Basic Information | |
---|---|
Family ID | F096291 |
Family Type | Metagenome |
Number of Sequences | 105 |
Average Sequence Length | 42 residues |
Representative Sequence | LLWSFVYLVVRNLFALVWLLGRPRRSKELEILVLRHELAILR |
Number of Associated Samples | 70 |
Number of Associated Scaffolds | 105 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 80.95 % |
% of genes near scaffold ends (potentially truncated) | 88.57 % |
% of genes from short scaffolds (< 2000 bps) | 85.71 % |
Associated GOLD sequencing projects | 70 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.37 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (80.952 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (48.571 % of family members) |
Environment Ontology (ENVO) | Unclassified (54.286 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (55.238 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.57% β-sheet: 0.00% Coil/Unstructured: 51.43% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 105 Family Scaffolds |
---|---|---|
PF13683 | rve_3 | 2.86 |
PF00211 | Guanylate_cyc | 1.90 |
PF12840 | HTH_20 | 1.90 |
PF00067 | p450 | 0.95 |
PF13411 | MerR_1 | 0.95 |
PF06348 | DUF1059 | 0.95 |
PF00109 | ketoacyl-synt | 0.95 |
PF08924 | DUF1906 | 0.95 |
PF12773 | DZR | 0.95 |
PF02535 | Zip | 0.95 |
PF13686 | DrsE_2 | 0.95 |
PF00990 | GGDEF | 0.95 |
PF07676 | PD40 | 0.95 |
PF00082 | Peptidase_S8 | 0.95 |
PF06723 | MreB_Mbl | 0.95 |
PF13649 | Methyltransf_25 | 0.95 |
PF07690 | MFS_1 | 0.95 |
PF13231 | PMT_2 | 0.95 |
PF04185 | Phosphoesterase | 0.95 |
PF01527 | HTH_Tnp_1 | 0.95 |
PF01915 | Glyco_hydro_3_C | 0.95 |
PF13407 | Peripla_BP_4 | 0.95 |
PF00078 | RVT_1 | 0.95 |
PF00072 | Response_reg | 0.95 |
PF13191 | AAA_16 | 0.95 |
PF05532 | CsbD | 0.95 |
PF00582 | Usp | 0.95 |
PF00196 | GerE | 0.95 |
PF07452 | CHRD | 0.95 |
PF01329 | Pterin_4a | 0.95 |
PF01734 | Patatin | 0.95 |
PF00583 | Acetyltransf_1 | 0.95 |
PF05974 | DUF892 | 0.95 |
PF01656 | CbiA | 0.95 |
PF00027 | cNMP_binding | 0.95 |
PF13565 | HTH_32 | 0.95 |
PF07705 | CARDB | 0.95 |
PF01609 | DDE_Tnp_1 | 0.95 |
PF00665 | rve | 0.95 |
PF13360 | PQQ_2 | 0.95 |
PF00872 | Transposase_mut | 0.95 |
PF00589 | Phage_integrase | 0.95 |
COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
---|---|---|---|
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.90 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.95 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.95 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.95 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.95 |
COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.95 |
COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.95 |
COG3685 | Ferritin-like metal-binding protein YciE | Inorganic ion transport and metabolism [P] | 0.95 |
COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.95 |
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.95 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.95 |
COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.95 |
COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.95 |
COG0428 | Zinc transporter ZupT | Inorganic ion transport and metabolism [P] | 0.95 |
COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.95 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.95 |
COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.95 |
COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.95 |
