Metagenome Family F096380

Basic Information
Family ID	F096380
Family Type	Metagenome
Number of Sequences	104
Average Sequence Length	43 residues
Representative Sequence	ITPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLVARLI
Number of Associated Samples	13
Number of Associated Scaffolds	104

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	8.91 %
% of genes near scaffold ends (potentially truncated)	94.23 %
% of genes from short scaffolds (< 2000 bps)	48.08 %
Associated GOLD sequencing projects	13
AlphaFold2 3D model prediction	No

Most Common Taxonomy
Group	Bacteria (81.731 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater (91.346 % of family members)
Environment Ontology (ENVO)	Unclassified (93.269 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (91.346 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 34.15% Coil/Unstructured: 65.85%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 104 Family Scaffolds
PF00072	Response_reg	2.88
PF01063	Aminotran_4	1.92
PF02881	SRP54_N	1.92
PF04879	Molybdop_Fe4S4	1.92
PF00753	Lactamase_B	1.92
PF13692	Glyco_trans_1_4	1.92
PF13749	HATPase_c_4	1.92
PF12399	BCA_ABC_TP_C	1.92
PF00912	Transgly	1.92
PF00691	OmpA	1.92
PF00005	ABC_tran	1.92
PF01418	HTH_6	1.92
PF01977	UbiD	0.96
PF10263	SprT-like	0.96
PF07726	AAA_3	0.96
PF00224	PK	0.96
PF13304	AAA_21	0.96
PF01885	PTS_2-RNA	0.96
PF13614	AAA_31	0.96
PF00754	F5_F8_type_C	0.96
PF00528	BPD_transp_1	0.96
PF00117	GATase	0.96
PF00334	NDK	0.96
PF01882	DUF58	0.96
PF04166	PdxA	0.96
PF02774	Semialdhyde_dhC	0.96
PF02653	BPD_transp_2	0.96
PF07963	N_methyl	0.96
PF00202	Aminotran_3	0.96
PF07690	MFS_1	0.96
PF00483	NTP_transferase	0.96
PF03773	ArsP_1	0.96
PF01810	LysE	0.96
PF00478	IMPDH	0.96
PF00795	CN_hydrolase	0.96
PF03449	GreA_GreB_N	0.96
PF07498	Rho_N	0.96
PF00793	DAHP_synth_1	0.96
PF13483	Lactamase_B_3	0.96
PF00700	Flagellin_C	0.96
PF01966	HD	0.96
PF00133	tRNA-synt_1	0.96
PF17131	LolA_like	0.96
PF06676	DUF1178	0.96
PF02335	Cytochrom_C552	0.96
PF08275	Toprim_N	0.96
PF02518	HATPase_c	0.96
PF05036	SPOR	0.96
PF04715	Anth_synt_I_N	0.96
PF02113	Peptidase_S13	0.96
PF02310	B12-binding	0.96
PF14535	AMP-binding_C_2	0.96
PF13337	BrxL_ATPase	0.96
PF06792	UPF0261	0.96
PF00724	Oxidored_FMN	0.96
PF08668	HDOD	0.96
PF14559	TPR_19	0.96
PF13604	AAA_30	0.96
PF02540	NAD_synthase	0.96
PF00873	ACR_tran	0.96
PF01642	MM_CoA_mutase	0.96
PF14520	HHH_5	0.96
PF00011	HSP20	0.96
PF03547	Mem_trans	0.96
PF01750	HycI	0.96
PF09350	DJC28_CD	0.96
PF13175	AAA_15	0.96
PF00885	DMRL_synthase	0.96
PF00378	ECH_1	0.96
PF01702	TGT	0.96
PF11449	ArsP_2	0.96
PF12838	Fer4_7	0.96
PF04055	Radical_SAM	0.96
PF14622	Ribonucleas_3_3	0.96
PF13426	PAS_9	0.96
PF01869	BcrAD_BadFG	0.96
PF06941	NT5C	0.96
PF08843	AbiEii	0.96
PF06114	Peptidase_M78	0.96

COG ID	Name	Functional Category	% Frequency in 104 Family Scaffolds
COG0115	Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase	Amino acid transport and metabolism [E]	3.85
COG0147	Anthranilate/para-aminobenzoate synthases component I	Amino acid transport and metabolism [E]	1.92
COG0744	Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase	Cell wall/membrane/envelope biogenesis [M]	1.92
COG1737	DNA-binding transcriptional regulator, MurR/RpiR family, contains HTH and SIS domains	Transcription [K]	1.92
COG5009	Membrane carboxypeptidase/penicillin-binding protein	Cell wall/membrane/envelope biogenesis [M]	1.92
COG4953	Membrane carboxypeptidase/penicillin-binding protein PbpC	Cell wall/membrane/envelope biogenesis [M]	1.92
COG1902	2,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) family	Energy production and conversion [C]	0.96
COG5441	ATP-binding helicase-inhibiting domain, Tm-1/UPF0261 family	Defense mechanisms [V]	0.96
COG0782	Transcription elongation factor, GreA/GreB family	Transcription [K]	0.96
COG1344	Flagellin and related hook-associated protein FlgL	Cell motility [N]	0.96
COG1549	Archaeosine tRNA-ribosyltransferase, contains uracil-DNA-glycosylase and PUA domains	Translation, ribosomal structure and biogenesis [J]	0.96
COG1721	Uncharacterized conserved protein, DUF58 family, contains vWF domain	Function unknown [S]	0.96
COG5319	Uncharacterized conserved protein, DUF1178 domain	Function unknown [S]	0.96
COG1859	RNA:NAD 2'-phosphotransferase, TPT1/KptA family	Translation, ribosomal structure and biogenesis [J]	0.96
COG1884	Methylmalonyl-CoA mutase, N-terminal domain/subunit	Lipid transport and metabolism [I]	0.96
COG1995	4-hydroxy-L-threonine phosphate dehydrogenase PdxA	Coenzyme transport and metabolism [H]	0.96
