Basic Information | |
---|---|
Family ID | F096380 |
Family Type | Metagenome |
Number of Sequences | 104 |
Average Sequence Length | 43 residues |
Representative Sequence | ITPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLVARLI |
Number of Associated Samples | 13 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 8.91 % |
% of genes near scaffold ends (potentially truncated) | 94.23 % |
% of genes from short scaffolds (< 2000 bps) | 48.08 % |
Associated GOLD sequencing projects | 13 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (81.731 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater (91.346 % of family members) |
Environment Ontology (ENVO) | Unclassified (93.269 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (91.346 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 34.15% Coil/Unstructured: 65.85% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF00072 | Response_reg | 2.88 |
PF01063 | Aminotran_4 | 1.92 |
PF02881 | SRP54_N | 1.92 |
PF04879 | Molybdop_Fe4S4 | 1.92 |
PF00753 | Lactamase_B | 1.92 |
PF13692 | Glyco_trans_1_4 | 1.92 |
PF13749 | HATPase_c_4 | 1.92 |
PF12399 | BCA_ABC_TP_C | 1.92 |
PF00912 | Transgly | 1.92 |
PF00691 | OmpA | 1.92 |
PF00005 | ABC_tran | 1.92 |
PF01418 | HTH_6 | 1.92 |
PF01977 | UbiD | 0.96 |
PF10263 | SprT-like | 0.96 |
PF07726 | AAA_3 | 0.96 |
PF00224 | PK | 0.96 |
PF13304 | AAA_21 | 0.96 |
PF01885 | PTS_2-RNA | 0.96 |
PF13614 | AAA_31 | 0.96 |
PF00754 | F5_F8_type_C | 0.96 |
PF00528 | BPD_transp_1 | 0.96 |
PF00117 | GATase | 0.96 |
PF00334 | NDK | 0.96 |
PF01882 | DUF58 | 0.96 |
PF04166 | PdxA | 0.96 |
PF02774 | Semialdhyde_dhC | 0.96 |
PF02653 | BPD_transp_2 | 0.96 |
PF07963 | N_methyl | 0.96 |
PF00202 | Aminotran_3 | 0.96 |
PF07690 | MFS_1 | 0.96 |
PF00483 | NTP_transferase | 0.96 |
PF03773 | ArsP_1 | 0.96 |
PF01810 | LysE | 0.96 |
PF00478 | IMPDH | 0.96 |
PF00795 | CN_hydrolase | 0.96 |
PF03449 | GreA_GreB_N | 0.96 |
PF07498 | Rho_N | 0.96 |
PF00793 | DAHP_synth_1 | 0.96 |
PF13483 | Lactamase_B_3 | 0.96 |
PF00700 | Flagellin_C | 0.96 |
PF01966 | HD | 0.96 |
PF00133 | tRNA-synt_1 | 0.96 |
PF17131 | LolA_like | 0.96 |
PF06676 | DUF1178 | 0.96 |
PF02335 | Cytochrom_C552 | 0.96 |
PF08275 | Toprim_N | 0.96 |
PF02518 | HATPase_c | 0.96 |
PF05036 | SPOR | 0.96 |
PF04715 | Anth_synt_I_N | 0.96 |
PF02113 | Peptidase_S13 | 0.96 |
PF02310 | B12-binding | 0.96 |
PF14535 | AMP-binding_C_2 | 0.96 |
PF13337 | BrxL_ATPase | 0.96 |
PF06792 | UPF0261 | 0.96 |
PF00724 | Oxidored_FMN | 0.96 |
PF08668 | HDOD | 0.96 |
PF14559 | TPR_19 | 0.96 |
PF13604 | AAA_30 | 0.96 |
PF02540 | NAD_synthase | 0.96 |
PF00873 | ACR_tran | 0.96 |
PF01642 | MM_CoA_mutase | 0.96 |
PF14520 | HHH_5 | 0.96 |
PF00011 | HSP20 | 0.96 |
PF03547 | Mem_trans | 0.96 |
PF01750 | HycI | 0.96 |
PF09350 | DJC28_CD | 0.96 |
PF13175 | AAA_15 | 0.96 |
PF00885 | DMRL_synthase | 0.96 |
PF00378 | ECH_1 | 0.96 |
PF01702 | TGT | 0.96 |
PF11449 | ArsP_2 | 0.96 |
PF12838 | Fer4_7 | 0.96 |
PF04055 | Radical_SAM | 0.96 |
PF14622 | Ribonucleas_3_3 | 0.96 |
PF13426 | PAS_9 | 0.96 |
PF01869 | BcrAD_BadFG | 0.96 |
PF06941 | NT5C | 0.96 |
PF08843 | AbiEii | 0.96 |
PF06114 | Peptidase_M78 | 0.96 |
COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
---|---|---|---|
COG0115 | Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase | Amino acid transport and metabolism [E] | 3.85 |
COG0147 | Anthranilate/para-aminobenzoate synthases component I | Amino acid transport and metabolism [E] | 1.92 |
COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.92 |
COG1737 | DNA-binding transcriptional regulator, MurR/RpiR family, contains HTH and SIS domains | Transcription [K] | 1.92 |
COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 1.92 |
COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 1.92 |
COG1902 | 2,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) family | Energy production and conversion [C] | 0.96 |
COG5441 | ATP-binding helicase-inhibiting domain, Tm-1/UPF0261 family | Defense mechanisms [V] | 0.96 |