COG2154 | Pterin-4a-carbinolamine dehydratase | Coenzyme transport and metabolism [H] | 0.95 |
COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.95 |
COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.95 |
COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 0.95 |
COG1077 | Cell shape-determining ATPase MreB, actin-like superfamily | Cell cycle control, cell division, chromosome partitioning [D] | 0.95 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 80.95 % |
Unclassified | root | N/A | 19.05 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908045|KansclcFeb2_ConsensusfromContig116753 | Not Available | 624 | Open in IMG/M |
2140918007|ConsensusfromContig27119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis lurida | 641 | Open in IMG/M |
2140918024|NODE_299558_length_631_cov_8.049129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis mediterranei | 681 | Open in IMG/M |
3300000955|JGI1027J12803_103456202 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300000956|JGI10216J12902_102985158 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
3300000956|JGI10216J12902_112769086 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
3300001532|A20PFW1_1716266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis balhimycina | 557 | Open in IMG/M |
3300001535|A3PFW1_10281288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta | 1494 | Open in IMG/M |
3300001536|A1565W1_10754713 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300001536|A1565W1_10963493 | Not Available | 1093 | Open in IMG/M |
3300001537|A2065W1_11027400 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
3300005471|Ga0070698_100303530 | All Organisms → cellular organisms → Bacteria | 1527 | Open in IMG/M |
3300005538|Ga0070731_10020164 | All Organisms → cellular organisms → Bacteria | 4627 | Open in IMG/M |
3300005561|Ga0066699_10313680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1118 | Open in IMG/M |
3300005569|Ga0066705_10178187 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
3300005598|Ga0066706_11205992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. PRh5 | 575 | Open in IMG/M |
3300005947|Ga0066794_10100660 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
3300006852|Ga0075433_10718667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 874 | Open in IMG/M |
3300006854|Ga0075425_100228337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2142 | Open in IMG/M |
3300006865|Ga0073934_10249306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1167 | Open in IMG/M |
3300009090|Ga0099827_10195650 | Not Available | 1679 | Open in IMG/M |
3300009101|Ga0105247_10727360 | Not Available | 750 | Open in IMG/M |
3300009137|Ga0066709_101281005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1076 | Open in IMG/M |
3300009137|Ga0066709_103328894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 584 | Open in IMG/M |
3300009817|Ga0105062_1058988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 714 | Open in IMG/M |
3300009840|Ga0126313_10238495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1407 | Open in IMG/M |
3300010040|Ga0126308_10475504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 842 | Open in IMG/M |
3300010040|Ga0126308_11350518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 506 | Open in IMG/M |
3300010041|Ga0126312_10975139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 620 | Open in IMG/M |
