0182121_10858061 | 3300015316 | Switchgrass Phyllosphere | GKIKPHMVKLISIDSSIVFMDLKLYKLEYMTKIEFQKYYHIFLNKEAIYYN* |
| Ga0182121_11245111 | 3300015316 | Switchgrass Phyllosphere | VKLFSTESSIVFLDPKFYRHEHMTKVEFHNYSKIFIRK* |
| Ga0182121_11387231 | 3300015316 | Switchgrass Phyllosphere | MVKLISTESSITFMDPKFYRHEHMTKIECVKFSQIFLSKETIYHNEILLNKH* |
| Ga0182136_11412311 | 3300015317 | Switchgrass Phyllosphere | PHMAKLIRTERSIMFLDPKFSRIEHMTKIEFHKYFQIFLSKETIYHN* |
| Ga0182181_10939091 | 3300015318 | Switchgrass Phyllosphere | RSNNFNKIKPHMVKLISTEISIMFLDPKFYRHEYMNKIQFHKYSQIFLNKKTIYYN* |
| Ga0182130_10377361 | 3300015319 | Switchgrass Phyllosphere | MEKLIITESFIVFLDLKFYRHEYMTKVEFHKFSQIFLS |
| Ga0182130_10918131 | 3300015319 | Switchgrass Phyllosphere | MVKLISTESSITFLDLKFYRHEHMTKLESQKYFHIFLSKKTIYY |
| Ga0182165_10590311 | 3300015320 | Switchgrass Phyllosphere | HGSYIYEHPINFSEFIYSQNRSNNFDKTKPYMIKLISTRSSIIFLVLKFYRHGYMTKIEFHKKFQIFISKEAIYHN* |
| Ga0182165_10763722 | 3300015320 | Switchgrass Phyllosphere | MVKLISTESSIMFLDPKFYIREHMIKIEFHKYFQMFLIKETIYYN* |
| Ga0182165_11260711 | 3300015320 | Switchgrass Phyllosphere | KIKPHMVKLISTESSIMFLDPTFYRHEHMTKIELHKYSQIFLRKETIYYN* |
| Ga0182165_11329751 | 3300015320 | Switchgrass Phyllosphere | MVKLISTESSITFLDTKFYKHEHMIKIEFHKYSQIFLSK |
| Ga0182148_11245091 | 3300015325 | Switchgrass Phyllosphere | MVKLISTESSIMFLVLNFHRHEYVTKIEFHKFSRIF |
| Ga0182153_10306002 | 3300015328 | Switchgrass Phyllosphere | MEKLISIESSITFIDTKFYRHEHITKIEFNKYSQIFVSK* |
| Ga0182153_10489731 | 3300015328 | Switchgrass Phyllosphere | IKLVSIGSYIVFLDPKFYRQEDMTRIEFYKNSQNFISKETIYHN* |
| Ga0182131_10823621 | 3300015331 | Switchgrass Phyllosphere | KIKPHIVKLISTESSTMFLDPKFYKHEHMTKIEFHEYSQIFLSKETIYYN* |
| Ga0182131_11432011 | 3300015331 | Switchgrass Phyllosphere | MAKLISTESYITFLDPKFYIHEHMTKIEFHKNSKIFLRKET |
| Ga0182131_11443761 | 3300015331 | Switchgrass Phyllosphere | NNFGKIKPHMVKLISTESSIMFIVLKFY*NGYMTKIEFYKNSQNFLVKETIYHN* |
| Ga0182117_10304321 | 3300015332 | Switchgrass Phyllosphere | MIKLINTGIYIVFMDPKFYRHEHMTEIEFHKNYQNFLNKETIYHN* |
| Ga0182147_10640291 | 3300015333 | Switchgrass Phyllosphere | MIKLINTGIYIVFMDPKFYRHEHMTEIEFHKNYQNFLGKETIYHN* |
| Ga0182147_11284061 | 3300015333 | Switchgrass Phyllosphere | MVKLISTESYITFLDPKFIRHEHMTKIKFHKYSQIF |
