| Basic Information | |
|---|---|
| Family ID | F096390 |
| Family Type | Metagenome |
| Number of Sequences | 104 |
| Average Sequence Length | 56 residues |
| Representative Sequence | MADIIKEIINLFVYPITHEVEAHGKLLSDEEKQDLLEREKRRYERELIKIFEKHDRL |
| Number of Associated Samples | 26 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 92.31 % |
| % of genes near scaffold ends (potentially truncated) | 22.12 % |
| % of genes from short scaffolds (< 2000 bps) | 73.08 % |
| Associated GOLD sequencing projects | 24 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (55.769 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Hydrothermal Vent Sediment (33.654 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.692 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (78.846 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 82.46% β-sheet: 0.00% Coil/Unstructured: 17.54% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF09643 | YopX | 44.23 |
| PF07659 | DUF1599 | 21.15 |
| PF00574 | CLP_protease | 11.54 |
| PF13597 | NRDD | 4.81 |
| PF01865 | PhoU_div | 4.81 |
| PF00705 | PCNA_N | 0.96 |
| PF01555 | N6_N4_Mtase | 0.96 |
| PF00692 | dUTPase | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 23.08 |
| COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 23.08 |
| COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 11.54 |
| COG1392 | Phosphate transport regulator YkaA, distantly related to PhoU, UPF0111/DUF47 family | Inorganic ion transport and metabolism [P] | 4.81 |
| COG0592 | DNA polymerase III sliding clamp (beta) subunit, PCNA homolog | Replication, recombination and repair [L] | 0.96 |
| COG0717 | dCTP deaminase | Nucleotide transport and metabolism [F] | 0.96 |
| COG0756 | dUTP pyrophosphatase (dUTPase) | Defense mechanisms [V] | 0.96 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.96 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.96 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.38 % |
| Unclassified | root | N/A | 34.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005265|Ga0073580_110697 | All Organisms → cellular organisms → Bacteria | 8080 | Open in IMG/M |
| 3300005265|Ga0073580_119066 | All Organisms → cellular organisms → Bacteria | 6680 | Open in IMG/M |
| 3300010330|Ga0136651_10007518 | All Organisms → cellular organisms → Bacteria | 5969 | Open in IMG/M |
| 3300010330|Ga0136651_10020353 | All Organisms → cellular organisms → Bacteria | 3638 | Open in IMG/M |
| 3300010330|Ga0136651_10046476 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division Kazan-3B-28 → candidate division Kazan bacterium | 2347 | Open in IMG/M |
| 3300010330|Ga0136651_10057196 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division Kazan-3B-28 → candidate division Kazan bacterium | 2093 | Open in IMG/M |
| 3300010330|Ga0136651_10062747 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division Kazan-3B-28 → candidate division Kazan bacterium | 1988 | Open in IMG/M |
| 3300010330|Ga0136651_10083437 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1696 | Open in IMG/M |
| 3300010330|Ga0136651_10103691 | Not Available | 1497 | Open in IMG/M |
| 3300010330|Ga0136651_10110800 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division Kazan-3B-28 → candidate division Kazan bacterium | 1440 | Open in IMG/M |
| 3300010330|Ga0136651_10216190 | Not Available | 971 | Open in IMG/M |
| 3300010330|Ga0136651_10240845 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division Kazan-3B-28 → candidate division Kazan bacterium | 911 | Open in IMG/M |
| 3300010330|Ga0136651_10284275 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division Kazan-3B-28 → candidate division Kazan bacterium | 826 | Open in IMG/M |
| 3300010330|Ga0136651_10321211 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division Kazan-3B-28 → candidate division Kazan bacterium | 768 | Open in IMG/M |