3300010042|Ga0126314_11010473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 617 | Open in IMG/M |
3300010301|Ga0134070_10365974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 562 | Open in IMG/M |
3300011271|Ga0137393_10955958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 730 | Open in IMG/M |
3300011991|Ga0120153_1057774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 693 | Open in IMG/M |
3300011994|Ga0120157_1018961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1684 | Open in IMG/M |
3300011997|Ga0120162_1036440 | Not Available | 1312 | Open in IMG/M |
3300012011|Ga0120152_1159618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 590 | Open in IMG/M |
3300012014|Ga0120159_1035326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1685 | Open in IMG/M |
3300012096|Ga0137389_11351463 | Not Available | 607 | Open in IMG/M |
3300012198|Ga0137364_11134891 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300012201|Ga0137365_10354649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1084 | Open in IMG/M |
3300012201|Ga0137365_10660091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 765 | Open in IMG/M |
3300012201|Ga0137365_10709532 | Not Available | 735 | Open in IMG/M |
3300012204|Ga0137374_10086601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3010 | Open in IMG/M |
3300012204|Ga0137374_10108068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2599 | Open in IMG/M |
3300012204|Ga0137374_10136787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2218 | Open in IMG/M |
3300012204|Ga0137374_10197867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1735 | Open in IMG/M |
3300012204|Ga0137374_10425117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1049 | Open in IMG/M |
3300012204|Ga0137374_10670846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 782 | Open in IMG/M |
3300012204|Ga0137374_11019612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 596 | Open in IMG/M |
3300012206|Ga0137380_10550909 | Not Available | 1012 | Open in IMG/M |
3300012206|Ga0137380_11324429 | Not Available | 605 | Open in IMG/M |
3300012208|Ga0137376_11626905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 537 | Open in IMG/M |
3300012209|Ga0137379_11358976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 615 | Open in IMG/M |
3300012209|Ga0137379_11714182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 525 | Open in IMG/M |
3300012209|Ga0137379_11720731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 523 | Open in IMG/M |
3300012210|Ga0137378_10721268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 908 | Open in IMG/M |
3300012210|Ga0137378_11826636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 511 | Open in IMG/M |
3300012211|Ga0137377_11015567 | Not Available | 760 | Open in IMG/M |
3300012349|Ga0137387_11110505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 563 | Open in IMG/M |
3300012350|Ga0137372_10128557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis lexingtonensis | 2091 | Open in IMG/M |
3300012350|Ga0137372_10137413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2008 | Open in IMG/M |
3300012350|Ga0137372_10824151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 664 | Open in IMG/M |
3300012350|Ga0137372_11217239 | Not Available | 507 | Open in IMG/M |
3300012351|Ga0137386_11212201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 527 | Open in IMG/M |
3300012353|Ga0137367_10191735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1483 | Open in IMG/M |