| Ga0182147_11312181 | 3300015333 | Switchgrass Phyllosphere | NRSNNFDKIKPHMAKLISTESSITFLDSKFYIHKHMTKIEFHKYSQMFLSKETIYYN* |
| Ga0182147_11486881 | 3300015333 | Switchgrass Phyllosphere | MVKLISTENFVMFLDPKFYRHEHMTKIEFHKYSYIFLTKETIYYNQSLLNKY* |
| Ga0182147_11514101 | 3300015333 | Switchgrass Phyllosphere | SHMEKLISTESSITFLDPKFYKHEHMTKIEFHKYSQIFLIKETIYQN* |
| Ga0182132_11212921 | 3300015334 | Switchgrass Phyllosphere | MVKLISTESFITFLDPKFCRHEHMTKIEFHKYSQIFLSKETIY |
| Ga0182116_10711421 | 3300015335 | Switchgrass Phyllosphere | MEKLISIESSITFLDTKFYRHEHIPKIEFNKYSQIF |
| Ga0182116_11201521 | 3300015335 | Switchgrass Phyllosphere | MVKQISTESSIVFLDLQFYRHEYMTTIEFRKFYQIFLSKETIYH |
| Ga0182150_11297222 | 3300015336 | Switchgrass Phyllosphere | MIKLISTENDIVFLDLKFYKPEYMTRIEFHKNYQNFISKETIYHN* |
| Ga0182151_10840471 | 3300015337 | Switchgrass Phyllosphere | AINFSEFIYESNRSNNFDKIKPHMVKLISTESYIIFLDPKFFRHEHMTYIEFHKYSQIFLSKETIYHN* |
| Ga0182137_11411061 | 3300015338 | Switchgrass Phyllosphere | MAKLISTKSSIMFLDSRFYIHEHIIEIEFHKNSQNFLRKETIYH |
| Ga0182149_10282031 | 3300015339 | Switchgrass Phyllosphere | STGSAIVFPVLKVYRNEYMTKIEFYKNSRNFISKETIYHN* |
| Ga0182149_11214831 | 3300015339 | Switchgrass Phyllosphere | MKPHMAKLISTESSILFLEHKFYKHEHMTKIELHKNYHIFLSKETIYHN* |
| Ga0182149_11715571 | 3300015339 | Switchgrass Phyllosphere | NRSNNFDKIKPHMEKLISIESSVMFLDPKFYRHEYMAKIEFHKYSQIFLSQETIYYN* |
| Ga0182133_10929981 | 3300015340 | Switchgrass Phyllosphere | KLISTESFIQFHDPKFYRHEHMTKIEFHKFSQIFLSKQTIYHN* |
| Ga0182133_11509801 | 3300015340 | Switchgrass Phyllosphere | MVKLINTDSYIVFLDPKFYRHEHMTKIEFEQKSQNFLNKETFYHN* |
| Ga0182115_11298721 | 3300015348 | Switchgrass Phyllosphere | MWAQNRSNNFDKIKPHMIRLISTGGSIVFLDPKFYRHEYRTKVELHKNYQNFLSKETIYHN* |
| Ga0182115_11624641 | 3300015348 | Switchgrass Phyllosphere | *NNNFNNIKPHMIKLISTGSYIVFLDPKFYRHEHTTKIEFYKNSQNFLSKETIYHN* |
| Ga0182115_11892871 | 3300015348 | Switchgrass Phyllosphere | NNFDKIKPHMIILISTESSITFLDAKFYRHEHMTKIEFHKYAQIFLRKETIYYN* |
| Ga0182115_12282621 | 3300015348 | Switchgrass Phyllosphere | MVKPISTGIYIVFMDPKFRRHEHMTEIEFHKNSQIFLSKETIYEN* |
| Ga0182185_11233691 | 3300015349 | Switchgrass Phyllosphere | MEKLISTESSIMFLDPKFYRHEHMTKIEFPKYFQIFLSKETIYYN* |
| Ga0182163_11112352 | 3300015350 | Switchgrass Phyllosphere | MVKLISTESSIMFLDPQFYRLQQMTKIEFHKYSQIFLSKETIYY |
