Metagenome Family F096309

Basic Information
Family ID	F096309
Family Type	Metagenome
Number of Sequences	104
Average Sequence Length	38 residues
Representative Sequence	MFDSLKLFSLTHVTSFGPIAPKSVDFRVLGVKTPLRA
Number of Associated Samples	23
Number of Associated Scaffolds	104

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	1.92 %
% of genes near scaffold ends (potentially truncated)	65.38 %
% of genes from short scaffolds (< 2000 bps)	79.81 %
Associated GOLD sequencing projects	23
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.24

Most Common Taxonomy
Group	Unclassified (75.962 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza (73.077 % of family members)
Environment Ontology (ENVO)	Unclassified (100.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Unclassified (85.577 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 20.00% β-sheet: 0.00% Coil/Unstructured: 80.00%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 104 Family Scaffolds
PF03641	Lysine_decarbox	12.50
PF00665	rve	3.85
PF02799	NMT_C	0.96
PF00385	Chromo	0.96
PF00078	RVT_1	0.96
PF03732	Retrotrans_gag	0.96
PF13976	gag_pre-integrs	0.96

COG ID	Name	Functional Category	% Frequency in 104 Family Scaffolds
COG1611	Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family	Nucleotide transport and metabolism [F]	12.50
COG2801	Transposase InsO and inactivated derivatives	Mobilome: prophages, transposons [X]	3.85
COG2826	Transposase and inactivated derivatives, IS30 family	Mobilome: prophages, transposons [X]	3.85
COG3316	Transposase (or an inactivated derivative), DDE domain	Mobilome: prophages, transposons [X]	3.85
COG4584	Transposase	Mobilome: prophages, transposons [X]	3.85

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.96 %
All Organisms	root	All Organisms	24.04 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.96 %
cellular organisms	root	All Organisms → cellular organisms	24.04 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.96 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	21.15 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	2.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.96 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	19.23 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.92 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.96 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	19.23 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1.92 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.96 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	16.35 %
Methylococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales	1.92 %
Bacilli	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.96 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	16.35 %
Methylococcaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae	1.92 %
Lactobacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.96 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	6.73 %
Methylomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas	1.92 %
Lactobacillaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.96 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	6.73 %
unclassified Methylomonas	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas	1.92 %