3300012353|Ga0137367_10234495 | Not Available | 1322 | Open in IMG/M |
3300012353|Ga0137367_10239229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1307 | Open in IMG/M |
3300012354|Ga0137366_10555285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 826 | Open in IMG/M |
3300012354|Ga0137366_10602559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 788 | Open in IMG/M |
3300012355|Ga0137369_10044662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3931 | Open in IMG/M |
3300012355|Ga0137369_10053959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3499 | Open in IMG/M |
3300012355|Ga0137369_10180046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1653 | Open in IMG/M |
3300012355|Ga0137369_10188718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1604 | Open in IMG/M |
3300012355|Ga0137369_10301598 | Not Available | 1188 | Open in IMG/M |
3300012356|Ga0137371_10780460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 729 | Open in IMG/M |
3300012358|Ga0137368_10063562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 3034 | Open in IMG/M |
3300012358|Ga0137368_10877994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 548 | Open in IMG/M |
3300012359|Ga0137385_10228265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1618 | Open in IMG/M |
3300012360|Ga0137375_10092152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3118 | Open in IMG/M |
3300012360|Ga0137375_10236628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1697 | Open in IMG/M |
3300012360|Ga0137375_10319503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1394 | Open in IMG/M |
3300012360|Ga0137375_10672723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 850 | Open in IMG/M |
3300012360|Ga0137375_11034664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 643 | Open in IMG/M |
3300012360|Ga0137375_11360214 | Not Available | 532 | Open in IMG/M |
3300012532|Ga0137373_10083781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae | 2832 | Open in IMG/M |
3300012532|Ga0137373_10809560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 692 | Open in IMG/M |
3300012915|Ga0157302_10146307 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
3300012976|Ga0134076_10486002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 562 | Open in IMG/M |
3300013768|Ga0120155_1114401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 747 | Open in IMG/M |
3300014031|Ga0120173_1042126 | Not Available | 658 | Open in IMG/M |
3300014157|Ga0134078_10609800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter | 524 | Open in IMG/M |
3300014827|Ga0120171_1027512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2052 | Open in IMG/M |
3300015359|Ga0134085_10579611 | Not Available | 520 | Open in IMG/M |
3300015373|Ga0132257_103393799 | Not Available | 580 | Open in IMG/M |
3300015373|Ga0132257_103810293 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 549 | Open in IMG/M |
3300018061|Ga0184619_10040487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2000 | Open in IMG/M |
3300018429|Ga0190272_10935527 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
3300022756|Ga0222622_11171184 | Not Available | 566 | Open in IMG/M |
3300025457|Ga0208850_1050413 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300026272|Ga0209913_1000654 | All Organisms → cellular organisms → Bacteria | 26452 | Open in IMG/M |
3300026307|Ga0209469_1134160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 565 | Open in IMG/M |
3300027056|Ga0209879_1069362 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300027561|Ga0209887_1056954 | Not Available | 832 | Open in IMG/M |
3300027561|Ga0209887_1069299 | Not Available | 737 | Open in IMG/M |
3300032002|Ga0307416_100334476 | All Organisms → cellular organisms → Bacteria | 1524 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 48.57% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 12.38% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.62% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 4.76% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.81% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 3.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.90% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 1.90% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.90% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.90% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.90% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.90% |
Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.95% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.95% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.95% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.95% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.95% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.95% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.95% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.95% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
2140918007 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all | Environmental | Open in IMG/M |
2140918024 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_all | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001532 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-PF 12A)- 1 week illumina | Environmental | Open in IMG/M |
3300001535 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illumina | Environmental | Open in IMG/M |
3300001536 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina | Environmental | Open in IMG/M |
3300001537 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illumina | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005947 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300011991 | Permafrost microbial communities from Nunavut, Canada - A34_65cm_12M | Environmental | Open in IMG/M |
3300011994 | Permafrost microbial communities from Nunavut, Canada - A7_65cm_12M | Environmental | Open in IMG/M |
3300011997 | Permafrost microbial communities from Nunavut, Canada - A15_80cm_18M | Environmental | Open in IMG/M |
3300012011 | Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M | Environmental | Open in IMG/M |
3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300013768 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0M | Environmental | Open in IMG/M |
3300014031 | Permafrost microbial communities from Nunavut, Canada - A35_80cm_0.25M | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014827 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_18M | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025457 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
3300026272 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil leachate replicate DNA2013-203 (SPAdes) | Environmental | Open in IMG/M |
3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