COG0701	Uncharacterized membrane protein YraQ, UPF0718 family	Function unknown [S]	0.96
COG2027	D-alanyl-D-alanine carboxypeptidase	Cell wall/membrane/envelope biogenesis [M]	0.96
COG2253	Predicted nucleotidyltransferase component of viral defense system	Defense mechanisms [V]	0.96
COG3303	Formate-dependent nitrite reductase, periplasmic cytochrome c552 subunit	Inorganic ion transport and metabolism [P]	0.96
COG4502	5'(3')-deoxyribonucleotidase	Nucleotide transport and metabolism [F]	0.96
COG0171	NH3-dependent NAD+ synthetase	Coenzyme transport and metabolism [H]	0.96
COG0042	tRNA-dihydrouridine synthase	Translation, ribosomal structure and biogenesis [J]	0.96
COG0043	3-polyprenyl-4-hydroxybenzoate decarboxylase	Coenzyme transport and metabolism [H]	0.96
COG0054	6,7-dimethyl-8-ribityllumazine synthase (Riboflavin synthase beta chain)	Coenzyme transport and metabolism [H]	0.96
COG0060	Isoleucyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.96
COG0071	Small heat shock protein IbpA, HSP20 family	Posttranslational modification, protein turnover, chaperones [O]	0.96
COG0105	Nucleoside diphosphate kinase	Nucleotide transport and metabolism [F]	0.96
COG0136	Aspartate-semialdehyde dehydrogenase	Amino acid transport and metabolism [E]	0.96
COG0143	Methionyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.96
COG0002	N-acetyl-gamma-glutamylphosphate reductase	Amino acid transport and metabolism [E]	0.96
COG0343	Queuine/archaeosine tRNA-ribosyltransferase	Translation, ribosomal structure and biogenesis [J]	0.96
COG0358	DNA primase (bacterial type)	Replication, recombination and repair [L]	0.96
COG0469	Pyruvate kinase	Carbohydrate transport and metabolism [G]	0.96
COG0495	Leucyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.96
COG0525	Valyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.96
COG0679	Predicted permease, AEC (auxin efflux carrier) family	General function prediction only [R]	0.96
COG0680	Ni,Fe-hydrogenase maturation factor	Energy production and conversion [C]	0.96

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	81.73 %
Unclassified	root	N/A	18.27 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	81.73 %
Unclassified	root	N/A	18.27 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	81.73 %
Unclassified	root	N/A	18.27 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	62.50 %
Unclassified	root	N/A	18.27 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	1.92 %

Name	Rank	Taxonomy	Distribution
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	58.65 %
Unclassified	root	N/A	18.27 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	1.92 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.96 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	58.65 %
Unclassified	root	N/A	18.27 %
Candidatus Aminicenantes	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes	1.92 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	18.27 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	14.42 %
Desulfobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales	9.62 %
Candidatus Aminicenantes	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes	1.92 %
Syntrophobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales	0.96 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	18.27 %
delta proteobacterium NaphS2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS2	7.69 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	6.73 %
Desulfobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	5.77 %
Candidatus Aminicenantes	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes	1.92 %
Desulfobacterales incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis	0.96 %
Syntrophobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae	0.96 %
Desulfobulbaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae	0.96 %
Magnetospirillum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	18.27 %
delta proteobacterium NaphS2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS2	7.69 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	6.73 %
Desulfatiglans	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans	1.92 %
Candidatus Aminicenantes	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes	1.92 %
Candidatus Desulfatibia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia	0.96 %
unclassified Desulfobulbaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → unclassified Desulfobulbaceae	0.96 %