| 3300010330|Ga0136651_10322324 | Not Available | 766 | Open in IMG/M |
| 3300010330|Ga0136651_10370919 | Not Available | 705 | Open in IMG/M |
| 3300010330|Ga0136651_10546046 | Not Available | 562 | Open in IMG/M |
| 3300010332|Ga0116200_10088741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1599 | Open in IMG/M |
| 3300013099|Ga0164315_11287719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 576 | Open in IMG/M |
| 3300013103|Ga0164318_10290851 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division Kazan-3B-28 → candidate division Kazan bacterium | 1451 | Open in IMG/M |
| 3300013103|Ga0164318_10443903 | All Organisms → Viruses → Predicted Viral | 1127 | Open in IMG/M |
| 3300013103|Ga0164318_10604517 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 935 | Open in IMG/M |
| 3300013103|Ga0164318_10905480 | Not Available | 731 | Open in IMG/M |
| 3300013103|Ga0164318_11140149 | Not Available | 636 | Open in IMG/M |
| 3300014886|Ga0180300_10085391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1268 | Open in IMG/M |
| 3300014911|Ga0180301_10248880 | Not Available | 970 | Open in IMG/M |
| 3300014911|Ga0180301_10605952 | Not Available | 525 | Open in IMG/M |
| 3300014913|Ga0164310_10044956 | All Organisms → cellular organisms → Bacteria | 2739 | Open in IMG/M |
| 3300014913|Ga0164310_10085642 | All Organisms → cellular organisms → Bacteria | 1955 | Open in IMG/M |
| 3300014913|Ga0164310_10160548 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division Kazan-3B-28 → candidate division Kazan bacterium | 1383 | Open in IMG/M |
| 3300014913|Ga0164310_10345934 | Not Available | 881 | Open in IMG/M |
| 3300014913|Ga0164310_10596162 | Not Available | 638 | Open in IMG/M |
| 3300014913|Ga0164310_10692171 | Not Available | 585 | Open in IMG/M |
| 3300014913|Ga0164310_10762961 | Not Available | 551 | Open in IMG/M |
| 3300014913|Ga0164310_10836105 | Not Available | 520 | Open in IMG/M |
| 3300014914|Ga0164311_10180672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1254 | Open in IMG/M |
| 3300014914|Ga0164311_10269305 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division Kazan-3B-28 → candidate division Kazan bacterium | 1000 | Open in IMG/M |
| 3300014914|Ga0164311_10430973 | Not Available | 763 | Open in IMG/M |
| 3300021467|Ga0190334_1000912 | All Organisms → cellular organisms → Bacteria | 13387 | Open in IMG/M |
| 3300021467|Ga0190334_1002004 | All Organisms → cellular organisms → Bacteria | 8460 | Open in IMG/M |
| 3300021467|Ga0190334_1003356 | All Organisms → cellular organisms → Bacteria | 6168 | Open in IMG/M |
| 3300021467|Ga0190334_1004424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 5276 | Open in IMG/M |
| 3300021467|Ga0190334_1006767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 4141 | Open in IMG/M |
| 3300021467|Ga0190334_1011853 | All Organisms → cellular organisms → Bacteria | 2991 | Open in IMG/M |
| 3300021467|Ga0190334_1026625 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1854 | Open in IMG/M |
| 3300021467|Ga0190334_1073891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 971 | Open in IMG/M |
| 3300021467|Ga0190334_1090680 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division Kazan-3B-28 → candidate division Kazan bacterium | 848 | Open in IMG/M |
| 3300021467|Ga0190334_1102044 | Not Available | 784 | Open in IMG/M |
| 3300021467|Ga0190334_1144702 | Not Available | 620 | Open in IMG/M |
| 3300021468|Ga0190360_1010532 | All Organisms → cellular organisms → Archaea | 3970 | Open in IMG/M |
| 3300021468|Ga0190360_1011904 | All Organisms → cellular organisms → Bacteria | 3711 | Open in IMG/M |
| 3300021468|Ga0190360_1023333 | All Organisms → cellular organisms → Bacteria | 2544 | Open in IMG/M |