Weissella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.96 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	6.73 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1.92 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.96 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	6.73 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1.92 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.96 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	5.77 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1.92 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.96 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	5.77 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1.92 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.96 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	5.77 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1.92 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.96 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	5.77 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1.92 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.96 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	4.81 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1.92 %
asterids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids	0.96 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.96 %
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	2.88 %
rosids incertae sedis	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis	1.92 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1.92 %
Cornales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → Cornales	0.96 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.96 %
Malpighiales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales	2.88 %
Vitales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales	1.92 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1.92 %
Nyssaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → Cornales → Nyssaceae	0.96 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.96 %
Salicaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae	2.88 %
Vitaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae	1.92 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1.92 %
Nyssa	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → Cornales → Nyssaceae → Nyssa	0.96 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.96 %
Saliceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	2.88 %
Viteae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae	1.92 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1.92 %
Nyssa sinensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → Cornales → Nyssaceae → Nyssa → Nyssa sinensis	0.96 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.96 %
Populus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	2.88 %
Vitis	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis	1.92 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1.92 %
Nyssa sinensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → Cornales → Nyssaceae → Nyssa → Nyssa sinensis	0.96 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.96 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	1.92 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1.92 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	0.96 %
Populus alba	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	0.96 %
Nyssa sinensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → Cornales → Nyssaceae → Nyssa → Nyssa sinensis	0.96 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	0.96 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300028786\|Ga0307517_10065421	Not Available	3363	Open in IMG/M
3300028786\|Ga0307517_10212043	Not Available	1191	Open in IMG/M
3300028786\|Ga0307517_10364701	Not Available	778	Open in IMG/M
3300028786\|Ga0307517_10432998	Not Available	686	Open in IMG/M
3300028786\|Ga0307517_10584373	Not Available	552	Open in IMG/M
3300028794\|Ga0307515_10010852	Not Available	17379	Open in IMG/M
3300028794\|Ga0307515_10017081	All Organisms → cellular organisms → Eukaryota	13247	Open in IMG/M
3300028794\|Ga0307515_10018680	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	12521	Open in IMG/M
3300028794\|Ga0307515_10150557	Not Available	2434	Open in IMG/M
3300028794\|Ga0307515_10346898	Not Available	1133	Open in IMG/M
3300028794\|Ga0307515_10364025	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → Cornales → Nyssaceae → Nyssa → Nyssa sinensis	1085	Open in IMG/M
3300028794\|Ga0307515_10493611	Not Available	835	Open in IMG/M
3300028794\|Ga0307515_10569463	Not Available	743	Open in IMG/M
3300028794\|Ga0307515_10780562	Not Available	576	Open in IMG/M
3300028794\|Ga0307515_10876139	Not Available	526	Open in IMG/M
3300030521\|Ga0307511_10137111	Not Available	1452	Open in IMG/M
3300030521\|Ga0307511_10147406	Not Available	1362	Open in IMG/M
3300030521\|Ga0307511_10227614	Not Available	927	Open in IMG/M
3300030521\|Ga0307511_10378282	Not Available	593	Open in IMG/M
3300030521\|Ga0307511_10411975	Not Available	550	Open in IMG/M
3300030522\|Ga0307512_10054916	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	3147	Open in IMG/M
3300030522\|Ga0307512_10211629	Not Available	1029	Open in IMG/M
3300030522\|Ga0307512_10236492	Not Available	930	Open in IMG/M
3300030522\|Ga0307512_10276476	Not Available	807	Open in IMG/M
3300030522\|Ga0307512_10469836	Not Available	501	Open in IMG/M
3300031456\|Ga0307513_10133042	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	2428	Open in IMG/M
3300031456\|Ga0307513_10178847	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	1987	Open in IMG/M
3300031456\|Ga0307513_10336172	Not Available	1262	Open in IMG/M
3300031456\|Ga0307513_10348129	Not Available	1230	Open in IMG/M
3300031456\|Ga0307513_10364602	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1188	Open in IMG/M
3300031456\|Ga0307513_10445494	Not Available	1020	Open in IMG/M
3300031456\|Ga0307513_10476626	Not Available	968	Open in IMG/M
3300031456\|Ga0307513_10657918	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	754	Open in IMG/M
3300031507\|Ga0307509_10035549	Not Available	5467	Open in IMG/M
3300031507\|Ga0307509_10262384	Not Available	1501	Open in IMG/M
3300031507\|Ga0307509_10266087	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	1485	Open in IMG/M
3300031507\|Ga0307509_10580418	Not Available	795	Open in IMG/M
3300031616\|Ga0307508_10095224	Not Available	2568	Open in IMG/M
3300031616\|Ga0307508_10218427	Not Available	1506	Open in IMG/M