3300027056 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027561 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
KansclcFeb2_12348330 | 2124908045 | Soil | LVEEGCLLWSFAYLAVRNLFALVWLLARPRRSKELEILVLR |
A_all_C_00077660 | 2140918007 | Soil | LLWSLAYLVVRNLFALVWLLGRQRGSKELEILVLRHELAVLR |
B_all_v_01754740 | 2140918024 | Soil | LLWSLAYLVVRNLFALVWLLGRQRGSKELEILVLRHELAVLRR |
JGI1027J12803_1034562023 | 3300000955 | Soil | LLWSFAYLVVRNLFALVWLLARPRRSKELEILVLRHELAMLR |
JGI10216J12902_1029851581 | 3300000956 | Soil | VVWSFFYLSVRSLFALALLLGRSDRSKDVEILVLR |
JGI10216J12902_1127690861 | 3300000956 | Soil | LLWSLVYLVVRNLFALVWLLGRRRRSKELEILVLRHELAI |
A20PFW1_17162661 | 3300001532 | Permafrost | LLWSFAYVVVRGLLSLVVLFGRSSGSNELEILVLRHELA |
A3PFW1_102812884 | 3300001535 | Permafrost | LLWSFAYLTVRSLFALVLLTGRSRRSKELEILVLRHELAVLRRQS |
A1565W1_107547132 | 3300001536 | Permafrost | LLWSFVYLVVRNLFALVWLLARPRRSKELEILALRHE |
A1565W1_109634931 | 3300001536 | Permafrost | VFWSLAYLVVRRLFEAMMLCCRSPRSKELEILVLRHELSILRRH |
A2065W1_110274003 | 3300001537 | Permafrost | LLWSFVYLVVRNLFALVWLLGRPRRSLELEILVLRHELEIFRR |
Ga0070698_1003035303 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LLWSFAYLAVRNLFALVWLLARPRRSNELEILVLRHELAMLRR* |
Ga0070731_100201641 | 3300005538 | Surface Soil | LLWALVYLVVRSLFALVFLAGRSGPSKELEILVLR |
Ga0066699_103136801 | 3300005561 | Soil | LLWSLVYLVVRNLRSLVWLLARPRRSRELEILVLRHEL |
Ga0066705_101781871 | 3300005569 | Soil | LLWSFLYLVVRNLFALVWLLGRPRRSKELEILVLRHELAVLRRQ |
Ga0066706_112059921 | 3300005598 | Soil | LPWSFVYLVVRNLFALVWLLGRPRRSKELEILVLRHELAILRRQAS |
Ga0066794_101006602 | 3300005947 | Soil | LLWSFVYLVVRNLFALVWLLGRPRRSKELEILVLRHELAILR* |
Ga0075433_107186672 | 3300006852 | Populus Rhizosphere | LLWSFVYLVVRNLFALVWLLARPRRSKELEILVLRHELA |
Ga0075425_1002283371 | 3300006854 | Populus Rhizosphere | LFWSFVYLVVRNLFALVWLLARPRRSNELEIPVPRHELAVLRRQRARPKLPTLIAHC* |
Ga0073934_102493063 | 3300006865 | Hot Spring Sediment | VFWSFLYIAVRVFELAVLVARSERSKELEILVLRHELTILRRQAKRPP |
Ga0099827_101956501 | 3300009090 | Vadose Zone Soil | LLWSFAYLVVRNLFVLAYLSAWPRRSKELEILVLRHELAILRRQAR |
Ga0105247_107273601 | 3300009101 | Switchgrass Rhizosphere | VYLVARNLFALVWWLGRQRRSKELEILVLRHELAIL |
Ga0066709_1012810052 | 3300009137 | Grasslands Soil | LLWSFVYLVVRNLFALVLLLGRRRRSKELGILVLRHELA |
Ga0066709_1033288941 | 3300009137 | Grasslands Soil | LLWSFVYLGVRNLFALVWLLGRPRRSKELEILVVRHELAILRRQSAP |
Ga0105062_10589881 | 3300009817 | Groundwater Sand | LVWSFVYLVVRNLFALVWLLGRPRRSKELEILVLRHELAILRRQA |
Ga0126313_102384951 | 3300009840 | Serpentine Soil | VVEEGYLFWSFAYLVVRNLFALVWLLGRPRRSKELEILVLRHELAIL |
Ga0126308_104755042 | 3300010040 | Serpentine Soil | MYLVVRDLFALVWLLGRPRRSKELEILVLRHELSILRRRAFATAADAG* |
Ga0126308_113505182 | 3300010040 | Serpentine Soil | LLWSLVYLVVRNLFAFVWLRARPRRSKELEILVLRPELWILRRR |
Ga0126312_109751391 | 3300010041 | Serpentine Soil | LLWTFVYLMFRNLFALVWLLARPRRSKEFEILLLRHQLACAGMLAG* |
Ga0126314_110104732 | 3300010042 | Serpentine Soil | VAWSFLYLAVRNVFALIVLLGRTDRSNELETLVLRHELAV |
Ga0134070_103659741 | 3300010301 | Grasslands Soil | LLWSFLYLVVRNLFALVWLLGRRRRSKELEILVLRHKLAILRRQA |
Ga0137393_109559582 | 3300011271 | Vadose Zone Soil | VVEEDCLLWSVAYLGVRNLFALVWLLARPRRSKEL |
Ga0120153_10577742 | 3300011991 | Permafrost | LLWSFVYLVVRNLFALVWLLARPRRSKELEILVLRHELAILRRQ |
Ga0120157_10189611 | 3300011994 | Permafrost | VYLVVRNLFALVWLLGRPRRSKELEILVLRHELAIL |
Ga0120162_10364403 | 3300011997 | Permafrost | LLWSFAYLAVRNLFALVLLVGRSRRSKELEILVLRHELAGLR |
Ga0120152_11596182 | 3300012011 | Permafrost | LPSIEEGSLLWAFVYLVVRNLFALVWLLARPRRSKECEILLLRHELA |
Ga0120159_10353264 | 3300012014 | Permafrost | LLWSFVYLVVRNLFALVWLLGRPRRSKEMEILVLR |
Ga0137389_113514632 | 3300012096 | Vadose Zone Soil | LLWSCVYLVARNLFALVWLLARSRRSKELEIAVLRHELAVLRR |
Ga0137364_111348911 | 3300012198 | Vadose Zone Soil | LLWSFAYLVVRNLFALVWLVARPRRSKELEILVLRHELAM |
Ga0137365_103546492 | 3300012201 | Vadose Zone Soil | LFWSFAYLVARNRFALVWLLARPGRSKELEILVLRP |
Ga0137365_106600911 | 3300012201 | Vadose Zone Soil | VAEEGCLLWSFVYLIVRNLFALVWLVGRRRRSKELEIRVPRTHEEVWM* |
Ga0137365_107095323 | 3300012201 | Vadose Zone Soil | LLWSFAYVVVRGLLSLVVLFGRSSGSNELEILVLRHELAVLR |
Ga0137374_100866017 | 3300012204 | Vadose Zone Soil | VYLVVRNLFALVWLLGRPRGSKELEILVLRHELAVLRRQ |
Ga0137374_101080681 | 3300012204 | Vadose Zone Soil | MRNLFALVWLLGRPRGSKELEILVLRHELAVLRRQSARPRLT |
Ga0137374_101367871 | 3300012204 | Vadose Zone Soil | LLWSFVYLVVRNLFALVWLLGRPRRSKELEILVLRHELAILRRQALAA* |
Ga0137374_101978673 | 3300012204 | Vadose Zone Soil | LVLVEEGGCVVWSFVYLVVRNLFALVWLLGRPCRSKELEILVLRHE |
Ga0137374_104251172 | 3300012204 | Vadose Zone Soil | LLWSFAYLVVRNLFALVWLLGRPRRSKKLEILVLRH |
Ga0137374_106708462 | 3300012204 | Vadose Zone Soil | LLWSLVYLVVRNLFALVWLLGRPRRSKEMEILVLRHELAILRRQ |
Ga0137374_110196121 | 3300012204 | Vadose Zone Soil | LLWSFVYLVVRNLFALVWLLGRPRRSKELEILVLRHELAILRRQ |
Ga0137380_105509091 | 3300012206 | Vadose Zone Soil | LESIEGHLVWWFAYLAVHLFAFVVLFGRPRRSKELEILVL |
Ga0137380_113244291 | 3300012206 | Vadose Zone Soil | LLWSFAYLVVRNLFALVYLLTRPHRSKELEILVLR |
Ga0137376_116269052 | 3300012208 | Vadose Zone Soil | LLWSFVYLVVRNLFALVWLLGRPRRSKELEMLVLRHELAILGRQAAPSKP* |
Ga0137379_113589761 | 3300012209 | Vadose Zone Soil | VPWSKEGRLLWSLVYLVVRNLFALVWLLGQPRRSKELEILILRHELAI |
Ga0137379_117141822 | 3300012209 | Vadose Zone Soil | LLWSLVYLVVRNLFALVWLLGQPRRSKELEILILRHELAI |
Ga0137379_117207312 | 3300012209 | Vadose Zone Soil | LLWSFAYLVVRNLFALACLLARPRRSKELEILVLRRELAICIAGTR* |
Ga0137378_107212682 | 3300012210 | Vadose Zone Soil | LLWSFAYLVVRNLFALVCLLARQRRSKELEILVLRHELAILRRQARP |
Ga0137378_118266361 | 3300012210 | Vadose Zone Soil | LLWSFVYLVVRNLFALVWLLGRRRRSKELEILVLRHE |
Ga0137377_110155672 | 3300012211 | Vadose Zone Soil | LLWSFVYLIARNLFALVWLLARPRRSKEFEILLLRHELAVL |
Ga0137387_111105051 | 3300012349 | Vadose Zone Soil | LLWSFVYLVVRNLFALVWLLGRPRRSKEMEILVLRHE |
Ga0137372_101285571 | 3300012350 | Vadose Zone Soil | VQVVWSFFYLSVRNLFALVLLLGRSDRSKDVEILVLRH |
Ga0137372_101374132 | 3300012350 | Vadose Zone Soil | LRWSFVYLVARNLFALVVLFGRRRRSKEVEILVLRHELAVLTGRLLGRG* |
Ga0137372_108241511 | 3300012350 | Vadose Zone Soil | LLWSFVYLVVRNLFTLVWLLGRPRRSKELEILVLRH |
Ga0137372_112172391 | 3300012350 | Vadose Zone Soil | VVWSFFYLSVRNLFALVLLLGRSDRSKDVEILVLRH |
Ga0137386_112122012 | 3300012351 | Vadose Zone Soil | LLWSFMYLVVRNLFALGWLLGRPRRGQELEILVLR |
Ga0137367_101917351 | 3300012353 | Vadose Zone Soil | VLWSFAYLVVRRLFQLIVICCRSSGSKELEILVLRHELSIL |
Ga0137367_102344951 | 3300012353 | Vadose Zone Soil | VYLVVRNLFALVWLLGQSRRSKELEIRVPRTHEEVWM* |
Ga0137367_102392291 | 3300012353 | Vadose Zone Soil | MVEGGCLLWSFVYLVVRNLFTLVWLLGRPRRSKELEILVLRHQLAILRRQS |
Ga0137366_105552853 | 3300012354 | Vadose Zone Soil | LLWSFAYVVVRGLLSLVVLFGRSSGSNELEILVLRHE |
Ga0137366_106025592 | 3300012354 | Vadose Zone Soil | LLWSFVYLIVRNLFALVWLLARRRCSKELEILVLRQELAILRRQRS |
Ga0137369_100446621 | 3300012355 | Vadose Zone Soil | LIWSLAYLVVRNLFALVWLLARPRRSKELEILVLRHELAMLR |