| 3300021468|Ga0190360_1035365 | All Organisms → cellular organisms → Bacteria | 1993 | Open in IMG/M |
| 3300021468|Ga0190360_1039788 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division Kazan-3B-28 → candidate division Kazan bacterium | 1853 | Open in IMG/M |
| 3300021468|Ga0190360_1043639 | All Organisms → cellular organisms → Bacteria | 1752 | Open in IMG/M |
| 3300021468|Ga0190360_1043899 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Thermococci → unclassified Thermococci → Thermococci archaeon | 1746 | Open in IMG/M |
| 3300021468|Ga0190360_1048235 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1648 | Open in IMG/M |
| 3300021468|Ga0190360_1053285 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division Kazan-3B-28 → candidate division Kazan bacterium | 1548 | Open in IMG/M |
| 3300021468|Ga0190360_1071949 | Not Available | 1277 | Open in IMG/M |
| 3300021468|Ga0190360_1087222 | Not Available | 1122 | Open in IMG/M |
| 3300021468|Ga0190360_1099308 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division Kazan-3B-28 → candidate division Kazan bacterium | 1027 | Open in IMG/M |
| 3300021468|Ga0190360_1124714 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division Kazan-3B-28 → candidate division Kazan bacterium | 878 | Open in IMG/M |
| 3300021468|Ga0190360_1201918 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division Kazan-3B-28 → candidate division Kazan bacterium | 624 | Open in IMG/M |
| 3300021469|Ga0190361_1005971 | All Organisms → cellular organisms → Bacteria | 4344 | Open in IMG/M |
| 3300021469|Ga0190361_1035413 | All Organisms → cellular organisms → Bacteria | 1653 | Open in IMG/M |
| 3300021469|Ga0190361_1040198 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division Kazan-3B-28 → candidate division Kazan bacterium | 1531 | Open in IMG/M |
| 3300021469|Ga0190361_1065138 | Not Available | 1140 | Open in IMG/M |
| 3300021469|Ga0190361_1085416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 960 | Open in IMG/M |
| 3300021469|Ga0190361_1100651 | Not Available | 864 | Open in IMG/M |
| 3300021469|Ga0190361_1115489 | Not Available | 790 | Open in IMG/M |
| 3300021469|Ga0190361_1123471 | Not Available | 756 | Open in IMG/M |
| 3300021471|Ga0190359_1074618 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division Kazan-3B-28 → candidate division Kazan bacterium | 1277 | Open in IMG/M |
| 3300021483|Ga0190331_1007992 | All Organisms → Viruses → Predicted Viral | 1731 | Open in IMG/M |
| 3300021488|Ga0190305_1001751 | All Organisms → cellular organisms → Bacteria | 4603 | Open in IMG/M |
| 3300021488|Ga0190305_1002370 | All Organisms → cellular organisms → Bacteria | 3911 | Open in IMG/M |
| 3300021488|Ga0190305_1002587 | All Organisms → cellular organisms → Bacteria | 3731 | Open in IMG/M |
| 3300021488|Ga0190305_1007515 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division Kazan-3B-28 → candidate division Kazan bacterium | 2085 | Open in IMG/M |
| 3300021488|Ga0190305_1031794 | Not Available | 840 | Open in IMG/M |
| 3300021488|Ga0190305_1057726 | Not Available | 539 | Open in IMG/M |
| 3300021488|Ga0190305_1058675 | Not Available | 532 | Open in IMG/M |
| 3300021488|Ga0190305_1061470 | Not Available | 514 | Open in IMG/M |
| 3300021491|Ga0190332_1011415 | All Organisms → cellular organisms → Bacteria | 1639 | Open in IMG/M |
| 3300021491|Ga0190332_1018305 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1204 | Open in IMG/M |
| 3300021491|Ga0190332_1019188 | Not Available | 1167 | Open in IMG/M |
| 3300021491|Ga0190332_1056742 | Not Available | 575 | Open in IMG/M |
| 3300021492|Ga0190336_1002184 | All Organisms → cellular organisms → Bacteria | 4023 | Open in IMG/M |
| 3300021492|Ga0190336_1018126 | Not Available | 1228 | Open in IMG/M |
| 3300021493|Ga0190306_1064569 | Not Available | 552 | Open in IMG/M |
| 3300021507|Ga0190316_1058386 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division Kazan-3B-28 → candidate division Kazan bacterium | 941 | Open in IMG/M |
| 3300021509|Ga0190304_1015029 | All Organisms → cellular organisms → Bacteria | 2478 | Open in IMG/M |
| 3300021509|Ga0190304_1017157 | All Organisms → cellular organisms → Bacteria | 2273 | Open in IMG/M |
| 3300021509|Ga0190304_1029459 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division Kazan-3B-28 → candidate division Kazan bacterium | 1576 | Open in IMG/M |
| 3300021509|Ga0190304_1082996 | Not Available | 765 | Open in IMG/M |
| 3300021509|Ga0190304_1109372 | Not Available | 629 | Open in IMG/M |
| 3300021509|Ga0190304_1110717 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 624 | Open in IMG/M |
| 3300021512|Ga0190303_1065946 | Not Available | 999 | Open in IMG/M |
| 3300021587|Ga0190351_1000007 | All Organisms → cellular organisms → Bacteria | 24054 | Open in IMG/M |
| 3300021589|Ga0190355_108519 | Not Available | 737 | Open in IMG/M |
| 3300021589|Ga0190355_110589 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division Kazan-3B-28 → candidate division Kazan bacterium | 668 | Open in IMG/M |
| 3300021590|Ga0190354_1000207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 10269 | Open in IMG/M |
| 3300022552|Ga0212118_10002032 | All Organisms → cellular organisms → Bacteria | 14251 | Open in IMG/M |
| 3300022552|Ga0212118_10080489 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division Kazan-3B-28 → candidate division Kazan bacterium | 1928 | Open in IMG/M |
| 3300025156|Ga0209834_10020801 | Not Available | 2981 | Open in IMG/M |
| 3300025156|Ga0209834_10156834 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division Kazan-3B-28 → candidate division Kazan bacterium | 888 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Hydrothermal Vent Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Hydrothermal Vent Sediment | 33.65% |
| Hydrothermal Vent Microbial Mat | Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Vent Microbial Mat | 25.96% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 19.23% |
| Marine Hydrothermal Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Hydrothermal Vent | 19.23% |
| Sediment | Environmental → Aquatic → Marine → Unclassified → Unclassified → Sediment | 1.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005265 | Hydrothermal sediment microbial communities from Guaymas Basin, California, USA 4484. Combined assembly of Gp0115313 and Gp0146561 | Environmental | Open in IMG/M |
| 3300010330 | Marine hydrothermal vent microbial communities from Guaymas Basin, Gulf of California to study Microbial Dark Matter (Phase II) - Marker 14 Mat core 4569-2 3-6 cm metaG | Environmental | Open in IMG/M |
| 3300010332 | Marine hydrothermal vent microbial communities from Guaymas Basin, Gulf of California to study Microbial Dark Matter (Phase II) - Marker 14 Mat core 4571-4 3-6 cm metaG | Environmental | Open in IMG/M |
| 3300013099 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay6, Core 4569-2, 0-3 cm | Environmental | Open in IMG/M |
| 3300013103 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay9, Core 4571-4, 0-3 cm | Environmental | Open in IMG/M |
| 3300014886 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay15, Core 4569-2, 21-24 cm | Environmental | Open in IMG/M |
| 3300014911 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay16, Core 4569-2, 12-15 cm | Environmental | Open in IMG/M |
| 3300014913 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay1, Core 4569-9, 0-3 cm | Environmental | Open in IMG/M |
| 3300014914 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay2, Core 4569-9, 9-12 cm | Environmental | Open in IMG/M |
| 3300021467 | Hydrothermal vent sediment bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4872-04-7-8_MG | Environmental | Open in IMG/M |
| 3300021468 | Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4872-18-3-4_MG | Environmental | Open in IMG/M |
| 3300021469 | Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4872-18-4-5_MG | Environmental | Open in IMG/M |
| 3300021471 | Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4872-18-2-3_MG | Environmental | Open in IMG/M |
| 3300021483 | Hydrothermal vent sediment bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4872-04-4-5_MG | Environmental | Open in IMG/M |
| 3300021488 | Hydrothermal vent sediment bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4870-07-2-3_MG | Environmental | Open in IMG/M |
| 3300021491 | Hydrothermal vent sediment bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4872-04-5-6_MG | Environmental | Open in IMG/M |
| 3300021492 | Hydrothermal vent sediment bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4872-04-9-10_MG | Environmental | Open in IMG/M |
| 3300021493 | Hydrothermal vent sediment bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4870-07-3-4_MG | Environmental | Open in IMG/M |
| 3300021507 | Hydrothermal vent sediment bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4870-11-1-2_MG | Environmental | Open in IMG/M |
| 3300021509 | Hydrothermal vent sediment bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4870-07-1--2_MG | Environmental | Open in IMG/M |
| 3300021512 | Hydrothermal vent sediment bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4870-07-0-1_MG | Environmental | Open in IMG/M |
| 3300021587 | Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4872-13-9-10_MG | Environmental | Open in IMG/M |
| 3300021589 | Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4872-13-13-14_MG | Environmental | Open in IMG/M |
| 3300021590 | Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4872-13-12-13_MG | Environmental | Open in IMG/M |
| 3300022552 | Guaymas_combined assembly | Environmental | Open in IMG/M |
| 3300025156 | Marine hydrothermal vent microbial communities from Guaymas Basin, Gulf of California to study Microbial Dark Matter (Phase II) - Marker 14 Mat core 4569-2 3-6 cm metaG (SPAdes) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0073580_11069720 | 3300005265 | Sediment | MADIIKEIINLFVYPITHEVEAHGKLLTDEEKEEMLQRAKKRYERELIRIFEKHDRL* |
| Ga0073580_11906612 | 3300005265 | Sediment | MADIIKEIINLFVYPITHEIEAHGKLLSDEEKEDLLKREKKRYERELIKIFEKHDRL* |
| Ga0136651_1000751810 | 3300010330 | Marine Hydrothermal Vent | MTDIIKEIINLFVYPITHEVEAHGKLLTDEEKEEMLQRAKKRYERELIKIFEKHDRL* |
| Ga0136651_100203533 | 3300010330 | Marine Hydrothermal Vent | MADIVKEIINLFVYSITHEVEAHGKMLTDEEKEEMLQRAKKRYEKELIKIFEKHDRL* |
| Ga0136651_100464762 | 3300010330 | Marine Hydrothermal Vent | MADIIKEIINLFVYPITHEVEAHGKLLTDEEKQDLLEREKRRYERELIKIFEKFDRL* |
| Ga0136651_100571963 | 3300010330 | Marine Hydrothermal Vent | MADIIKEIINLFVYPITHEVEAHGKLLTDEEKQELLEREKKRYERELIKIFEKFDQL* |
| Ga0136651_100627472 | 3300010330 | Marine Hydrothermal Vent | MADIIKEIINLFVYPITHEVEAHGKLLTDEEKEEMLQRAKKRYERELIKIFEKHDRL* |
| Ga0136651_100834372 | 3300010330 | Marine Hydrothermal Vent | MGDIVNDIMNLFTYSITHEVEAHGKLLTDEEKEEMLQRAKKRYEKELIKIFEKHDRL* |
| Ga0136651_101036912 | 3300010330 | Marine Hydrothermal Vent | MADIIKEIINLFVYPITHEVEAHGKLLADEEKEEMLQRAKKRYEKELIKIFEKHDRL* |
| Ga0136651_101108002 | 3300010330 | Marine Hydrothermal Vent | MADIIREIINLFVYPITHEVEAHGKLLTDEEKEEMLQQAKKRYERELIKIFEKHDRL* |
| Ga0136651_102161901 | 3300010330 | Marine Hydrothermal Vent | MADIIKEIINLFVYPITHEVEAHGKLLTDEEKEEMLRRAKKRYERELIKIFDKHDRL* |
| Ga0136651_102408452 | 3300010330 | Marine Hydrothermal Vent | MADIIKEIINLFVYPITHEVEAHGKLLSDEEKQDLLEREKRRYERELIKIFEKHDRL* |
| Ga0136651_102842752 | 3300010330 | Marine Hydrothermal Vent | MADIIKEIINLFVYPITHEVEAHGKLLTDEEKQDLLEKAKKRYERELIKIFEKYDRL* |
| Ga0136651_103212112 | 3300010330 | Marine Hydrothermal Vent | MADIIKEIINLFVYPITHEVEAHGKLLTDEEKQDLLEKAKKRYERELIKIFEKHDRL* |
| Ga0136651_103223241 | 3300010330 | Marine Hydrothermal Vent | MADIIKEIINLFVYPITHEVEAHGKLLTDEEKEDLLKKAKKRYERELIKIFEKHDRL* |
| Ga0136651_103709192 | 3300010330 | Marine Hydrothermal Vent | MADIIKEIINLFVYPITHEIETHGKLLTDEEKEDLLKKAKKRYERELIKIFEKHDRL* |
| Ga0136651_105460461 | 3300010330 | Marine Hydrothermal Vent | MADIIKEIINLFVYPITHEIEEHGKLLTDEEKQDLLEREKKRYERELIKIFEK |
| Ga0116200_100887413 | 3300010332 | Marine Hydrothermal Vent | MADIIKEIINLFIYPITHEVEAHGKLLTDEEKQDLLEREKRRYERELIKIFEKFDRL* |
| Ga0164315_112877191 | 3300013099 | Marine Sediment | MADIIKEIINLFVYPITHEIEAHGKLLSDEEKQDLLEKEKKRYERELIRIFEKFDRL* |
| Ga0164318_102908514 | 3300013103 | Marine Sediment | MADIIKEIINLFVYPITHEVEAHGKLLSDEEKQDLLEREKRRYERELIKIFE |
| Ga0164318_104439034 | 3300013103 | Marine Sediment | MADIIKEIINLFVYPITHEVEAHGKLLSDEEKQDLLEREKRRYERELIRIFEKFDRI* |
| Ga0164318_106045171 | 3300013103 | Marine Sediment | NLFVYPITHEIEAHGKLLSDEEKQDLLEREKRRYERELIKIFEKHDRL* |
| Ga0164318_109054801 | 3300013103 | Marine Sediment | MADIIKEIINLFVYPITHEIEAHGKLLSDEEKQDLLEKEKRRYERELIKIFEKHDRL* |
| Ga0164318_111401493 | 3300013103 | Marine Sediment | MADIIKEIINLFVYPITHEVEAHGRLLTDEEKEEMLQRAKKRYERELIKIFEKHDRL* |
| Ga0180300_100853913 | 3300014886 | Marine Sediment | MADIIKEIINLFVYPITHEVEAHGKLLTDEEKEEMLQRAKKRYERELIKIFEKYDRL* |
| Ga0180301_102488803 | 3300014911 | Marine Sediment | MADIIKEIINLFVYPITHEVEAHGKLLTDEEKQDLLEKAKKRYERELIKIFEKCDRL* |
| Ga0180301_106059522 | 3300014911 | Marine Sediment | MGDIIGEIINLFAYPITHEVEAHGKMLSDEEKEDMLQRAKRRYERELIKLFNRLDKI* |
| Ga0164310_100449563 | 3300014913 | Marine Sediment | MADIIKEIINLFVYPITHEIEAHGKLLTDEEKQDLLEREKKRYERELIKIFEKFDRL* |
| Ga0164310_100856421 | 3300014913 | Marine Sediment | MADIIKEIINLFIYPITHEIEAHGKLLTDEEKQDLLEREKRRYERELIKIFEKFDRL* |
| Ga0164310_101605482 | 3300014913 | Marine Sediment | MGDIVKDILNLFVYSITHEVEAHGKLLTDEEKQDLLEKAKKRYERELIKIFEKYDRL* |
| Ga0164310_103459342 | 3300014913 | Marine Sediment | MADIIKEIINLFVYPITHEVEAHGKLLTDEEKQELLEREKKRYERELIKIFEKFDRL* |
| Ga0164310_105961621 | 3300014913 | Marine Sediment | MADIIKEIINLFVYPITHEVEAHGKLLTDEEKQDLLEREKRRYERELVKIFEKFDRL* |
| Ga0164310_106921711 | 3300014913 | Marine Sediment | IINLFVYPITHEIEAHGKLLSDEEKQDLLEKEKRRYERELIKIFEKFDRL* |
| Ga0164310_107629611 | 3300014913 | Marine Sediment | MADIIKEIINLFVYPITHEVEAHGKLLSDEEKQDLLEREKRRYERELIKIFEKYDRL* |
| Ga0164310_108361052 | 3300014913 | Marine Sediment | MKMADIIKEIINLFVYPITHEVEAHGKLLTDEEKQDLLEKAKKRYERELIKIFEKYDRL* |
| Ga0164311_101806722 | 3300014914 | Marine Sediment | MADIIKEIINLFVYPITHEIEAHGKLLSDEEKQDLLEREKKRYERELIKIFEKHDRL* |
| Ga0164311_102693053 | 3300014914 | Marine Sediment | MKMADIIKEIINLFVYPITHEIEAHGKLLSDEEKQDLLEREKKRYERELIKIFEKYDRL* |
| Ga0164311_104309732 | 3300014914 | Marine Sediment | MADIVKEIINLFVYPITHEVEAHGKLLTDEEKQDLLEKAKKRYERELIKIFEKYDRL* |
| Ga0190334_10009126 | 3300021467 | Hydrothermal Vent Sediment | MADIIKEIINLFVYPITHEVEAHGKLLTDEEKEEMLQRAKKRYERELIKIFEKHDRL |
| Ga0190334_10020048 | 3300021467 | Hydrothermal Vent Sediment | MADIIKEIINLFVYPITHEIEAHGKLLSDEEKQDLLEKEKKRYERELIKIFEKYDRL |
| Ga0190334_10033567 | 3300021467 | Hydrothermal Vent Sediment | MADIIKEIINLFIYPITHEVEAHGKLLTDEEKQDLLEREKRRYERELIKIFEKFDRL |
| Ga0190334_10044242 | 3300021467 | Hydrothermal Vent Sediment | MGDIVKDILNLFVYPITHEVEAHGKLLTDEEKQDLLEKAKKRYERELIKIFEKYDRL |
| Ga0190334_10067679 | 3300021467 | Hydrothermal Vent Sediment | MADIIKEIINLFVYPITHEVEAHGKLLTDEEKEDLLKKAKKRYERELIKIFEKHDRL |
| Ga0190334_10118534 | 3300021467 | Hydrothermal Vent Sediment | MVDIIKEIINLFVYPITHEIEAHGKLLSDEEKQDLLEKEKKRYERELIRIFEKYDRL |
| Ga0190334_10266251 | 3300021467 | Hydrothermal Vent Sediment | MADIIKEIINLFVYSITHEVEAHGKLLTDEEKQDLLEKAKKRYERELIKIFEKHDRL |
| Ga0190334_10738913 | 3300021467 | Hydrothermal Vent Sediment | MADIIKEIINLFVYPITHEVEAHGKLLSDEEKQDLLEREKRRYERELIKIFEKH |
| Ga0190334_10906802 | 3300021467 | Hydrothermal Vent Sediment | MADIIKEIINLFIYPITHEVEAHGKLLTDEEKQDLLEREKRRYERELIKIFEKFDRLXVKRILII |
| Ga0190334_11020441 | 3300021467 | Hydrothermal Vent Sediment | KEIINLFVYPITHEVEAHGKLLADEEKEEMLQRAKKRYEKELIKIFEKHDRL |
| Ga0190334_11447023 | 3300021467 | Hydrothermal Vent Sediment | MADIIKEIINLFVYPITHEIEAHGKLLSDEEKEDLLKREKKRYERELIKIFEKHDRL |
| Ga0190360_10105325 | 3300021468 | Hydrothermal Vent Microbial Mat | MADIIKEIINLFIYPITHEIEAHGKLLTDEEKQDLLEREKRRYERELIKIFEKYDRL |
| Ga0190360_10119043 | 3300021468 | Hydrothermal Vent Microbial Mat | MADIIKEIINLFVYPITHEVEAHGRLLTDEEKEEMLQRAKKRYERELIKIFEKHDRL |
| Ga0190360_10233335 | 3300021468 | Hydrothermal Vent Microbial Mat | MADIIKEIINLFVYPITHEVEAHGKLLTDEEKQDLLEREKRRYERELIKIFEKFDRL |
| Ga0190360_10353652 | 3300021468 | Hydrothermal Vent Microbial Mat | MADIIKEIINLFVYPITHEIETHGKLLTDEEKEDLLKKAKKRYERELIKIFEKHDRL |
| Ga0190360_10397882 | 3300021468 | Hydrothermal Vent Microbial Mat | MADIIKEIINLFVYPITHEIEAHGKLLSDEEKQDLLEREKRRYERELIKIFEKHDRL |
| Ga0190360_10436394 | 3300021468 | Hydrothermal Vent Microbial Mat | MADIIKEIINLFIYPITHEIEAHGKLLSDEEKQDLLEKEKKRYERELI |
| Ga0190360_10438994 | 3300021468 | Hydrothermal Vent Microbial Mat | MADIIKEIINLFVYPITHEIEAHGKLLTDEEKQDLLEKEKRRYERELIKIFEKHDRL |
| Ga0190360_10482355 | 3300021468 | Hydrothermal Vent Microbial Mat | MADIIKEIINLFVYPITHEVEAHGKLLSDEEKQDLLEREKRRYERELIKIFEKYDRL |
| Ga0190360_10532852 | 3300021468 | Hydrothermal Vent Microbial Mat | MADIIKEIINLFVYPITHEVEAHGKLLTDEEKQDLLEKAKKRYERELIKIFEKYDRL |
| Ga0190360_10719494 | 3300021468 | Hydrothermal Vent Microbial Mat | MADIIKEIINLFVYPITHEVEAHGKLLADEEKEEMLQRAKKRYEKELIKIFEKHDRL |
| Ga0190360_10872224 | 3300021468 | Hydrothermal Vent Microbial Mat | MADIIKEIINLFVYPITHEIEAHGKLLSDEEKQDLLEKEKRRYERELIKIFEKHDRLXVKRILITI |
| Ga0190360_10993081 | 3300021468 | Hydrothermal Vent Microbial Mat | MADIIKEIINLFIYPITHEVEAHGKLLTDEEKQDLLEREKRRYERELIKIFEKFDRLXVKKILIII |
| Ga0190360_11247142 | 3300021468 | Hydrothermal Vent Microbial Mat | MADIIKEIINLFVYPITHEVEAHGKLLTDEEKRELLEREKKRYERELIKIFEKFDRL |
| Ga0190360_12019181 | 3300021468 | Hydrothermal Vent Microbial Mat | MADIIKEIINLFVYPITHEIEAHGKLLSDEEKQDLLEREKRRYERELIKIF |
| Ga0190361_10059716 | 3300021469 | Hydrothermal Vent Microbial Mat | MGDFVNDIMNLFTYSITHEVEAHGKLLTDEEKEEMLQRAKKRYEKELIKIFEKHDRL |
| Ga0190361_10354131 | 3300021469 | Hydrothermal Vent Microbial Mat | MADIIKEIINLFIYPITHEIEAHGKLLSDEEKQDLLEKEKKRYERELIRIFEKY |
| Ga0190361_10401981 | 3300021469 | Hydrothermal Vent Microbial Mat | MVDIIKEIINLFVYPITHEIEAHGKLLSDEEKQDLLEKEKKRYERELIRIFEKY |
| Ga0190361_10651383 | 3300021469 | Hydrothermal Vent Microbial Mat | MADIIKEIINLFVYPITHEVEAHGKLLTDEEKQELLEREKKRYERELIKIFEKFDRL |
| Ga0190361_10854162 | 3300021469 | Hydrothermal Vent Microbial Mat | MADIIKEIINLFIYPITHEIEAHGKLLTDEEKQDLLEREKRRYERELIKIFEKFDRL |
| Ga0190361_11006512 | 3300021469 | Hydrothermal Vent Microbial Mat | MADIIKEIINLFVYPITHEVEAHGKLLTDEEKQDLLEKAKKRYERELIKIFEKCDRL |
| Ga0190361_11154891 | 3300021469 | Hydrothermal Vent Microbial Mat | RMADIIKEIINLFVYPITHEVEAHGKLLTDEEKEEILQRAKKRYERELIRIFEKHDRL |
| Ga0190361_11234713 | 3300021469 | Hydrothermal Vent Microbial Mat | MADIIKEIINLFVYPITHEVEAHGRLLTDEEKEEMLQRAKKRYERELIKIFEKHNRL |
| Ga0190359_10746182 | 3300021471 | Hydrothermal Vent Microbial Mat | MADIIKEIINLFVYPITHEVEAHGKLLTDEEKQELLEREKKRYERELIKIFEKFDQL |
| Ga0190331_10079925 | 3300021483 | Hydrothermal Vent Sediment | MAGIIKEIINLFVYPITHEIETHGKLLTDEEKYELLEREKKRYERELIKIFEKHDRL |
| Ga0190305_10017515 | 3300021488 | Hydrothermal Vent Sediment | MADIIKEIINLFVYPITHEVEAHGKLLSDEEKQDLLEREKRRYERELIRIFEKFDRI |