3300031616\|Ga0307508_10304479	Not Available	1186	Open in IMG/M
3300031616\|Ga0307508_10327218	Not Available	1124	Open in IMG/M
3300031616\|Ga0307508_10357252	Not Available	1052	Open in IMG/M
3300031616\|Ga0307508_10462018	Not Available	862	Open in IMG/M
3300031616\|Ga0307508_10507298	Not Available	801	Open in IMG/M
3300031616\|Ga0307508_10551647	Not Available	750	Open in IMG/M
3300031616\|Ga0307508_10790678	Not Available	565	Open in IMG/M
3300031649\|Ga0307514_10063656	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	2800	Open in IMG/M
3300031649\|Ga0307514_10174429	Not Available	1397	Open in IMG/M
3300031649\|Ga0307514_10378758	Not Available	736	Open in IMG/M
3300031649\|Ga0307514_10425037	Not Available	665	Open in IMG/M
3300031649\|Ga0307514_10445107	Not Available	639	Open in IMG/M
3300031649\|Ga0307514_10567838	Not Available	519	Open in IMG/M
3300031730\|Ga0307516_10048487	Not Available	4179	Open in IMG/M
3300031730\|Ga0307516_10183112	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	1826	Open in IMG/M
3300031730\|Ga0307516_10459549	Not Available	928	Open in IMG/M
3300031730\|Ga0307516_10535925	Not Available	824	Open in IMG/M
3300031730\|Ga0307516_10670934	Not Available	692	Open in IMG/M
3300031730\|Ga0307516_10731825	Not Available	647	Open in IMG/M
3300031730\|Ga0307516_10928072	Not Available	538	Open in IMG/M
3300031730\|Ga0307516_10939107	Not Available	533	Open in IMG/M
3300031730\|Ga0307516_10939253	Not Available	533	Open in IMG/M
3300031838\|Ga0307518_10003561	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	11198	Open in IMG/M
3300031838\|Ga0307518_10082730	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2316	Open in IMG/M
3300031838\|Ga0307518_10129989	Not Available	1771	Open in IMG/M
3300031838\|Ga0307518_10238174	Not Available	1170	Open in IMG/M
3300031838\|Ga0307518_10481295	Not Available	649	Open in IMG/M
3300031838\|Ga0307518_10556916	Not Available	565	Open in IMG/M
3300031838\|Ga0307518_10617886	Not Available	511	Open in IMG/M
3300032354\|Ga0325403_1003420	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	14481	Open in IMG/M
3300032354\|Ga0325403_1003905	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	13739	Open in IMG/M
3300032354\|Ga0325403_1023906	Not Available	5397	Open in IMG/M
3300032354\|Ga0325403_1091569	All Organisms → cellular organisms → Eukaryota	1364	Open in IMG/M
3300032354\|Ga0325403_1107087	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1062	Open in IMG/M
3300032354\|Ga0325403_1135289	Not Available	753	Open in IMG/M
3300032354\|Ga0325403_1139804	Not Available	710	Open in IMG/M
3300032354\|Ga0325403_1148791	Not Available	637	Open in IMG/M
3300032355\|Ga0325401_1208522	Not Available	627	Open in IMG/M
3300032355\|Ga0325401_1245302	Not Available	518	Open in IMG/M
3300032374\|Ga0325400_1180188	Not Available	1005	Open in IMG/M
3300032389\|Ga0325405_1069614	Not Available	1593	Open in IMG/M
3300032389\|Ga0325405_1073636	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1449	Open in IMG/M
3300032389\|Ga0325405_1074259	Not Available	1429	Open in IMG/M
3300032389\|Ga0325405_1089613	Not Available	1022	Open in IMG/M
3300032389\|Ga0325405_1102849	Not Available	815	Open in IMG/M