COG0782 | Transcription elongation factor, GreA/GreB family | Transcription [K] | 0.96 |
COG1344 | Flagellin and related hook-associated protein FlgL | Cell motility [N] | 0.96 |
COG1549 | Archaeosine tRNA-ribosyltransferase, contains uracil-DNA-glycosylase and PUA domains | Translation, ribosomal structure and biogenesis [J] | 0.96 |
COG1721 | Uncharacterized conserved protein, DUF58 family, contains vWF domain | Function unknown [S] | 0.96 |
COG5319 | Uncharacterized conserved protein, DUF1178 domain | Function unknown [S] | 0.96 |
COG1859 | RNA:NAD 2'-phosphotransferase, TPT1/KptA family | Translation, ribosomal structure and biogenesis [J] | 0.96 |
COG1884 | Methylmalonyl-CoA mutase, N-terminal domain/subunit | Lipid transport and metabolism [I] | 0.96 |
COG1995 | 4-hydroxy-L-threonine phosphate dehydrogenase PdxA | Coenzyme transport and metabolism [H] | 0.96 |
COG0701 | Uncharacterized membrane protein YraQ, UPF0718 family | Function unknown [S] | 0.96 |
COG2027 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
COG2253 | Predicted nucleotidyltransferase component of viral defense system | Defense mechanisms [V] | 0.96 |
COG3303 | Formate-dependent nitrite reductase, periplasmic cytochrome c552 subunit | Inorganic ion transport and metabolism [P] | 0.96 |
COG4502 | 5'(3')-deoxyribonucleotidase | Nucleotide transport and metabolism [F] | 0.96 |
COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 0.96 |
COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.96 |
COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 0.96 |
COG0054 | 6,7-dimethyl-8-ribityllumazine synthase (Riboflavin synthase beta chain) | Coenzyme transport and metabolism [H] | 0.96 |
COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.96 |
COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.96 |
COG0105 | Nucleoside diphosphate kinase | Nucleotide transport and metabolism [F] | 0.96 |
COG0136 | Aspartate-semialdehyde dehydrogenase | Amino acid transport and metabolism [E] | 0.96 |
COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.96 |
COG0002 | N-acetyl-gamma-glutamylphosphate reductase | Amino acid transport and metabolism [E] | 0.96 |
COG0343 | Queuine/archaeosine tRNA-ribosyltransferase | Translation, ribosomal structure and biogenesis [J] | 0.96 |
COG0358 | DNA primase (bacterial type) | Replication, recombination and repair [L] | 0.96 |
COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.96 |
COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.96 |
COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.96 |
COG0679 | Predicted permease, AEC (auxin efflux carrier) family | General function prediction only [R] | 0.96 |
COG0680 | Ni,Fe-hydrogenase maturation factor | Energy production and conversion [C] | 0.96 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 81.73 % |
Unclassified | root | N/A | 18.27 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005612|Ga0070723_10453419 | Not Available | 628 | Open in IMG/M |
3300005832|Ga0074469_11002583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1794 | Open in IMG/M |
3300005832|Ga0074469_11192120 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
3300010392|Ga0118731_105720867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 2034 | Open in IMG/M |
3300010392|Ga0118731_108023005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 824 | Open in IMG/M |
3300014914|Ga0164311_10578861 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
(restricted) 3300023112|Ga0233411_10000231 | All Organisms → cellular organisms → Bacteria | 18189 | Open in IMG/M |
(restricted) 3300023112|Ga0233411_10000613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 10703 | Open in IMG/M |
(restricted) 3300023112|Ga0233411_10000781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 9369 | Open in IMG/M |
(restricted) 3300023112|Ga0233411_10001321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS2 | 7241 | Open in IMG/M |
(restricted) 3300023112|Ga0233411_10001640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS2 | 6494 | Open in IMG/M |