Magnetospirillum magnetotacticum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum → Magnetospirillum magnetotacticum	0.96 %
Syntrophobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	18.27 %
delta proteobacterium NaphS2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS2	7.69 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	6.73 %
Desulfatiglans anilini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini	1.92 %
Candidatus Aminicenantes	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes	1.92 %
Desulfobulbaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → unclassified Desulfobulbaceae → Desulfobulbaceae bacterium	0.96 %
Candidatus Desulfatibia profunda	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda	0.96 %
Magnetospirillum magnetotacticum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum → Magnetospirillum magnetotacticum	0.96 %
Syntrophobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae	0.96 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005612\|Ga0070723_10453419	Not Available	628	Open in IMG/M
3300005832\|Ga0074469_11002583	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	1794	Open in IMG/M
3300005832\|Ga0074469_11192120	All Organisms → cellular organisms → Bacteria	977	Open in IMG/M
3300010392\|Ga0118731_105720867	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	2034	Open in IMG/M
3300010392\|Ga0118731_108023005	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	824	Open in IMG/M
3300014914\|Ga0164311_10578861	All Organisms → cellular organisms → Bacteria	644	Open in IMG/M
(restricted) 3300023112\|Ga0233411_10000231	All Organisms → cellular organisms → Bacteria	18189	Open in IMG/M
(restricted) 3300023112\|Ga0233411_10000613	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	10703	Open in IMG/M
(restricted) 3300023112\|Ga0233411_10000781	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	9369	Open in IMG/M
(restricted) 3300023112\|Ga0233411_10001321	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS2	7241	Open in IMG/M
(restricted) 3300023112\|Ga0233411_10001640	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS2	6494	Open in IMG/M
(restricted) 3300023112\|Ga0233411_10001696	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	6362	Open in IMG/M
(restricted) 3300023112\|Ga0233411_10003738	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini	4293	Open in IMG/M
(restricted) 3300023112\|Ga0233411_10006122	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	3410	Open in IMG/M
(restricted) 3300023112\|Ga0233411_10007303	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	3146	Open in IMG/M
(restricted) 3300023112\|Ga0233411_10020431	Not Available	1963	Open in IMG/M
(restricted) 3300023112\|Ga0233411_10021892	All Organisms → cellular organisms → Bacteria	1903	Open in IMG/M
(restricted) 3300023112\|Ga0233411_10049488	Not Available	1306	Open in IMG/M
(restricted) 3300023112\|Ga0233411_10062034	All Organisms → cellular organisms → Bacteria	1172	Open in IMG/M
(restricted) 3300023112\|Ga0233411_10112795	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	874	Open in IMG/M
(restricted) 3300023210\|Ga0233412_10000251	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	31931	Open in IMG/M
(restricted) 3300023210\|Ga0233412_10000972	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	15720	Open in IMG/M
(restricted) 3300023210\|Ga0233412_10001161	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	14167	Open in IMG/M
(restricted) 3300023210\|Ga0233412_10001231	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS2	13672	Open in IMG/M
(restricted) 3300023210\|Ga0233412_10001865	All Organisms → cellular organisms → Bacteria → Proteobacteria	10592	Open in IMG/M
(restricted) 3300023210\|Ga0233412_10001963	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	10255	Open in IMG/M
(restricted) 3300023210\|Ga0233412_10002183	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS2	9666	Open in IMG/M
(restricted) 3300023210\|Ga0233412_10002869	All Organisms → cellular organisms → Bacteria	8178	Open in IMG/M
(restricted) 3300023210\|Ga0233412_10003954	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS2	6714	Open in IMG/M
(restricted) 3300023210\|Ga0233412_10004526	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	6175	Open in IMG/M
(restricted) 3300023210\|Ga0233412_10005114	All Organisms → cellular organisms → Bacteria	5742	Open in IMG/M
(restricted) 3300023210\|Ga0233412_10008325	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	4272	Open in IMG/M
(restricted) 3300023210\|Ga0233412_10013431	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	3264	Open in IMG/M
(restricted) 3300023210\|Ga0233412_10014188	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	3174	Open in IMG/M
(restricted) 3300023210\|Ga0233412_10016069	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes	2970	Open in IMG/M
(restricted) 3300023210\|Ga0233412_10016931	All Organisms → cellular organisms → Bacteria	2890	Open in IMG/M
(restricted) 3300023210\|Ga0233412_10019747	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2676	Open in IMG/M
(restricted) 3300023210\|Ga0233412_10025829	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2342	Open in IMG/M
(restricted) 3300023210\|Ga0233412_10081824	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1341	Open in IMG/M
(restricted) 3300023210\|Ga0233412_10107485	Not Available	1175	Open in IMG/M
(restricted) 3300023210\|Ga0233412_10116934	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales	1127	Open in IMG/M
(restricted) 3300023210\|Ga0233412_10139334	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1034	Open in IMG/M
(restricted) 3300023210\|Ga0233412_10176116	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	922	Open in IMG/M
(restricted) 3300023210\|Ga0233412_10228587	Not Available	811	Open in IMG/M
(restricted) 3300023210\|Ga0233412_10266278	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → unclassified Desulfobulbaceae → Desulfobulbaceae bacterium	752	Open in IMG/M
(restricted) 3300023276\|Ga0233410_10000307	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	16666	Open in IMG/M
(restricted) 3300023276\|Ga0233410_10000770	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	9367	Open in IMG/M
(restricted) 3300023276\|Ga0233410_10000855	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	8828	Open in IMG/M
(restricted) 3300023276\|Ga0233410_10001846	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS2	5848	Open in IMG/M
(restricted) 3300023276\|Ga0233410_10005447	All Organisms → cellular organisms → Bacteria	3421	Open in IMG/M
(restricted) 3300023276\|Ga0233410_10006726	All Organisms → cellular organisms → Bacteria → Proteobacteria	3085	Open in IMG/M
(restricted) 3300023276\|Ga0233410_10008875	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2706	Open in IMG/M
(restricted) 3300023276\|Ga0233410_10018923	Not Available	1932	Open in IMG/M
(restricted) 3300023276\|Ga0233410_10019456	All Organisms → cellular organisms → Bacteria	1909	Open in IMG/M
(restricted) 3300023276\|Ga0233410_10019688	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1899	Open in IMG/M
(restricted) 3300023276\|Ga0233410_10024920	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1712	Open in IMG/M
(restricted) 3300023276\|Ga0233410_10066070	All Organisms → cellular organisms → Bacteria	1094	Open in IMG/M
(restricted) 3300023276\|Ga0233410_10073650	All Organisms → cellular organisms → Bacteria	1039	Open in IMG/M
(restricted) 3300023276\|Ga0233410_10079239	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1004	Open in IMG/M
(restricted) 3300023276\|Ga0233410_10088244	All Organisms → cellular organisms → Bacteria → Proteobacteria	954	Open in IMG/M
(restricted) 3300023276\|Ga0233410_10185617	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	664	Open in IMG/M
3300027822\|Ga0209633_10232241	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales	974	Open in IMG/M
3300027858\|Ga0209013_10493095	All Organisms → cellular organisms → Bacteria	661	Open in IMG/M
(restricted) 3300027861\|Ga0233415_10012697	Not Available	3312	Open in IMG/M
(restricted) 3300027861\|Ga0233415_10053940	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1690	Open in IMG/M
(restricted) 3300027861\|Ga0233415_10148106	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1063	Open in IMG/M
(restricted) 3300027861\|Ga0233415_10186099	Not Available	953	Open in IMG/M
(restricted) 3300027861\|Ga0233415_10256880	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	817	Open in IMG/M
(restricted) 3300027861\|Ga0233415_10295531	Not Available	763	Open in IMG/M
(restricted) 3300027861\|Ga0233415_10335622	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum → Magnetospirillum magnetotacticum	717	Open in IMG/M
(restricted) 3300027996\|Ga0233413_10001070	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	12327	Open in IMG/M
(restricted) 3300027996\|Ga0233413_10002056	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	8553	Open in IMG/M
(restricted) 3300027996\|Ga0233413_10002192	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	8251	Open in IMG/M
(restricted) 3300027996\|Ga0233413_10003107	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	6853	Open in IMG/M
(restricted) 3300027996\|Ga0233413_10008973	All Organisms → cellular organisms → Bacteria	3770	Open in IMG/M
(restricted) 3300027996\|Ga0233413_10009172	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini	3729	Open in IMG/M
(restricted) 3300027996\|Ga0233413_10011905	All Organisms → cellular organisms → Bacteria	3249	Open in IMG/M
(restricted) 3300027996\|Ga0233413_10014221	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes	2959	Open in IMG/M
(restricted) 3300027996\|Ga0233413_10021036	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS2	2434	Open in IMG/M
(restricted) 3300027996\|Ga0233413_10027427	All Organisms → cellular organisms → Bacteria	2140	Open in IMG/M
(restricted) 3300027996\|Ga0233413_10143036	Not Available	986	Open in IMG/M
(restricted) 3300027996\|Ga0233413_10231759	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	782	Open in IMG/M
(restricted) 3300027996\|Ga0233413_10365729	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	627	Open in IMG/M
(restricted) 3300027996\|Ga0233413_10497318	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	539	Open in IMG/M
(restricted) 3300027996\|Ga0233413_10575168	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	503	Open in IMG/M
(restricted) 3300028045\|Ga0233414_10000837	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae	12271	Open in IMG/M
(restricted) 3300028045\|Ga0233414_10003841	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	5765	Open in IMG/M
(restricted) 3300028045\|Ga0233414_10018914	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS2	2686	Open in IMG/M
(restricted) 3300028045\|Ga0233414_10019285	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2663	Open in IMG/M
(restricted) 3300028045\|Ga0233414_10023731	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2425	Open in IMG/M
(restricted) 3300028045\|Ga0233414_10048197	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1748	Open in IMG/M
(restricted) 3300028045\|Ga0233414_10060425	All Organisms → cellular organisms → Bacteria	1577	Open in IMG/M
(restricted) 3300028045\|Ga0233414_10062970	Not Available	1548	Open in IMG/M
(restricted) 3300028045\|Ga0233414_10084645	Not Available	1351	Open in IMG/M
(restricted) 3300028045\|Ga0233414_10090350	Not Available	1310	Open in IMG/M
(restricted) 3300028045\|Ga0233414_10132361	Not Available	1094	Open in IMG/M
(restricted) 3300028045\|Ga0233414_10150354	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1029	Open in IMG/M
(restricted) 3300028045\|Ga0233414_10173121	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda	961	Open in IMG/M
(restricted) 3300028045\|Ga0233414_10298556	Not Available	738	Open in IMG/M
(restricted) 3300028045\|Ga0233414_10333888	Not Available	698	Open in IMG/M
3300031539\|Ga0307380_10439854	All Organisms → cellular organisms → Bacteria	1164	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	99.04%
Terrestrial	Environmental → Terrestrial	0.96%

Habitat	Taxonomy	Distribution
Marine	Environmental → Aquatic → Marine	97.12%
Sediment	Environmental → Aquatic → Sediment	1.92%
Soil	Environmental → Terrestrial → Soil	0.96%

Habitat	Taxonomy	Distribution
Inlet	Environmental → Aquatic → Marine → Inlet	91.35%
Coastal	Environmental → Aquatic → Marine → Coastal	2.88%
Oil Seeps	Environmental → Aquatic → Marine → Oil Seeps	1.92%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	1.92%
Hydrothermal Vents	Environmental → Aquatic → Marine → Hydrothermal Vents	0.96%
Clay	Environmental → Terrestrial → Soil → Clay	0.96%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Marine → Inlet → Unclassified	91.35%
Sediment	Environmental → Aquatic → Marine → Coastal → Sediment	2.88%
Unclassified	Environmental → Aquatic → Marine → Oil Seeps → Unclassified	1.92%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	1.92%
Sediment	Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment	0.96%
Unclassified	Environmental → Terrestrial → Soil → Clay → Unclassified	0.96%

Habitat	Taxonomy	Distribution
Seawater	Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater	91.35%
Marine	Environmental → Aquatic → Marine → Coastal → Sediment → Marine	1.92%
Marine	Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine	1.92%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	1.92%
Marine Sediment	Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment	0.96%
Marine Sediment	Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment	0.96%
Soil	Environmental → Terrestrial → Soil → Clay → Unclassified → Soil	0.96%

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005612	Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2	Environmental	Open in IMG/M
3300005832	Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBB	Environmental	Open in IMG/M
3300010392	Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385	Environmental	Open in IMG/M
3300014914	Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay2, Core 4569-9, 9-12 cm	Environmental	Open in IMG/M
3300023112 (restricted)	Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MG	Environmental	Open in IMG/M
3300023210 (restricted)	Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG	Environmental	Open in IMG/M
3300023276 (restricted)	Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MG	Environmental	Open in IMG/M
3300027822	Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 1 (SPAdes)	Environmental	Open in IMG/M
3300027858	Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2 (SPAdes)	Environmental	Open in IMG/M
3300027861 (restricted)	Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG	Environmental	Open in IMG/M
3300027996 (restricted)	Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MG	Environmental	Open in IMG/M
3300028045 (restricted)	Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MG	Environmental	Open in IMG/M
3300031539	Soil microbial communities from Risofladan, Vaasa, Finland - UN-3	Environmental	Open in IMG/M

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0070723_104534191	3300005612	Marine Sediment	VVIPAKAGIQKDTGCRIKSGMTGIGYLVAGLISCKL*
Ga0074469_110025831	3300005832	Sediment (Intertidal)	YLNIVIPPRIGVRDDDQAGIQVGTGCRIKSGMTELPYLVAGLICRLEIETR*
Ga0074469_111921202	3300005832	Sediment (Intertidal)	PATKYLKVVIPAEAGIQAGTGCRIKSGMTEMACLITGLII*
Ga0118731_1057208671	3300010392	Marine	LNSSNPISITPAIKYVTVVIPAKVGIQKDTGCRIMSGMTGFGYLVA
Ga0118731_1080230052	3300010392	Marine	ATVVIPAKAGIQKDTGCRIMSGMTGFSYLVAGLITQ*
Ga0164311_105788612	3300014914	Marine Sediment	VFDINPAIKYLPIVIPAKAGIQEYTGCRIKSGMTEVAYLIAGLIFK
(restricted) Ga0233411_1000023116	3300023112	Seawater	TPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLIARLIVNI
(restricted) Ga0233411_1000061310	3300023112	Seawater	IKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLVARLI
(restricted) Ga0233411_1000078111	3300023112	Seawater	ITLAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLVARLIPSL
(restricted) Ga0233411_100013217	3300023112	Seawater	ITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLVARLIL
(restricted) Ga0233411_100016406	3300023112	Seawater	MGIITPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLVARLI
(restricted) Ga0233411_100016967	3300023112	Seawater	DITPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLIARLIY
(restricted) Ga0233411_100037381	3300023112	Seawater	SIAEGLRALIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLVARLI
(restricted) Ga0233411_100061221	3300023112	Seawater	LHDNITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLIARLI
(restricted) Ga0233411_100073034	3300023112	Seawater	TPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLIARLINN
(restricted) Ga0233411_100154734	3300023112	Seawater	ITPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLVARLI
(restricted) Ga0233411_100204311	3300023112	Seawater	AIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLIARLI
(restricted) Ga0233411_100218921	3300023112	Seawater	VPQICDITPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLIARLI
(restricted) Ga0233411_100494883	3300023112	Seawater	SRYVFNITPAIKYLNIVIPAKAGIQAGTGCRIKSGMTELDYLIARLIL
(restricted) Ga0233411_100620342	3300023112	Seawater	PAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLIARLI
(restricted) Ga0233411_101127951	3300023112	Seawater	NIVIPAKAGIQEGTGCRIKSGMTELEYLVARLIKTANQRKV
(restricted) Ga0233412_1000025127	3300023210	Seawater	NIVIPAKAGIQVGTGCRIKSGMTELDYLIARLIVNI
(restricted) Ga0233412_100009721	3300023210	Seawater	ITPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLVARLII
(restricted) Ga0233412_1000116113	3300023210	Seawater	ITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLVARLICP
(restricted) Ga0233412_1000123112	3300023210	Seawater	ITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLVARLI
(restricted) Ga0233412_100018651	3300023210	Seawater	LLFQTDITPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLI
(restricted) Ga0233412_1000196314	3300023210	Seawater	ITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLIARLINPAVMT
(restricted) Ga0233412_100021831	3300023210	Seawater	LITPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLIARLI
(restricted) Ga0233412_1000286912	3300023210	Seawater	LRPIKYLNIVIPAKAGIQVGTGCRIKSGMTELEYLVARLIFFQNLF
(restricted) Ga0233412_100039549	3300023210	Seawater	ITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLVARLIIHL
(restricted) Ga0233412_100045261	3300023210	Seawater	TPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLVARLIIKKHLDVEK
(restricted) Ga0233412_100051141	3300023210	Seawater	LSQLNITPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLVARLI
(restricted) Ga0233412_100083251	3300023210	Seawater	DITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLIARLIQ
(restricted) Ga0233412_100134311	3300023210	Seawater	LNIVIPAKAGIQEGTGCRIKSGMTELDYLIARLILPGV
(restricted) Ga0233412_100141883	3300023210	Seawater	MGKDEFITPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLV
(restricted) Ga0233412_100160693	3300023210	Seawater	ITPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLIARLIYALQKKM
(restricted) Ga0233412_100169311	3300023210	Seawater	HITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLIARLIS
(restricted) Ga0233412_100197474	3300023210	Seawater	DITPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLIARLIL
(restricted) Ga0233412_100258291	3300023210	Seawater	VITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLIARLISYLVLLQ
(restricted) Ga0233412_100818241	3300023210	Seawater	NITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLVARLI
(restricted) Ga0233412_101074853	3300023210	Seawater	DDPRTFINITPAIKYLNIVIPAKAGIQESTGCRIKSGMTELDYLIARLI
(restricted) Ga0233412_101169341	3300023210	Seawater	KYLNIVIPAKAGIQEGTGCRIKSGMTELDYLVARLI
(restricted) Ga0233412_101393341	3300023210	Seawater	TPAIKYLSIVIPAKAGIQVGTGCRIKSGMTELDYLIARLIICFTG
(restricted) Ga0233412_101761162	3300023210	Seawater	MGKDEFITPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLVVRLI
(restricted) Ga0233412_102285872	3300023210	Seawater	TPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLVARLIIK
(restricted) Ga0233412_102662781	3300023210	Seawater	FFFFHFSPFIFCFNVTPAIQYLNIVIPAKAGIQEGTGCRIKSGMTELDYLVARLILS
(restricted) Ga0233410_100003071	3300023276	Seawater	SVYITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLIAMLFMQL
(restricted) Ga0233410_100007701	3300023276	Seawater	NITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLVARLIPSL
(restricted) Ga0233410_100008552	3300023276	Seawater	METINPAIKYLNIVIPAKAGIQAGTGCRIKSGMTELDYLIARLIL
(restricted) Ga0233410_100018466	3300023276	Seawater	FTGIIITPAIKYLNIVIPAKAGIQEGAGCRIKFGMTELDYLAARLI
(restricted) Ga0233410_100054475	3300023276	Seawater	ITPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLIARLIIIF
(restricted) Ga0233410_100067261	3300023276	Seawater	LNVITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLIAR
(restricted) Ga0233410_100088754	3300023276	Seawater	PAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLVARLIIQNKL
(restricted) Ga0233410_100189233	3300023276	Seawater	AIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLIARLISRVQR
(restricted) Ga0233410_100194564	3300023276	Seawater	TPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLIARLIFRVIV
(restricted) Ga0233410_100196883	3300023276	Seawater	ITPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLIARLILPGV
(restricted) Ga0233410_100249201	3300023276	Seawater	YLNIVIPAKAGIQEGTGCRIKSGMTELDYLIARLIL
(restricted) Ga0233410_100660701	3300023276	Seawater	AIKYPNIVIPAKAGIQVGTGCRIKSGMTELDYLIARLISKTMQ
(restricted) Ga0233410_100736502	3300023276	Seawater	KYLNIVIPAKAGIQEGTGCRIKSGMTELDYLVARLILLRF
(restricted) Ga0233410_100792391	3300023276	Seawater	TPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLIARLILIDFSLKKR
(restricted) Ga0233410_100882441	3300023276	Seawater	PAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLVARLIL
(restricted) Ga0233410_101856171	3300023276	Seawater	NITPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLIARLIRTRRAT
Ga0209633_102322411	3300027822	Marine	KTVFVRASNINPAIKYLPIVIPAKAGIQEYTGCRIKSGMTEVVYLIAGLIFK
Ga0209013_104930951	3300027858	Marine	GNSSISTDITLAVKYLKVVIPAEAGIQKNTGCRIKSGMTEFGYLLAGLITL
(restricted) Ga0233415_100126974	3300027861	Seawater	IKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLVARLILRH
(restricted) Ga0233415_100539403	3300027861	Seawater	MEGISSTLLHITPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLIARL
(restricted) Ga0233415_101481061	3300027861	Seawater	LCLFESPFFIITPAIKYLNIVIPAKAGIQEGTGCRIKSGITELDYLIARLI
(restricted) Ga0233415_101860991	3300027861	Seawater	IVIPAKAGIQEGTGCRIKSGMTELDYLVARLIFFQTS
(restricted) Ga0233415_102568801	3300027861	Seawater	ITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELEYLIARLI
(restricted) Ga0233415_102955311	3300027861	Seawater	LLLISITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLIARL
(restricted) Ga0233415_103356221	3300027861	Seawater	IPAKAGIQEGTGCRIKSGMTELDYLIARLITTKEMEK
(restricted) Ga0233413_1000107014	3300027996	Seawater	MKEYITPAIKYLDIVIPAKAGIQVGTGCRIKSGMTELDYLVARLIIIF
(restricted) Ga0233413_100020561	3300027996	Seawater	IITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLVARLIFRQYISS
(restricted) Ga0233413_100021929	3300027996	Seawater	TPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLIARLIY
(restricted) Ga0233413_100031074	3300027996	Seawater	LITPAIKYLNIVIPAKAGIQEGAGCRIKSGMTELDYLIARLILLRF
(restricted) Ga0233413_100089735	3300027996	Seawater	KYLNIVIPAKAGIQEGTGCRIKSGMTELEYLVARLI
(restricted) Ga0233413_100091726	3300027996	Seawater	IVIPAKAGIQVGTGCRIKSGMTELDYLIARLINPAVMT
(restricted) Ga0233413_100119055	3300027996	Seawater	YITPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLIARLIFKI
(restricted) Ga0233413_100142211	3300027996	Seawater	AIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLIARLIYALQKKM
(restricted) Ga0233413_100210361	3300027996	Seawater	NITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLVARLIHRFN
(restricted) Ga0233413_100274278	3300027996	Seawater	AIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLIARLIR
(restricted) Ga0233413_101430361	3300027996	Seawater	LNVITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLVA
(restricted) Ga0233413_102317591	3300027996	Seawater	ITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLVARLIFYTTLGLSIN
(restricted) Ga0233413_103657291	3300027996	Seawater	SVITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLIARLTF
(restricted) Ga0233413_104973181	3300027996	Seawater	TPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLVARLIRXN
(restricted) Ga0233413_105751681	3300027996	Seawater	LNIVIPAKAGIQVGTGCRIKSGMTELDYLVARLIVKPAD
(restricted) Ga0233414_100008371	3300028045	Seawater	NITPAIKYLNIVIPAKAGIQEGTGCRIKSGITELDYLIARLILYVS
(restricted) Ga0233414_100038411	3300028045	Seawater	IKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLVARLII
(restricted) Ga0233414_100189141	3300028045	Seawater	IVIPAKAGIQVGTGCRIKSGMTELDYLVARLIIQNKL
(restricted) Ga0233414_100192854	3300028045	Seawater	VRNDITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLVARLI
(restricted) Ga0233414_100237314	3300028045	Seawater	CIITPAIKYLNIVIPAKAGIQEGAGCRIKSGMTELDYLVARLISNH
(restricted) Ga0233414_100481971	3300028045	Seawater	ITPAIKYLNIVIPAKAGIQEGTGCWIKSGMTELDYLVARLIL
(restricted) Ga0233414_100604251	3300028045	Seawater	IKYLNIVIPAKAGIQVGTGCRIKSGMTELDYSVARLIIP
(restricted) Ga0233414_100629701	3300028045	Seawater	LNVITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLI
(restricted) Ga0233414_100680382	3300028045	Seawater	TPAIKYLNIGIPAKAGIQEGTGCRIKSGMTELDYLIARLI
(restricted) Ga0233414_100801322	3300028045	Seawater	ILFIDITPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDI
(restricted) Ga0233414_100846452	3300028045	Seawater	IVIPAKAGIQVGTGCRIKSGMTELDYLVARLIKSVFIPDQ
(restricted) Ga0233414_100903502	3300028045	Seawater	ITPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLIARLIIK
(restricted) Ga0233414_101323612	3300028045	Seawater	LHDNITPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLVA
(restricted) Ga0233414_101503543	3300028045	Seawater	FITSAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLIARLIISGTLPDH
(restricted) Ga0233414_101731212	3300028045	Seawater	TPAIKYLNIVIPAKAGIQVGTGCRIKSGMTELDYLVARLI
(restricted) Ga0233414_102985561	3300028045	Seawater	YLDIVIPAKAGIQEGTGCRIKSGMTELDYLIARLIPSFF
(restricted) Ga0233414_103338881	3300028045	Seawater	YNIIPAIKYLNIVIPAKAGIQEGTGCRIKSGMTELDYLVARLIKDETKN
Ga0307380_104398541	3300031539	Soil	YVNIVIPAKAGIQVGTGCRIKSGMTQLPYLVAGLITAA

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F096380

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Geographical Distribution

Zoom:	Powered by OpenStreetMap