3300032390\|Ga0325404_1000799	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	32156	Open in IMG/M
3300032390\|Ga0325404_1054547	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2199	Open in IMG/M
3300032390\|Ga0325404_1056440	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	2094	Open in IMG/M
3300032740\|Ga0325411_1109526	Not Available	586	Open in IMG/M
3300032741\|Ga0325414_1112039	Not Available	803	Open in IMG/M
3300033160\|Ga0325402_1058106	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2459	Open in IMG/M
3300033160\|Ga0325402_1153371	Not Available	557	Open in IMG/M
3300033179\|Ga0307507_10313263	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	951	Open in IMG/M
3300033179\|Ga0307507_10370580	Not Available	830	Open in IMG/M
3300033179\|Ga0307507_10522324	Not Available	633	Open in IMG/M
3300033179\|Ga0307507_10524453	Not Available	631	Open in IMG/M
3300033179\|Ga0307507_10533302	Not Available	623	Open in IMG/M
3300033179\|Ga0307507_10563109	Not Available	597	Open in IMG/M
3300033180\|Ga0307510_10226811	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1374	Open in IMG/M
3300033180\|Ga0307510_10328571	Not Available	984	Open in IMG/M
3300034389\|Ga0325419_049124	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2493	Open in IMG/M
3300034389\|Ga0325419_100455	Not Available	827	Open in IMG/M
3300034389\|Ga0325419_107314	Not Available	760	Open in IMG/M
3300034688\|Ga0325420_128064	Not Available	751	Open in IMG/M
3300034901\|Ga0325409_104580	Not Available	765	Open in IMG/M

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.24
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.24
Powered by PDBe Molstar

Habitat	Taxonomy	Distribution
Roots	Host-Associated → Plants → Roots	73.08%
Wood	Host-Associated → Plants → Wood	22.12%
Phylloplane	Host-Associated → Plants → Phylloplane	4.81%

Habitat	Taxonomy	Distribution
Ectomycorrhiza	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza	73.08%
Xylem	Host-Associated → Plants → Wood → Unclassified → Unclassified → Xylem	22.12%
Leaf	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf	4.81%

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0307517_100654212	3300028786	Ectomycorrhiza	MFDSLKLFSLTYVTSVGPIAPKSVDFRVLGVKTPL
Ga0307517_102120432	3300028786	Ectomycorrhiza	MFDSLKLFSLTHVTSFGPIAPNSVDLRVLGVKTPIGA
Ga0307517_103647011	3300028786	Ectomycorrhiza	MFDSLKLFSSTHVTSVGPIAPKLVDFRVLGVKTPIQA
Ga0307517_104329981	3300028786	Ectomycorrhiza	XYVDSAMFDSLKFFSLTHVTSFVPIAPKLVDFRVLGIKTPLRA
Ga0307517_105843731	3300028786	Ectomycorrhiza	DSLKLFSLTHVTSFGPIASKSVDFRVLGVKTPLQA
Ga0307515_1001085218	3300028794	Ectomycorrhiza	MFDSLRLFSSTHVTSFGPIAPKIVGFRELGVKTTLRA
Ga0307515_100170811	3300028794	Ectomycorrhiza	MFDSLKLFSLTHVTNFGPIAPKSVDFRVLGVKTPLQTYEGLRILVK
Ga0307515_100186803	3300028794	Ectomycorrhiza	MFDSLKLFSSTHVTSIGPIAPKSVDFRVLGVKTPIQA
Ga0307515_101505571	3300028794	Ectomycorrhiza	VDSAMFDSLRLFSLTHVTSFGPIAPKSVDFRVLDVKTPLPA
Ga0307515_103468981	3300028794	Ectomycorrhiza	MFDSLKLFSSTHVTSVGPIAPKSVDFRVLGVKTPLQA
Ga0307515_103640251	3300028794	Ectomycorrhiza	YVDSAMFDSLKLFSLTHVTSVGPIAPKSVDFRVLGVKTPLRA
Ga0307515_104936112	3300028794	Ectomycorrhiza	MFDSLKLFFLTHVTSFGPIAPKSVDFKVLGVKIPLQA
Ga0307515_105694632	3300028794	Ectomycorrhiza	MFDSLKLFSSTHVTSVGPIAPKSIDFRVLGVKKPLQA