(restricted) 3300023112|Ga0233411_10001696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 6362 | Open in IMG/M |
(restricted) 3300023112|Ga0233411_10003738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini | 4293 | Open in IMG/M |
(restricted) 3300023112|Ga0233411_10006122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3410 | Open in IMG/M |
(restricted) 3300023112|Ga0233411_10007303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3146 | Open in IMG/M |
(restricted) 3300023112|Ga0233411_10020431 | Not Available | 1963 | Open in IMG/M |
(restricted) 3300023112|Ga0233411_10021892 | All Organisms → cellular organisms → Bacteria | 1903 | Open in IMG/M |
(restricted) 3300023112|Ga0233411_10049488 | Not Available | 1306 | Open in IMG/M |
(restricted) 3300023112|Ga0233411_10062034 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
(restricted) 3300023112|Ga0233411_10112795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 874 | Open in IMG/M |
(restricted) 3300023210|Ga0233412_10000251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 31931 | Open in IMG/M |
(restricted) 3300023210|Ga0233412_10000972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 15720 | Open in IMG/M |
(restricted) 3300023210|Ga0233412_10001161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 14167 | Open in IMG/M |
(restricted) 3300023210|Ga0233412_10001231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS2 | 13672 | Open in IMG/M |
(restricted) 3300023210|Ga0233412_10001865 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10592 | Open in IMG/M |
(restricted) 3300023210|Ga0233412_10001963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 10255 | Open in IMG/M |
(restricted) 3300023210|Ga0233412_10002183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS2 | 9666 | Open in IMG/M |
(restricted) 3300023210|Ga0233412_10002869 | All Organisms → cellular organisms → Bacteria | 8178 | Open in IMG/M |
(restricted) 3300023210|Ga0233412_10003954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS2 | 6714 | Open in IMG/M |
(restricted) 3300023210|Ga0233412_10004526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 6175 | Open in IMG/M |
(restricted) 3300023210|Ga0233412_10005114 | All Organisms → cellular organisms → Bacteria | 5742 | Open in IMG/M |
(restricted) 3300023210|Ga0233412_10008325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4272 | Open in IMG/M |
(restricted) 3300023210|Ga0233412_10013431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3264 | Open in IMG/M |
(restricted) 3300023210|Ga0233412_10014188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3174 | Open in IMG/M |
(restricted) 3300023210|Ga0233412_10016069 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes | 2970 | Open in IMG/M |
(restricted) 3300023210|Ga0233412_10016931 | All Organisms → cellular organisms → Bacteria | 2890 | Open in IMG/M |
(restricted) 3300023210|Ga0233412_10019747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2676 | Open in IMG/M |
(restricted) 3300023210|Ga0233412_10025829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2342 | Open in IMG/M |
(restricted) 3300023210|Ga0233412_10081824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1341 | Open in IMG/M |
(restricted) 3300023210|Ga0233412_10107485 | Not Available | 1175 | Open in IMG/M |
(restricted) 3300023210|Ga0233412_10116934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 1127 | Open in IMG/M |
(restricted) 3300023210|Ga0233412_10139334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1034 | Open in IMG/M |
(restricted) 3300023210|Ga0233412_10176116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 922 | Open in IMG/M |
(restricted) 3300023210|Ga0233412_10228587 | Not Available | 811 | Open in IMG/M |
(restricted) 3300023210|Ga0233412_10266278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → unclassified Desulfobulbaceae → Desulfobulbaceae bacterium | 752 | Open in IMG/M |
(restricted) 3300023276|Ga0233410_10000307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 16666 | Open in IMG/M |
(restricted) 3300023276|Ga0233410_10000770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 9367 | Open in IMG/M |
(restricted) 3300023276|Ga0233410_10000855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 8828 | Open in IMG/M |
(restricted) 3300023276|Ga0233410_10001846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS2 | 5848 | Open in IMG/M |
(restricted) 3300023276|Ga0233410_10005447 | All Organisms → cellular organisms → Bacteria | 3421 | Open in IMG/M |
(restricted) 3300023276|Ga0233410_10006726 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3085 | Open in IMG/M |
(restricted) 3300023276|Ga0233410_10008875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2706 | Open in IMG/M |
(restricted) 3300023276|Ga0233410_10018923 | Not Available | 1932 | Open in IMG/M |
(restricted) 3300023276|Ga0233410_10019456 | All Organisms → cellular organisms → Bacteria | 1909 | Open in IMG/M |
(restricted) 3300023276|Ga0233410_10019688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1899 | Open in IMG/M |
(restricted) 3300023276|Ga0233410_10024920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1712 | Open in IMG/M |
(restricted) 3300023276|Ga0233410_10066070 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
(restricted) 3300023276|Ga0233410_10073650 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
(restricted) 3300023276|Ga0233410_10079239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1004 | Open in IMG/M |
(restricted) 3300023276|Ga0233410_10088244 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 954 | Open in IMG/M |
(restricted) 3300023276|Ga0233410_10185617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 664 | Open in IMG/M |
3300027822|Ga0209633_10232241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 974 | Open in IMG/M |
3300027858|Ga0209013_10493095 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
(restricted) 3300027861|Ga0233415_10012697 | Not Available | 3312 | Open in IMG/M |
(restricted) 3300027861|Ga0233415_10053940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1690 | Open in IMG/M |
(restricted) 3300027861|Ga0233415_10148106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1063 | Open in IMG/M |
(restricted) 3300027861|Ga0233415_10186099 | Not Available | 953 | Open in IMG/M |
(restricted) 3300027861|Ga0233415_10256880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 817 | Open in IMG/M |
(restricted) 3300027861|Ga0233415_10295531 | Not Available | 763 | Open in IMG/M |
(restricted) 3300027861|Ga0233415_10335622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum → Magnetospirillum magnetotacticum | 717 | Open in IMG/M |
(restricted) 3300027996|Ga0233413_10001070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 12327 | Open in IMG/M |
(restricted) 3300027996|Ga0233413_10002056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 8553 | Open in IMG/M |
(restricted) 3300027996|Ga0233413_10002192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 8251 | Open in IMG/M |
(restricted) 3300027996|Ga0233413_10003107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 6853 | Open in IMG/M |
(restricted) 3300027996|Ga0233413_10008973 | All Organisms → cellular organisms → Bacteria | 3770 | Open in IMG/M |
(restricted) 3300027996|Ga0233413_10009172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini | 3729 | Open in IMG/M |
(restricted) 3300027996|Ga0233413_10011905 | All Organisms → cellular organisms → Bacteria | 3249 | Open in IMG/M |
(restricted) 3300027996|Ga0233413_10014221 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes | 2959 | Open in IMG/M |
(restricted) 3300027996|Ga0233413_10021036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS2 | 2434 | Open in IMG/M |
(restricted) 3300027996|Ga0233413_10027427 | All Organisms → cellular organisms → Bacteria | 2140 | Open in IMG/M |
(restricted) 3300027996|Ga0233413_10143036 | Not Available | 986 | Open in IMG/M |
(restricted) 3300027996|Ga0233413_10231759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 782 | Open in IMG/M |
(restricted) 3300027996|Ga0233413_10365729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 627 | Open in IMG/M |
(restricted) 3300027996|Ga0233413_10497318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 539 | Open in IMG/M |
(restricted) 3300027996|Ga0233413_10575168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 503 | Open in IMG/M |
(restricted) 3300028045|Ga0233414_10000837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae | 12271 | Open in IMG/M |
(restricted) 3300028045|Ga0233414_10003841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5765 | Open in IMG/M |
(restricted) 3300028045|Ga0233414_10018914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS2 | 2686 | Open in IMG/M |
(restricted) 3300028045|Ga0233414_10019285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2663 | Open in IMG/M |
(restricted) 3300028045|Ga0233414_10023731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2425 | Open in IMG/M |
(restricted) 3300028045|Ga0233414_10048197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1748 | Open in IMG/M |
(restricted) 3300028045|Ga0233414_10060425 | All Organisms → cellular organisms → Bacteria | 1577 | Open in IMG/M |
(restricted) 3300028045|Ga0233414_10062970 | Not Available | 1548 | Open in IMG/M |
(restricted) 3300028045|Ga0233414_10084645 | Not Available | 1351 | Open in IMG/M |
(restricted) 3300028045|Ga0233414_10090350 | Not Available | 1310 | Open in IMG/M |
(restricted) 3300028045|Ga0233414_10132361 | Not Available | 1094 | Open in IMG/M |
(restricted) 3300028045|Ga0233414_10150354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1029 | Open in IMG/M |
(restricted) 3300028045|Ga0233414_10173121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda | 961 | Open in IMG/M |
(restricted) 3300028045|Ga0233414_10298556 | Not Available | 738 | Open in IMG/M |
(restricted) 3300028045|Ga0233414_10333888 | Not Available | 698 | Open in IMG/M |
3300031539|Ga0307380_10439854 | All Organisms → cellular organisms → Bacteria | 1164 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 91.35% |
Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 1.92% |
Marine | Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine | 1.92% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.92% |
Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.96% |
Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.96% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005612 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 | Environmental | Open in IMG/M |
3300005832 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBB | Environmental | Open in IMG/M |
3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
3300014914 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay2, Core 4569-9, 9-12 cm | Environmental | Open in IMG/M |
3300023112 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MG | Environmental | Open in IMG/M |
3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
3300023276 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MG | Environmental | Open in IMG/M |
3300027822 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 1 (SPAdes) | Environmental | Open in IMG/M |
3300027858 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2 (SPAdes) | Environmental | Open in IMG/M |
3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
3300027996 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MG | Environmental | Open in IMG/M |
3300028045 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MG | Environmental | Open in IMG/M |
3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0070723_104534191 | 3300005612 | Marine Sediment | VVIPAKAGIQKDTGCRIKSGMTGIGYLVAGLISCKL* |
Ga0074469_110025831 | 3300005832 | Sediment (Intertidal) | YLNIVIPPRIGVRDDDQAGIQVGTGCRIKSGMTELPYLVAGLICRLEIETR* |
Ga0074469_111921202 | 3300005832 | Sediment (Intertidal) | PATKYLKVVIPAEAGIQAGTGCRIKSGMTEMACLITGLII* |
Ga0118731_1057208671 | 3300010392 | Marine | LNSSNPISITPAIKYVTVVIPAKVGIQKDTGCRIMSGMTGFGYLVA |
Ga0118731_1080230052 | 3300010392 | Marine | ATVVIPAKAGIQKDTGCRIMSGMTGFSYLVAGLITQ* |
Ga0164311_105788612 | 3300014914 | Marine Sediment | VFDINPAIKYLPIVIPAKAGIQEYTGCRIKSGMTEVAYLIAGLIFK |
(restricted) Ga0233411_1000023116 | 3300023112 | Seawater | TPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLIARLIVNI |
(restricted) Ga0233411_1000061310 | 3300023112 | Seawater | IKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLVARLI |
(restricted) Ga0233411_1000078111 | 3300023112 | Seawater | ITLAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLVARLIPSL |
(restricted) Ga0233411_100013217 | 3300023112 | Seawater | ITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLVARLIL |
(restricted) Ga0233411_100016406 | 3300023112 | Seawater | MGIITPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLVARLI |
(restricted) Ga0233411_100016967 | 3300023112 | Seawater | DITPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLIARLIY |
(restricted) Ga0233411_100037381 | 3300023112 | Seawater | SIAEGLRALIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLVARLI |
(restricted) Ga0233411_100061221 | 3300023112 | Seawater | LHDNITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLIARLI |
(restricted) Ga0233411_100073034 | 3300023112 | Seawater | TPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLIARLINN |
(restricted) Ga0233411_100154734 | 3300023112 | Seawater | ITPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLVARLI |
(restricted) Ga0233411_100204311 | 3300023112 | Seawater | AIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLIARLI |
(restricted) Ga0233411_100218921 | 3300023112 | Seawater | VPQICDITPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLIARLI |
(restricted) Ga0233411_100494883 | 3300023112 | Seawater | SRYVFNITPAIKYLNIVIPAKAGIQAGTGCRIKSGMTELDYLIARLIL |
(restricted) Ga0233411_100620342 | 3300023112 | Seawater | PAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLIARLI |
(restricted) Ga0233411_101127951 | 3300023112 | Seawater | NIVIPAKAGIQEGTGCRIKSGMTELEYLVARLIKTANQRKV |
(restricted) Ga0233412_1000025127 | 3300023210 | Seawater | NIVIPAKAGIQVGTGCRIKSGMTELDYLIARLIVNI |
(restricted) Ga0233412_100009721 | 3300023210 | Seawater | ITPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLVARLII |
(restricted) Ga0233412_1000116113 | 3300023210 | Seawater | ITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLVARLICP |
(restricted) Ga0233412_1000123112 | 3300023210 | Seawater | ITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLVARLI |
(restricted) Ga0233412_100018651 | 3300023210 | Seawater | LLFQTDITPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLI |
(restricted) Ga0233412_1000196314 | 3300023210 | Seawater | ITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLIARLINPAVMT |
(restricted) Ga0233412_100021831 | 3300023210 | Seawater | LITPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLIARLI |
(restricted) Ga0233412_1000286912 | 3300023210 | Seawater | LRPIKYLNIVIPAKAGIQVGTGCRIKSGMTELEYLVARLIFFQNLF |
(restricted) Ga0233412_100039549 | 3300023210 | Seawater | ITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLVARLIIHL |
(restricted) Ga0233412_100045261 | 3300023210 | Seawater | TPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLVARLIIKKHLDVEK |
(restricted) Ga0233412_100051141 | 3300023210 | Seawater | LSQLNITPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLVARLI |
(restricted) Ga0233412_100083251 | 3300023210 | Seawater | DITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLIARLIQ |
(restricted) Ga0233412_100134311 | 3300023210 | Seawater | LNIVIPAKAGIQEGTGCRIKSGMTELDYLIARLILPGV |
(restricted) Ga0233412_100141883 | 3300023210 | Seawater | MGKDEFITPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLV |
(restricted) Ga0233412_100160693 | 3300023210 | Seawater | ITPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLIARLIYALQKKM |
(restricted) Ga0233412_100169311 | 3300023210 | Seawater | HITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLIARLIS |
(restricted) Ga0233412_100197474 | 3300023210 | Seawater | DITPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLIARLIL |
(restricted) Ga0233412_100258291 | 3300023210 | Seawater | VITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLIARLISYLVLLQ |
(restricted) Ga0233412_100818241 | 3300023210 | Seawater | NITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLVARLI |
(restricted) Ga0233412_101074853 | 3300023210 | Seawater | DDPRTFINITPAIKYLNIVIPAKAGIQESTGCRIKSGMTELDYLIARLI |
(restricted) Ga0233412_101169341 | 3300023210 | Seawater | KYLNIVIPAKAGIQEGTGCRIKSGMTELDYLVARLI |
(restricted) Ga0233412_101393341 | 3300023210 | Seawater | TPAIKYLSIVIPAKAGIQVGTGCRIKSGMTELDYLIARLIICFTG |
(restricted) Ga0233412_101761162 | 3300023210 | Seawater | MGKDEFITPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLVVRLI |
(restricted) Ga0233412_102285872 | 3300023210 | Seawater | TPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLVARLIIK |
(restricted) Ga0233412_102662781 | 3300023210 | Seawater | FFFFHFSPFIFCFNVTPAIQYLNIVIPAKAGIQEGTGCRIKSGMTELDYLVARLILS |
(restricted) Ga0233410_100003071 | 3300023276 | Seawater | SVYITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLIAMLFMQL |
(restricted) Ga0233410_100007701 | 3300023276 | Seawater | NITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLVARLIPSL |
(restricted) Ga0233410_100008552 | 3300023276 | Seawater | METINPAIKYLNIVIPAKAGIQAGTGCRIKSGMTELDYLIARLIL |
(restricted) Ga0233410_100018466 | 3300023276 | Seawater | FTGIIITPAIKYLNIVIPAKAGIQEGAGCRIKFGMTELDYLAARLI |
(restricted) Ga0233410_100054475 | 3300023276 | Seawater | ITPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLIARLIIIF |
(restricted) Ga0233410_100067261 | 3300023276 | Seawater | LNVITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLIAR |
(restricted) Ga0233410_100088754 | 3300023276 | Seawater | PAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLVARLIIQNKL |
(restricted) Ga0233410_100189233 | 3300023276 | Seawater | AIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLIARLISRVQR |
(restricted) Ga0233410_100194564 | 3300023276 | Seawater | TPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLIARLIFRVIV |
(restricted) Ga0233410_100196883 | 3300023276 | Seawater | ITPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLIARLILPGV |
(restricted) Ga0233410_100249201 | 3300023276 | Seawater | YLNIVIPAKAGIQEGTGCRIKSGMTELDYLIARLIL |
(restricted) Ga0233410_100660701 | 3300023276 | Seawater | AIKYPNIVIPAKAGIQVGTGCRIKSGMTELDYLIARLISKTMQ |
(restricted) Ga0233410_100736502 | 3300023276 | Seawater | KYLNIVIPAKAGIQEGTGCRIKSGMTELDYLVARLILLRF |
(restricted) Ga0233410_100792391 | 3300023276 | Seawater | TPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLIARLILIDFSLKKR |
(restricted) Ga0233410_100882441 | 3300023276 | Seawater | PAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLVARLIL |
(restricted) Ga0233410_101856171 | 3300023276 | Seawater | NITPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLIARLIRTRRAT |
Ga0209633_102322411 | 3300027822 | Marine | KTVFVRASNINPAIKYLPIVIPAKAGIQEYTGCRIKSGMTEVVYLIAGLIFK |
Ga0209013_104930951 | 3300027858 | Marine | GNSSISTDITLAVKYLKVVIPAEAGIQKNTGCRIKSGMTEFGYLLAGLITL |
(restricted) Ga0233415_100126974 | 3300027861 | Seawater | IKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLVARLILRH |
(restricted) Ga0233415_100539403 | 3300027861 | Seawater | MEGISSTLLHITPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLIARL |
(restricted) Ga0233415_101481061 | 3300027861 | Seawater | LCLFESPFFIITPAIKYLNIVIPAKAGIQEGTGCRIKSGITELDYLIARLI |
(restricted) Ga0233415_101860991 | 3300027861 | Seawater | IVIPAKAGIQEGTGCRIKSGMTELDYLVARLIFFQTS |
(restricted) Ga0233415_102568801 | 3300027861 | Seawater | ITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELEYLIARLI |
(restricted) Ga0233415_102955311 | 3300027861 | Seawater | LLLISITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLIARL |
(restricted) Ga0233415_103356221 | 3300027861 | Seawater | IPAKAGIQEGTGCRIKSGMTELDYLIARLITTKEMEK |
(restricted) Ga0233413_1000107014 | 3300027996 | Seawater | MKEYITPAIKYLDIVIPAKAGIQVGTGCRIKSGMTELDYLVARLIIIF |
(restricted) Ga0233413_100020561 | 3300027996 | Seawater | IITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLVARLIFRQYISS |
(restricted) Ga0233413_100021929 | 3300027996 | Seawater | TPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLIARLIY |
(restricted) Ga0233413_100031074 | 3300027996 | Seawater | LITPAIKYLNIVIPAKAGIQEGAGCRIKSGMTELDYLIARLILLRF |
(restricted) Ga0233413_100089735 | 3300027996 | Seawater | KYLNIVIPAKAGIQEGTGCRIKSGMTELEYLVARLI |
(restricted) Ga0233413_100091726 | 3300027996 | Seawater | IVIPAKAGIQVGTGCRIKSGMTELDYLIARLINPAVMT |
(restricted) Ga0233413_100119055 | 3300027996 | Seawater | YITPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLIARLIFKI |
(restricted) Ga0233413_100142211 | 3300027996 | Seawater | AIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLIARLIYALQKKM |
(restricted) Ga0233413_100210361 | 3300027996 | Seawater | NITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLVARLIHRFN |
(restricted) Ga0233413_100274278 | 3300027996 | Seawater | AIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLIARLIR |
(restricted) Ga0233413_101430361 | 3300027996 | Seawater | LNVITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLVA |
(restricted) Ga0233413_102317591 | 3300027996 | Seawater | ITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLVARLIFYTTLGLSIN |
(restricted) Ga0233413_103657291 | 3300027996 | Seawater | SVITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLIARLTF |
(restricted) Ga0233413_104973181 | 3300027996 | Seawater | TPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLVARLIRXN |
(restricted) Ga0233413_105751681 | 3300027996 | Seawater | LNIVIPAKAGIQVGTGCRIKSGMTELDYLVARLIVKPAD |
(restricted) Ga0233414_100008371 | 3300028045 | Seawater | NITPAIKYLNIVIPAKAGIQEGTGCRIKSGITELDYLIARLILYVS |
(restricted) Ga0233414_100038411 | 3300028045 | Seawater | IKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLVARLII |
(restricted) Ga0233414_100189141 | 3300028045 | Seawater | IVIPAKAGIQVGTGCRIKSGMTELDYLVARLIIQNKL |
(restricted) Ga0233414_100192854 | 3300028045 | Seawater | VRNDITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLVARLI |
(restricted) Ga0233414_100237314 | 3300028045 | Seawater | CIITPAIKYLNIVIPAKAGIQEGAGCRIKSGMTELDYLVARLISNH |
(restricted) Ga0233414_100481971 | 3300028045 | Seawater | ITPAIKYLNIVIPAKAGIQEGTGCWIKSGMTELDYLVARLIL |
(restricted) Ga0233414_100604251 | 3300028045 | Seawater | IKYLNIVIPAKAGIQVGTGCRIKSGMTELDYSVARLIIP |
(restricted) Ga0233414_100629701 | 3300028045 | Seawater | LNVITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLI |
(restricted) Ga0233414_100680382 | 3300028045 | Seawater | TPAIKYLNIGIPAKAGIQEGTGCRIKSGMTELDYLIARLI |
(restricted) Ga0233414_100801322 | 3300028045 | Seawater | ILFIDITPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDI |
(restricted) Ga0233414_100846452 | 3300028045 | Seawater | IVIPAKAGIQVGTGCRIKSGMTELDYLVARLIKSVFIPDQ |
(restricted) Ga0233414_100903502 | 3300028045 | Seawater | ITPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLIARLIIK |
(restricted) Ga0233414_101323612 | 3300028045 | Seawater | LHDNITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLVA |
(restricted) Ga0233414_101503543 | 3300028045 | Seawater | FITSAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLIARLIISGTLPDH |
(restricted) Ga0233414_101731212 | 3300028045 | Seawater | TPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLVARLI |
(restricted) Ga0233414_102985561 | 3300028045 | Seawater | YLDIVIPAKAGIQEGTGCRIKSGMTELDYLIARLIPSFF |
(restricted) Ga0233414_103338881 | 3300028045 | Seawater | YNIIPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLVARLIKDETKN |
Ga0307380_104398541 | 3300031539 | Soil | YVNIVIPAKAGIQVGTGCRIKSGMTQLPYLVAGLITAA |
⦗Top⦘ |