| Ga0190305_10023708 | 3300021488 | Hydrothermal Vent Sediment | MADIIKEIINLFVYPITHEIEAHGKLLSDEEKQDLLEREKKRYERELIKIFEKYDRL |
| Ga0190305_10025873 | 3300021488 | Hydrothermal Vent Sediment | MADIIKEIINLFVYPITHEIEAHGKLLSDEEKQDLLEREKRRYERELIKIFEKQDRL |
| Ga0190305_10075152 | 3300021488 | Hydrothermal Vent Sediment | MVDIIKEIINLFVYPITHEVEAHGKLLSDEEKQDLLEREKRRYERELIKIFEKYDRL |
| Ga0190305_10317942 | 3300021488 | Hydrothermal Vent Sediment | MADIIKEIINLFVYPITHEVEAHGKLLSDEEKQDLLEKEKRRYERELIKIFERHDRL |
| Ga0190305_10577261 | 3300021488 | Hydrothermal Vent Sediment | MADIIKEIINLFIYPITHEVEAHGKLLTDEEKQDLLEREKRRYEKELIKIFEKFDRL |
| Ga0190305_10586752 | 3300021488 | Hydrothermal Vent Sediment | MADIIKEIINLFVYPITHEIEAHGKLLSDEEKQDLLEKEKRRYERELIKIFEKHDRL |
| Ga0190305_10614702 | 3300021488 | Hydrothermal Vent Sediment | MADIIKEIINLFIYPITHEVEAHGKLLTDEEKQDLLEREKRRYERELIKIFEKFDRLXV |
| Ga0190332_10114154 | 3300021491 | Hydrothermal Vent Sediment | MADIVKEIINLFVYSMTHEVEAHGKMLTDEEKEEMLQRAKKRYEKELIRIFEKHDRL |
| Ga0190332_10183054 | 3300021491 | Hydrothermal Vent Sediment | MADIIKEIINLFVYPITHEVEAHGKLLTDEEKQDLLEKAKKRYERELIKIFEKHDRL |
| Ga0190332_10191883 | 3300021491 | Hydrothermal Vent Sediment | MADIIKEIINLFIYPITHEIEAHGKLLSDEEKQDLLEKEKKRYERELIRIFEKYDRL |
| Ga0190332_10567421 | 3300021491 | Hydrothermal Vent Sediment | IKEIINLFIYPITHEVEAHGKLLTDEEKQDLLEREKRRYERELIKIFEKFDRL |
| Ga0190336_10021844 | 3300021492 | Hydrothermal Vent Sediment | MGDIIKEIINLFVYSITHEVEAHGKMLSDEEKEDMLQRAKRRYERELVKLFNKLDKL |
| Ga0190336_10181262 | 3300021492 | Hydrothermal Vent Sediment | MKDIIGEIINLFAYSIAHEVEAHGKMLSDEEKEDMLQRAKRRYERELVKLFNKLDKL |
| Ga0190306_10645691 | 3300021493 | Hydrothermal Vent Sediment | MADIIKEIINLFVYPITHEIEAHGKLLSDEEKQDLLEKEKRRYERELIKIFEKHDRLXVKRILIT |
| Ga0190316_10583861 | 3300021507 | Hydrothermal Vent Sediment | MADIIKEIINLFIYPITHEVEAHGKLLTDEEKQDLLKREKRRYERELIKIFEKFDR |
| Ga0190304_10150291 | 3300021509 | Hydrothermal Vent Sediment | MADIIKEIINLFVYPITHEIEAHGKLLSDEEKQDLLEKEKRRYERELIKIFE |
| Ga0190304_10171575 | 3300021509 | Hydrothermal Vent Sediment | MADIIKEIINLFVYPITHEVEAHGKLLSDEEKQDLLEREKRRYERELIKIFEKFDRL |
| Ga0190304_10294594 | 3300021509 | Hydrothermal Vent Sediment | MADIIKEIINLFIYPITHEVEAHGKLLTDEEKQDLLEREKRRYERELIKIFEKHDRL |
| Ga0190304_10829963 | 3300021509 | Hydrothermal Vent Sediment | IKEIINLFVYPITHEIEAHGKLLSDEEKQDLLEKEKRRYERELIKIFERHDRL |
| Ga0190304_11093722 | 3300021509 | Hydrothermal Vent Sediment | MADIIKEIINLFVYPITHEIEAHGKLLSDEEKQDLLEKEKKRYERELIKIFEKHDRL |
| Ga0190304_11107173 | 3300021509 | Hydrothermal Vent Sediment | NLFVYPITHEVEAHGKLLSDEEKQDLLEREKRRYERELIKIFEKHDRL |
| Ga0190303_10659462 | 3300021512 | Hydrothermal Vent Sediment | MGDIVKDILNLFVYSITHEVEAHGKLLTDEEKQDLLEKAKKRYERELIKIFEKYDRL |
| Ga0190351_100000727 | 3300021587 | Hydrothermal Vent Microbial Mat | MADIIKEIINLFVYPITHEIEAHGKLLTDEEKEDLLKREKKRYERELIKIFEKYDRL |
| Ga0190355_1085192 | 3300021589 | Hydrothermal Vent Microbial Mat | MADIIKEIINLFVYPITHEVEAHGKLLTDEEKEEMLQRAKKRYERELIRIFEKHDRL |
| Ga0190355_1105891 | 3300021589 | Hydrothermal Vent Microbial Mat | MADIIKEIINLFVYPITHEIEAHGKLLSDEEKQDLLEKEKKRYERELIRIFEKYDRL |
| Ga0190354_10002077 | 3300021590 | Hydrothermal Vent Microbial Mat | MADIIKEIINLFVYPITHEIEAHGKLLTDEEKQDLLEKEKKRYERELIRIFEKFDRL |
| Ga0212118_1000203218 | 3300022552 | Marine Hydrothermal Vent | MADIVKEIINLFVYSITHEVEAHGKMLTDEEKEEMLQRAKKRYEKELIKIFEKHDRL |
| Ga0212118_100804895 | 3300022552 | Marine Hydrothermal Vent | MADIIREIINLFVYPITHEVEAHGKLLTDEEKEEMLQQAKKRYERELIKIFEKHDRL |
| Ga0209834_100208015 | 3300025156 | Marine Hydrothermal Vent | MTDIIKEIINLFVYPITHEVEAHGKLLTDEEKEEMLQRAKKRYERELIKIFEKHDRL |
| Ga0209834_101568342 | 3300025156 | Marine Hydrothermal Vent | MADIIKEIINLFVYPITHEVEAHGKLLSDEEKQDLLEREKRRYERELIKIFEKHDRL |
| ⦗Top⦘ |