Ga0307515_107805621	3300028794	Ectomycorrhiza	MFDSVKLFSLIHVTRTEPIAPKSVDFRVLGVKTPLQGLIA
Ga0307515_108761392	3300028794	Ectomycorrhiza	MFDSLKLFSLTHVTSVGPIAPKSVDFRVLGVKTPLR
Ga0307511_101371111	3300030521	Ectomycorrhiza	MFDSLKLFSLTHVTSVGPIAPKSVDFRVLGVKTPLRA
Ga0307511_101474061	3300030521	Ectomycorrhiza	SAMFDSLKLFSLTHVTSTGTIALKSVDFRVLGVKTPLRA
Ga0307511_102276141	3300030521	Ectomycorrhiza	MFDSLKLFSSTYVTNVGPIAPKLVDLRVLGVKTPLQD
Ga0307511_103782821	3300030521	Ectomycorrhiza	DNAMFDSLKLFSLTHVTSIGPIAPKSVDFRVSGVKTPLQA
Ga0307511_104119751	3300030521	Ectomycorrhiza	DSLKHFSLTHVTSFGPIAPKSVDFRVFGVKTPLWA
Ga0307512_100549167	3300030522	Ectomycorrhiza	YRYKNVDSAMFDSLKLFSSTYVTSIGPTAFKLVDFRVLGVKTPLQT
Ga0307512_102116291	3300030522	Ectomycorrhiza	MFDSFKLFSLTHVTIFGPIAPKLVDFRVLGVKTPLQA
Ga0307512_102364922	3300030522	Ectomycorrhiza	MFDSLKLFSSTHVTSVGPIAPRSVDFRKLGVKTPLRA
Ga0307512_102764761	3300030522	Ectomycorrhiza	MFDSLKLFSLTHVTSFGPIAPKSVDLRVLGVKTPLSSLIA
Ga0307512_104698361	3300030522	Ectomycorrhiza	MFDFLKLFCPTYVTSFGPIALKLVDFRVLGVKTPLRA
Ga0307513_101330421	3300031456	Ectomycorrhiza	MFDSLKLFSLTHVPNTGPIAPKSVDFKVLGVKTPLQA
Ga0307513_101788471	3300031456	Ectomycorrhiza	DSAMFDSLKLFSLTHVTSTGPTAPKSVDFRVLGVKTSLQA
Ga0307513_103361721	3300031456	Ectomycorrhiza	MFDSLKLFSSTHVISTGPIAPKLIDFRVLGVKTPLQA
Ga0307513_103481292	3300031456	Ectomycorrhiza	DSAMFDFLKLFSLTHVTNFRPIAPKSVNVMVLGVKTPLWA
Ga0307513_103646021	3300031456	Ectomycorrhiza	SAMFDSLKLFSLTHVTSFGPIAPKSVDFRVLGVKTPLRA
Ga0307513_104454941	3300031456	Ectomycorrhiza	FDSLKLFSLTHVTSTEPIAPKSVDFRVLGVKTPIWA
Ga0307513_104766261	3300031456	Ectomycorrhiza	FDSLKLFSLTHVTSFGPIAPKSVDFRVLGVKTPLQA
Ga0307513_106579181	3300031456	Ectomycorrhiza	SAMFDSLKLFSLTHVTSFGPIASKSVDFRVLGVKTPLQA
Ga0307509_100355491	3300031507	Ectomycorrhiza	AMFDSFKLFSLTYVISFGPIASKSVNFRILGVKTPIQT
Ga0307509_102623841	3300031507	Ectomycorrhiza	DSAMFDSLKLFSLTHVTSFGPIAPKSVDFRVLGVKTPLRA
Ga0307509_102660871	3300031507	Ectomycorrhiza	DSAMFDSLKLFSLTHVTSFGPITPKSVDFRVLGVKTPLRA
Ga0307509_105804181	3300031507	Ectomycorrhiza	AMFDSLKLFSLTHVTSTGPIAPKSVDFRVLGVKTPLRA
Ga0307508_100952241	3300031616	Ectomycorrhiza	MFGSLKLFSSSHVTSVGPIAPKSVDFRVLGVKTPLQA
Ga0307508_102184271	3300031616	Ectomycorrhiza	MFDSLKLFSLTHVISTKPIAPKSVDFRVLGVKTPLWA
Ga0307508_103044792	3300031616	Ectomycorrhiza	MFDSLKLFSLTHVTSFGPIAPKSVDLRVLGVKTPSGLIA
Ga0307508_103272181	3300031616	Ectomycorrhiza	MFDFLKLFSSTHVTSFGPIAPKIVDFRVLGVKTTLQA
Ga0307508_103572522	3300031616	Ectomycorrhiza	DSAMFDSLKLFSLTHVTSFGPIAPKLVDFRVLGVKTPLRA
Ga0307508_104620181	3300031616	Ectomycorrhiza	SAMFDSLKLFSLTHVTSFGPIAPKLVDFRVLGVKTPLQA
Ga0307508_105072981	3300031616	Ectomycorrhiza	LYVDSAMFDSLKLFSLTHVTSTGPIASKSVDFRVLGVKTPLRA
Ga0307508_105516471	3300031616	Ectomycorrhiza	MFDSLKLFSLTHVTSFGLITPKSVDFRVLGVKTPLR
Ga0307508_107906782	3300031616	Ectomycorrhiza	MFDSLKLFSLTHVTSFEPIAPKSVDLRVLGVKTPLSSLIA
Ga0307514_100636562	3300031649	Ectomycorrhiza	MFDSLKLFSSTYVTSIGPIAPKSVDFRVLGVKTPIRA
Ga0307514_101744293	3300031649	Ectomycorrhiza	AMFDSLKLFSLTHVTSFEPIAPKSVDFRVLGVKTTLRA
Ga0307514_103787581	3300031649	Ectomycorrhiza	MFDSLKLFSLTHVTSFWPIAPKSVDFRVVGVKTPF
Ga0307514_104250371	3300031649	Ectomycorrhiza	FASLKLFSLTHVTSFGPIAPKSVDFRVLGVKTPLQA
Ga0307514_104451071	3300031649	Ectomycorrhiza	MFDSLKLFSSTHVTSVGPITPKSVDFRVLDVKTPLQA