Ga0137369_100539591 | 3300012355 | Vadose Zone Soil | LLWSFVYLVVRNLFALVWLLGRPRRSKELEILVLRHELAILRRQAS |
Ga0137369_101800463 | 3300012355 | Vadose Zone Soil | LLWSFVYLAVRTLFALVLLLAGSRRSKELEILLLRHELAILRRQTG |
Ga0137369_101887182 | 3300012355 | Vadose Zone Soil | LLWSFAYLVVRNLFALVWLLARPRRSKELEILVLRH |
Ga0137369_103015981 | 3300012355 | Vadose Zone Soil | VPSSREGSLLWSFVYLVVRNQFALMWLLARPRRSKELE |
Ga0137371_107804602 | 3300012356 | Vadose Zone Soil | LLWSFAYLVVRNLFALVWLLARPRRSKELEILVLRHELALLRRRARPPRL |
Ga0137368_100635624 | 3300012358 | Vadose Zone Soil | LLWSFAYLAVRNLFALVWLLARPRRSKELEILVLRHE |
Ga0137368_108779942 | 3300012358 | Vadose Zone Soil | LLWSFVYLVVRNLFALVWLLARPRRSKELEILVLRHE |
Ga0137385_102282651 | 3300012359 | Vadose Zone Soil | LVYLVVRNLFALVWLLGQPRRSKELEILILRHELAILRRQSS |
Ga0137375_100921521 | 3300012360 | Vadose Zone Soil | MYLVMRNLFALVWLLARPRRSKELEILVLRHELAVLRRQA |
Ga0137375_102366284 | 3300012360 | Vadose Zone Soil | LLWSFVYLVVRNLFALVWLLGRSRRSKELEILALRH |
Ga0137375_103195033 | 3300012360 | Vadose Zone Soil | VVEEGWLLWSFVSLVVRNLFALVWLLGRRRHRSKELEILVLRHELAI |
Ga0137375_106727232 | 3300012360 | Vadose Zone Soil | MYLVVRNLFALVWLLARPRRSKELEILVLRHELALLRR |
Ga0137375_110346641 | 3300012360 | Vadose Zone Soil | LLWSFAYLVVRNLFALACLSARPRRSKELEILVLRHELAIL |
Ga0137375_113602141 | 3300012360 | Vadose Zone Soil | LLWSLAYLVVRNLFALVCLLARPRRSRELEILVLRHELAILRRQARQK |
Ga0137373_100837814 | 3300012532 | Vadose Zone Soil | LLWSFAYLGVRNLFALVWLLARPRRSKELEILVLRHE |
Ga0137373_108095601 | 3300012532 | Vadose Zone Soil | LLWSFVYLVVRNLFALVWLLARPRRSKELEILVLRHELAVL |
Ga0157302_101463072 | 3300012915 | Soil | ASVIESEVQVVWSFFYLSVRNLFALVLLLGRSDRSKEVEILVLRHELLS* |
Ga0134076_104860021 | 3300012976 | Grasslands Soil | LLWSFVYLVARNLFALVWLLARPRRSKEREILVLRHELAVLRRRTRPPL |
Ga0120155_11144011 | 3300013768 | Permafrost | LVWSFVYLATRNLFALVLLLGRPGRSKEVEILVLRHE |
Ga0120173_10421261 | 3300014031 | Permafrost | LLWSFAYLAVRNLFALVLLVGRSRRSKELEILVLRHELAVLR |
Ga0134078_106098001 | 3300014157 | Grasslands Soil | MVEGGCLLWSLVYLVVRNLFALVWLLGRPRRSKEFEILVLRHEL |
Ga0120171_10275124 | 3300014827 | Permafrost | LFWSLVHPVVRNLFALVWLLGRPRRSKELEILVLRH |
Ga0134085_105796111 | 3300015359 | Grasslands Soil | VQVVWSFFYLSVRNLFALVLLLGCSDRSKDVEVLVLRHEL |
Ga0132257_1033937991 | 3300015373 | Arabidopsis Rhizosphere | LVRSFAYLVVRNLFALVWLLARRRRSKELELLLLRHEPAILRRQ |
Ga0132257_1038102931 | 3300015373 | Arabidopsis Rhizosphere | VYVVVREGRLLWSFIYLAARNLFAFVLLFVRRRRSKELEILV |
Ga0184619_100404873 | 3300018061 | Groundwater Sediment | VYLVVRNLFALVWLLGRPRRSKELEILILRHELAILRRQTSR |
Ga0190272_109355271 | 3300018429 | Soil | LLWSFVYLVVRNLFALVWLLARPRRSKELEILVLRHELAILR |
Ga0222622_111711841 | 3300022756 | Groundwater Sediment | VLWSLAYLVVRNLFALVWLLARPRRSNELEILVLRHELLMLR |
Ga0208850_10504131 | 3300025457 | Arctic Peat Soil | VLWSVAYLVVRRLFELMMLCCRSSGSKELEILVLRHELSILRR |
Ga0209913_10006547 | 3300026272 | Soil | LLWSFVYLVVRNLFALVWLLGRPRRSKELEILVLRHELAILR |
Ga0209469_11341601 | 3300026307 | Soil | VLWSFAYLVVRRLFQLIVICCRSSGSKELEILVLRHELSILR |
Ga0209879_10693621 | 3300027056 | Groundwater Sand | LLWSFAYLAIRNLFALVWLLTRSGRSKELEILVLRH |
Ga0209887_10569541 | 3300027561 | Groundwater Sand | LLWSFVYLMLRNLFALVWLLARPRRSKEFEILLLRHELAVLRRQ |
Ga0209887_10692992 | 3300027561 | Groundwater Sand | LLWTFVYLIVRNLFALVWLLARPRRSKEFEILLLRHELAVLR |
Ga0307416_1003344761 | 3300032002 | Rhizosphere | LLWSFVYLIGRNVFALIWLLARQRRSKEMELLLLRHELA |
⦗Top⦘ |