| Ga0182163_11674541 | 3300015350 | Switchgrass Phyllosphere | MVKLISTESSLMFLDPKFYRHEYMTKIEFHKYSQIFLSKETIYYN |
| Ga0182163_11924341 | 3300015350 | Switchgrass Phyllosphere | MVKLISTESSITFLDPKLYRHEYTTKIEFHKFSQIFLSKETIY |
| Ga0182163_11982761 | 3300015350 | Switchgrass Phyllosphere | MEKLISTESYIIFLDPKFYRNEHMTKLEFHKYSQIFLSK |
| Ga0182163_12423371 | 3300015350 | Switchgrass Phyllosphere | KIKPHMIKLISTGSYIVFLDPKFYIQEHMTKIQFYKNSQNFLSKETIYHNQGLLNKH* |
| Ga0182169_11358121 | 3300015352 | Switchgrass Phyllosphere | NFDKSKPHMKKLISTGSSMVFLGSKFYIHEHMTKAEFYKNSKIFLSKETI* |
| Ga0182169_11913841 | 3300015352 | Switchgrass Phyllosphere | AQNRSNNFDKIKPHMVKLISIDRSIVFLDLKFYSHEYMTKIEFRKYSQIFLSKETIYHN* |
| Ga0182179_10126924 | 3300015353 | Switchgrass Phyllosphere | MVKLISTECSIMFLDPKFYRHEHMTKIGFHKYSQIFLSKETIYYNEILLSKH* |
| Ga0182179_11003271 | 3300015353 | Switchgrass Phyllosphere | NIVKQISKESYITFRDNKFYKHEHITKIEFHNFFQICLSKETIYYN* |
| Ga0182167_12496171 | 3300015354 | Switchgrass Phyllosphere | NRSNNFDKIKTHTVKLISTKGSIMFLDPKYYRHEHMTKIEFQKYSQIFLSKETIYHN* |
| Ga0182167_12541331 | 3300015354 | Switchgrass Phyllosphere | MAKLISIESSITFLDPKFYRREHMTKIEFQKYSQIFISKETIYRN* |
| Ga0182197_11345471 | 3300017408 | Switchgrass Phyllosphere | RSNNFDKIKPHMVKLISTESSIMFLDPKFYRHEHMTKIEFHKYSQSFLSKETIYHN |
| Ga0182195_11757031 | 3300017414 | Switchgrass Phyllosphere | NFDKIKPHMAKLISTESSITFMDPKFYKHEYLTKIEFHKYSQIFLSKETIYHN |
| Ga0182201_11411341 | 3300017422 | Switchgrass Phyllosphere | PHMIKLISTENDIVFLDLKFYKPEYMTRIEFHKNYQNFISKETIYHN |
| Ga0182196_10768671 | 3300017432 | Switchgrass Phyllosphere | MVKLISTESSITFLDTKFYKHEHMIKIEFHKYSQIF |
| Ga0182194_11369761 | 3300017435 | Switchgrass Phyllosphere | SNNFDKIKPHMVKLISTESCITIMDPKFYRHETMTKIEFHKYSQIF |
| Ga0182200_11183851 | 3300017439 | Switchgrass Phyllosphere | HMIKLISTGSYIVFLDPKFYRHEHMTEIEFHKNYQIFLSKETIYKN |
| Ga0182214_10440412 | 3300017440 | Switchgrass Phyllosphere | MIKLISTGSYIVFMDPKFYRHEHMTEIEFHKNYQNFLGKETIYHN |
| Ga0182198_11583571 | 3300017445 | Switchgrass Phyllosphere | MVKLISIESSIMFRDPKFYKHEHVTKIEFHKFSHIFLSKETI |
| Ga0182215_10780991 | 3300017447 | Switchgrass Phyllosphere | MVKLISQESSVEFLDPKFFRHEHITKIEFQKYYRIF |
| Ga0182216_11074661 | 3300017693 | Switchgrass Phyllosphere | RSNNFDKIKPHMVKLISTESSIVFLDIKFNRHEYMTKIEFHKYSQIFRSKETIYHN |
| Ga0182216_12013851 | 3300017693 | Switchgrass Phyllosphere | MVKLISIESSIVFLDLKFYRHEYMTKIEFHKFSQIFRSKETIY |
| Ga0182211_10631682 | 3300017694 | Switchgrass Phyllosphere | MKPHMVKLISTESSIVFLDPKFFRHEHMTKIEFHKYSQIFLNKE |
| Ga0182211_11562121 | 3300017694 | Switchgrass Phyllosphere | MWAQNRSNNFDKIKPHVVKLISTESYITFLVLNFYRHEYMTKIELHKNSQNF |
| Ga0207684_110909991 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | KIKPHMVKLISTESSIMFLDPKFYRHEHMTKIEFHKYYQIFISKETIYYN |
| Ga0268322_10426591 | 3300028049 | Phyllosphere | MEKLISTESSIMFLDPKFYRHEHMTKIEFPKYFQIFLSKETIYYN |
| Ga0268328_10146261 | 3300028050 | Phyllosphere | MWAQNRSNNFDKIKPHMIRLISTGGSIVFLDPKFYRHEYRTKVELHKNYQNFLSKETIYH |
| Ga0268346_10349672 | 3300028053 | Phyllosphere | KRSNNFDKIKPHMAKLISTESYITFLVPKFYKHEHMTKIEFHKYFQIFLSKETIYHN |
| Ga0268332_10320591 | 3300028058 | Phyllosphere | MKPHMAKLISTESSILFLEHKFYKHEHMTKIELHKNYHIFLSKETIYHN |
| Ga0268332_10513971 | 3300028058 | Phyllosphere | HKTEVIILTKIKPHMVKLIRKESSIMFLDPKFYKHENMTKIEFHKYSQIFLSKETIYYN |
| Ga0268332_10764651 | 3300028058 | Phyllosphere | FGAINGGKIKTHMVKIISIENSIMFLDPKFYRHEYTTKVELHKNSQNFLNKETIYHN |
| Ga0268348_10108001 | 3300028143 | Phyllosphere | MEKLISTESFIKFLVPIFYRHEHMSKIEFYKNSQIFLIKETI |
| Ga0268343_10065381 | 3300028150 | Phyllosphere | MVKLISTESSIIFLDPKFYKHENMTKVEFHKYFHICLSKETIYY |
| Ga0268308_10156861 | 3300028151 | Phyllosphere | MEKLISTESSIKFLDPKFYRHENMTEIEFHKNYQNFLSKDTIYHN |
| Ga0268304_10161901 | 3300028256 | Phyllosphere | HSYCKIFRIYLGLNRSNNFDKIKPHMVKLISTESYIMFLDPKFYRHEYMTKIEFHKYSQIFLRKETIYYN |
| Ga0268333_10130841 | 3300028467 | Phyllosphere | SNNFDKIKPPMVKLISTESSIIFLDPKFYKHENMTKVEFHKYFHICLSKETIYYN |
| Ga0268307_10035672 | 3300028470 | Phyllosphere | EARTFTEDQNKANLATVNFSEFMWAQNRSNNFDKIKPHMIRLISTGGSIVFLDPKFYRHEYRTKVELHKNYQNFLSKETIYHN |
| Ga0268307_10113541 | 3300028470 | Phyllosphere | MEKLISTESYIIFLDPKFYRHEHMTKLEFHKYSQIFLSKETIYH |
| Ga0268329_10171792 | 3300028476 | Phyllosphere | NFEKIKPHMVKLVSTESSVMFLDPKFYRHEHMTKIEFHKYSHIFLIKKTIYYN |
| Ga0268335_10064321 | 3300028527 | Phyllosphere | MVKLISTESSIMFLDPKFYRHEHITKIEFHKFSHICLSKE |
| Ga0268311_10033131 | 3300028529 | Phyllosphere | MVKLISTESSITFLDPKLYRHEHMTKLEFLKFSQIFLSKETIYHN |
| Ga0314749_11026721 | 3300032915 | Switchgrass Phyllosphere | GSNNFDKIKPHMIKLISTKSYLVFLDPKFYRHENMTKLEFYKNSQNFLSKETIYHN |
| ⦗Top⦘ |