Ga0307514_105678381	3300031649	Ectomycorrhiza	VDNAMFDSLKLFSLTHVTSFGPIAPKSVDFRVSGVKTPLRA
Ga0307516_100484871	3300031730	Ectomycorrhiza	MFGSLKLFSSSYLTSVGPIAPKSVDFRVLGVKTPLQA
Ga0307516_101831121	3300031730	Ectomycorrhiza	DSLKLFSLTHVTSTGPTAPKSVDFRVLGVKTPLQA
Ga0307516_104595491	3300031730	Ectomycorrhiza	VDSAMFDSLKLFSLTHVTSFGPIAPKSIDFRVLGVKTPLRA
Ga0307516_105359251	3300031730	Ectomycorrhiza	MFDSLKLFSLTHVTSIGPIAPKLVDFRVLGVKTPLQA
Ga0307516_106709341	3300031730	Ectomycorrhiza	MFDSLKLFSSTHVTGIGPITPKSVDFRVLDVKTPLQA
Ga0307516_107318252	3300031730	Ectomycorrhiza	MFDSLKLFSSTHVRSIGPIAPKLVDFRVLGVKTPLQA
Ga0307516_109280721	3300031730	Ectomycorrhiza	VDSAMFDSLKLFSLTHVTSFVPIAPNSVDFRVLGVKTPLRA
Ga0307516_109391071	3300031730	Ectomycorrhiza	AMFDSLKLFSLTHVISFGPIAPKSVDFRVLGVKTPLRA
Ga0307516_109392532	3300031730	Ectomycorrhiza	MFDHLKLFSLTHVTSIGPIAPKSVDFRVLGVKTPL
Ga0307518_100035618	3300031838	Ectomycorrhiza	MFDSLKLFSLTHVTSVGPIASKSVDFRVLGVKTPLEV
Ga0307518_100827301	3300031838	Ectomycorrhiza	DSAMFDSLKLFSLTHVTSTESIAPKSVDFRVLGVKTLLQA
Ga0307518_101299891	3300031838	Ectomycorrhiza	DSAMFDSLKLFSLTHVTSVGPIAPKSVDFRALGVKTPLRA
Ga0307518_102381742	3300031838	Ectomycorrhiza	MFDSLKLFSLTHVTSIGPIAPESVDFRVLGVKTPLQA
Ga0307518_104812951	3300031838	Ectomycorrhiza	MFDSLKLFSSAHVTSTGPIAPNSVDFRILGVKTPPQA
Ga0307518_105569161	3300031838	Ectomycorrhiza	FGSLKLFSSSHVTSVGPIAPKSVDFRVLGVKTPLQA
Ga0307518_106178862	3300031838	Ectomycorrhiza	YVDSAMFDSLKLFSSTHVTSVGPITPKSVDFRVLDVKTPLRA
Ga0325403_100342012	3300032354	Xylem	MFDSLKLFSLTHVSSFGPIAAKSVDFRVLGVKTPLQA
Ga0325403_10039053	3300032354	Xylem	MFDSLKLFSSTHVTSIGPIAPKSVDFKVLGVKTPIQA
Ga0325403_10239064	3300032354	Xylem	MFDSLKLFSLTHVTSFGPIAPKSVDFRVLGIKTPLGA
Ga0325403_10915693	3300032354	Xylem	MFDSLKLFSLTHVTSFGPIAPKLVDFRVLGVKTPLSGLIV
Ga0325403_11070871	3300032354	Xylem	AMFDSLKLFSLTHVTSFGPIAPKSVDFRVLGVKTPLWA
Ga0325403_11352891	3300032354	Xylem	RYXYIDSAMFDSLKLFSLTHVTSFGPIAPKSVDFRVLGVKTPLSGLIA
Ga0325403_11398041	3300032354	Xylem	DSLKLFSLTRVTSFGPIAPKSVDFRVLGVKTPLRA
Ga0325403_11487912	3300032354	Xylem	VDSAMFDSLKLFSLTHVTSFGPIAPKSVDFRVLGIKTSLRA
Ga0325401_12085221	3300032355	Xylem	MFDSLKLFSLTHVTSFGPIAPKSVDFRVLGIKTPL
Ga0325401_12453021	3300032355	Xylem	FDSLKLFSLTYVTNVGPIAPKSIDFKVLGVKTPFRA
Ga0325400_11801882	3300032374	Xylem	MFDSLKLFSLTHVTSFGPIAPKLVDFRVLGVKTPL
Ga0325405_10696142	3300032389	Xylem	MFDSLKLFSLTHVTSFEPIAPKLVDFRVLGVKTPLSGLIV
Ga0325405_10736361	3300032389	Xylem	SAMFDSLKLFSLTHVTSFGPIAPKSVDFRVLGVKTPL
Ga0325405_10742591	3300032389	Xylem	MFDSLKLFSLNHVTSFGPIAPKSVDFRVLGIKTPLRA
Ga0325405_10896131	3300032389	Xylem	MFDSLKLFSLTHVTSFGPIAPKSVDFRVLGVKTPLRA
Ga0325405_11028491	3300032389	Xylem	VDSAMVDSLKLFSLTHVTSFGPIAPKSVDFRVLGVKTLLRA
Ga0325404_10007992	3300032390	Xylem	MFDSLKLFSSTHVTSFEPITPKSVDFRVLGVETPLQA
Ga0325404_10545473	3300032390	Xylem	MFDSLKLFSLTHVTSFGPIAPKSVDFRVLGVKTPLSGLIA
Ga0325404_10564401	3300032390	Xylem	VDSAMFDSLKLFSLTHVTSFGPIAPKSVDFRVLGIKTPLRA
Ga0325411_11095261	3300032740	Xylem	MFDSLKLFSLTHVTSFGPIAPKSVDFRVLGIKTPLRA
Ga0325414_11120391	3300032741	Leaf	YXYVDSAMFDSLKLFSLTHVTSFGPIAPKSVDFRVLGVKTPLQA
Ga0325402_10581066	3300033160	Xylem	NAMFDFLKLLSLTHVTSFGPLAPKSVYFRVLGVKTPLRA
Ga0325402_11533711	3300033160	Xylem	FNSLKLFSLSHVTSVWPISPKSVDFRVLGVKTPLQA
Ga0307507_103132631	3300033179	Ectomycorrhiza	YXYVDSAMFDSLKLFSSTHVTSVGPIAPKSVDFRVLGVKTPLWA
Ga0307507_103705801	3300033179	Ectomycorrhiza	MFDSLKLFSLTHVTSFGPIAPKSVDLRVLGVKTPLTGLIA
Ga0307507_105223242	3300033179	Ectomycorrhiza	DSLKLFSSTHVTSVGPIAPKSVDFRVLGVKTPLWA
Ga0307507_105244531	3300033179	Ectomycorrhiza	MFNSLKLFSLTHITSSRPIAPKSVDFRVLGVKIPLQ
Ga0307507_105333022	3300033179	Ectomycorrhiza	MFDSLKLFSSTHVTSVGPIAPKSVDFRVLGVKTPL
Ga0307507_105631091	3300033179	Ectomycorrhiza	YVDSAMLDSLKLFSLTHVTSFGPIAPKSVDFRVLGVKTPLRA
Ga0307510_102268112	3300033180	Ectomycorrhiza	MFDSLKLFSLTHVTSFGPIAPKLVDFRVLGVKTPLQA
Ga0307510_103285711	3300033180	Ectomycorrhiza	MFDSLKLFSSTHVTSTGPIAPKSVDFRVLGVKTLLRA
Ga0325419_049124_2300_2413	3300034389	Leaf	MFDSLKLFSSTHVTSTDPIAPKSIDFRVLGVKTPLGA
Ga0325419_100455_2_130	3300034389	Leaf	YVDSAVFDSLKLFSLTHVTSFGPIAPKSVDFTVLGIKTPLRA
Ga0325419_107314_641_760	3300034389	Leaf	SAMFDSLKLFSLTHVTSFGPIALKSVDFRVLGVKTPLRA
Ga0325420_128064_607_750	3300034688	Leaf	YWYIDSAMFDSLKLFSLTHVTSFGPIAPKSVDFRVLGVKTPLSGLIA
Ga0325409_104580_1_126	3300034901	Xylem	VDSAMFDFLKLFSLTHVTSFGSIAPKSVDFRVLGIKTPLRT

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F096309

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Host-Associated	Open in IMG/M
3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Host-Associated	Open in IMG/M
3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Host-Associated	Open in IMG/M
3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Host-Associated	Open in IMG/M
3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Host-Associated	Open in IMG/M
3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Host-Associated	Open in IMG/M
3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Host-Associated	Open in IMG/M
3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Host-Associated	Open in IMG/M
3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Host-Associated	Open in IMG/M
3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Host-Associated	Open in IMG/M
3300032354	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R4	Host-Associated	Open in IMG/M
3300032355	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R2	Host-Associated	Open in IMG/M
3300032374	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R1	Host-Associated	Open in IMG/M
3300032389	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R2	Host-Associated	Open in IMG/M
3300032390	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R1	Host-Associated	Open in IMG/M
3300032740	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R4	Host-Associated	Open in IMG/M
3300032741	Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdKOR-R3	Host-Associated	Open in IMG/M
3300033160	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R3	Host-Associated	Open in IMG/M
3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Host-Associated	Open in IMG/M
3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Host-Associated	Open in IMG/M
3300034389	Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-Control-R4	Host-Associated	Open in IMG/M
3300034688	Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R1	Host-Associated	Open in IMG/M
3300034901	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R2	Host-Associated	Open in IMG/M

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign