NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F096280

Metagenome / Metatranscriptome Family F096280

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F096280
Family Type Metagenome / Metatranscriptome
Number of Sequences 105
Average Sequence Length 40 residues
Representative Sequence HHESFEKQEEGWLVFWSRILDVMCMIEYNNLNRNSILKA
Number of Associated Samples 38
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 33
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (95.238 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere
(47.619 % of family members)
Environment Ontology (ENVO) Unclassified
(94.286 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(95.238 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 55.22%    β-sheet: 0.00%    Coil/Unstructured: 44.78%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.19 %
UnclassifiedrootN/A3.81 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2209111006|2214876340All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis583Open in IMG/M
3300000041|ARcpr5oldR_c010142All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis801Open in IMG/M
3300000041|ARcpr5oldR_c014126All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis688Open in IMG/M
3300000041|ARcpr5oldR_c024059All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis555Open in IMG/M
3300000043|ARcpr5yngRDRAFT_c019618Not Available571Open in IMG/M
3300000043|ARcpr5yngRDRAFT_c023184All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis529Open in IMG/M
3300003379|JGI26142J50222_102839All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis → Arabidopsis suecica514Open in IMG/M
3300005276|Ga0065717_1000495All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis992Open in IMG/M
3300005276|Ga0065717_1000771All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis582Open in IMG/M
3300005276|Ga0065717_1009569All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis644Open in IMG/M
3300005276|Ga0065717_1009679All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis643Open in IMG/M
3300005277|Ga0065716_1012887All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis → Arabidopsis suecica586Open in IMG/M
3300005718|Ga0068866_10461929All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis832Open in IMG/M
3300012473|Ga0157340_1016263All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis587Open in IMG/M
3300012475|Ga0157317_1016988All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis617Open in IMG/M
3300012477|Ga0157336_1040483All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis500Open in IMG/M
3300012480|Ga0157346_1022368All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis562Open in IMG/M
3300012482|Ga0157318_1014139All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis638Open in IMG/M
3300012482|Ga0157318_1019072All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis594Open in IMG/M
3300012482|Ga0157318_1029662All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis534Open in IMG/M
3300012483|Ga0157337_1039167All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis517Open in IMG/M
3300012485|Ga0157325_1032733All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis530Open in IMG/M
3300012488|Ga0157343_1017996Not Available614Open in IMG/M
3300012488|Ga0157343_1031017All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis539Open in IMG/M
3300012488|Ga0157343_1036581All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis518Open in IMG/M
3300012490|Ga0157322_1025026All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis602Open in IMG/M
3300012497|Ga0157319_1055075All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis504Open in IMG/M
3300012498|Ga0157345_1005846All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis965Open in IMG/M
3300012498|Ga0157345_1041156All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis556Open in IMG/M
3300012500|Ga0157314_1012310All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis767Open in IMG/M
3300012500|Ga0157314_1038426All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis568Open in IMG/M
3300012505|Ga0157339_1041533All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis579Open in IMG/M
3300012505|Ga0157339_1072002All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis500Open in IMG/M
3300012506|Ga0157324_1009850All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis797Open in IMG/M
3300012506|Ga0157324_1054314All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis530Open in IMG/M
3300012507|Ga0157342_1079353All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis514Open in IMG/M
3300012510|Ga0157316_1019461All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis728Open in IMG/M
3300012513|Ga0157326_1025752All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis753Open in IMG/M
3300012513|Ga0157326_1044282All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis634Open in IMG/M
3300012513|Ga0157326_1076714All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis540Open in IMG/M
3300013285|Ga0136642_1093314All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis780Open in IMG/M
3300013285|Ga0136642_1100749All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis744Open in IMG/M
3300015371|Ga0132258_12065845All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis1433Open in IMG/M
3300015373|Ga0132257_100728562All Organisms → Viruses → Predicted Viral1234Open in IMG/M
3300015373|Ga0132257_100902321All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis1108Open in IMG/M
3300015373|Ga0132257_101072207All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis1016Open in IMG/M
3300015373|Ga0132257_101078398All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis1013Open in IMG/M
3300015373|Ga0132257_101289714All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis927Open in IMG/M
3300015373|Ga0132257_101688889All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis812Open in IMG/M
3300015373|Ga0132257_101932421All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis760Open in IMG/M
3300015373|Ga0132257_102061819All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis736Open in IMG/M
3300015373|Ga0132257_102080950All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis733Open in IMG/M
3300015373|Ga0132257_102140233All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis723Open in IMG/M
3300015373|Ga0132257_102299216Not Available699Open in IMG/M
3300015373|Ga0132257_102550623All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis664Open in IMG/M
3300015373|Ga0132257_102555707All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis → Arabidopsis suecica664Open in IMG/M
3300015373|Ga0132257_102732743All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis643Open in IMG/M
3300015373|Ga0132257_102896839All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis625Open in IMG/M
3300015373|Ga0132257_102955395All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis619Open in IMG/M
3300015373|Ga0132257_103102598All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis605Open in IMG/M
3300015373|Ga0132257_103492468All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis572Open in IMG/M
3300015373|Ga0132257_103583364All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis565Open in IMG/M
3300015373|Ga0132257_103637557All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis561Open in IMG/M
3300015373|Ga0132257_103778658All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis551Open in IMG/M
3300015373|Ga0132257_104281130Not Available519Open in IMG/M
3300015373|Ga0132257_104601034All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis502Open in IMG/M
3300015374|Ga0132255_101162969All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis1161Open in IMG/M
3300015374|Ga0132255_102639810All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis768Open in IMG/M
3300015374|Ga0132255_102758017All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis751Open in IMG/M
3300015374|Ga0132255_103111537All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis708Open in IMG/M
3300015374|Ga0132255_103209628All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis697Open in IMG/M
3300015374|Ga0132255_103565531All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis662Open in IMG/M
3300015374|Ga0132255_103926749All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis631Open in IMG/M
3300015374|Ga0132255_104125731All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis616Open in IMG/M
3300015374|Ga0132255_104447862All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis594Open in IMG/M
3300015374|Ga0132255_104737737All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis576Open in IMG/M
3300015374|Ga0132255_105141623All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis554Open in IMG/M
3300015374|Ga0132255_105547952All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis534Open in IMG/M
3300015374|Ga0132255_105555617All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis → Arabidopsis thaliana533Open in IMG/M
3300015374|Ga0132255_105757849All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis524Open in IMG/M
3300015374|Ga0132255_105758546All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis524Open in IMG/M
3300020070|Ga0206356_11312661All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis → Arabidopsis suecica505Open in IMG/M
3300027252|Ga0209973_1007186All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis1238Open in IMG/M
3300027252|Ga0209973_1010834All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis1085Open in IMG/M
3300027252|Ga0209973_1012381All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis1037Open in IMG/M
3300027252|Ga0209973_1023133All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis838Open in IMG/M
3300027252|Ga0209973_1026550All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis798Open in IMG/M
3300027252|Ga0209973_1031991All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis745Open in IMG/M
3300027252|Ga0209973_1034274All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis726Open in IMG/M
3300027252|Ga0209973_1060517All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis582Open in IMG/M
3300027424|Ga0209984_1067697All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis532Open in IMG/M
3300027526|Ga0209968_1095858All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis539Open in IMG/M
3300027614|Ga0209970_1047391All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis → Arabidopsis suecica773Open in IMG/M
3300027614|Ga0209970_1076186All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis627Open in IMG/M
3300027717|Ga0209998_10095141All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis733Open in IMG/M
3300027717|Ga0209998_10148580All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis601Open in IMG/M
3300027717|Ga0209998_10175770All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis556Open in IMG/M
3300027876|Ga0209974_10176384All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis781Open in IMG/M
3300027876|Ga0209974_10180421All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis773Open in IMG/M
3300027876|Ga0209974_10206728All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis → Arabidopsis suecica727Open in IMG/M
3300027876|Ga0209974_10316903All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis599Open in IMG/M
3300027876|Ga0209974_10360682All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis → Arabidopsis suecica565Open in IMG/M
3300028261|Ga0256316_1061098All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis658Open in IMG/M
3300030545|Ga0210271_11049871All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis609Open in IMG/M
3300030741|Ga0265459_13056689All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis584Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere47.62%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere25.71%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere20.00%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.90%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.95%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.95%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2209111006Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0Host-AssociatedOpen in IMG/M
3300000041Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphereHost-AssociatedOpen in IMG/M
3300000043Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphereHost-AssociatedOpen in IMG/M
3300003379Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PMHost-AssociatedOpen in IMG/M
3300005276Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5Host-AssociatedOpen in IMG/M
3300005277Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300012473Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610Host-AssociatedOpen in IMG/M
3300012475Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610Host-AssociatedOpen in IMG/M
3300012477Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610Host-AssociatedOpen in IMG/M
3300012480Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610Host-AssociatedOpen in IMG/M
3300012482Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510Host-AssociatedOpen in IMG/M
3300012483Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610Host-AssociatedOpen in IMG/M
3300012485Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610Host-AssociatedOpen in IMG/M
3300012488Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610Host-AssociatedOpen in IMG/M
3300012490Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610Host-AssociatedOpen in IMG/M
3300012497Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510Host-AssociatedOpen in IMG/M
3300012498Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410Host-AssociatedOpen in IMG/M
3300012500Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610Host-AssociatedOpen in IMG/M
3300012505Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610Host-AssociatedOpen in IMG/M
3300012506Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610Host-AssociatedOpen in IMG/M
3300012507Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610Host-AssociatedOpen in IMG/M
3300012510Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610Host-AssociatedOpen in IMG/M
3300012513Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510Host-AssociatedOpen in IMG/M
3300013285Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31YEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300027252Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027424Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027526Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027614Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027717Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027876Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300028261Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030545Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO142-VCO033SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
22139274812209111006Arabidopsis RhizosphereLHHESFEKQEEGWLVFWSRI*LDLMCMIEYKNLNRNRILKA
ARcpr5oldR_01014213300000041Arabidopsis RhizosphereSFEKQEEGRLVFSSRI*LVVMCMIEYNTLNRNSILKA*
ARcpr5oldR_01412613300000041Arabidopsis RhizosphereHHESFEKQEEGWLVFWSRI*LDVMCMIEYNNLNRNSILKA*
ARcpr5oldR_02405913300000041Arabidopsis RhizosphereMECLHHESFEKQEEGWLVFWSRM*LDLMCMIEYKN
ARcpr5yngRDRAFT_01961813300000043Arabidopsis RhizosphereVRRYKDKDSYGLWLNHQSFEKQEEAWLVFWSRIXLDVMCMIEXKNLNXNLILKA*
ARcpr5yngRDRAFT_02318413300000043Arabidopsis RhizosphereWLHHESFEKQEEGWLVFWSQI*LDLMCMIEYKNLNRNCIL*
JGI26142J50222_10283913300003379Arabidopsis Thaliana RhizosphereVRRHKAKDSYRLWLQHEIFETQEEGWLVFWSRIXLDVMCMIVYKNLNRNPIL*
Ga0065717_100049513300005276Arabidopsis RhizosphereLHHESFEKQEEGWLVFRSRI*LDVMCMIEYKNLNHNPIL*
Ga0065717_100077113300005276Arabidopsis RhizosphereSYGLWLHHESFEKQEEGWLVFWSRI*LEVMGIFEYKNLNRNTILXA*
Ga0065717_100956913300005276Arabidopsis RhizosphereHHESFEKQEEGWLVFWSRILLDLMCMIEYKNLNRNRILQA*
Ga0065717_100967913300005276Arabidopsis RhizosphereLHHESFEKQEEGWLVFWSRI*LDVMCMIEYKNLNRNKIL*
Ga0065716_101288713300005277Arabidopsis RhizosphereLHHESFEKQEEGWLVFWSQI*LVVMSMIEYNNLNRNSILKA*
Ga0068866_1046192913300005718Miscanthus RhizosphereLHHESFEKQEEGWLVFWSRI*LVVMCMIEYNNLNRNPILKA*
Ga0157340_101626313300012473Arabidopsis RhizosphereLHHESFEKQEEGWLVFWSRI*LDVMCMIEYKNLNHNPIL*
Ga0157317_101698813300012475Arabidopsis RhizosphereHHESFEKQEEGWLVFWSRI*LDVVCMIEYKNLNRNPIL*
Ga0157336_104048313300012477Arabidopsis RhizosphereHESFEKQEEGWLVFQSRI*LDVMTMIEYKNLNRNPIIKA*
Ga0157346_102236823300012480Arabidopsis RhizosphereESFEKQEEGWLVFWSRI*HDVMCMIEYKNLNRNPIL*
Ga0157318_101413913300012482Arabidopsis RhizosphereESFEKQEEGWLVFWSRI*LVVMCMNEYNNLNRNSILKA*
Ga0157318_101907213300012482Arabidopsis RhizosphereESFEKQEEGWLVFWSRI*LDGMCMIEYKNLNRNRILNA*
Ga0157318_102966213300012482Arabidopsis RhizosphereFEKQEEGWLVFWSQI*LVVMCMNEYNNLNRNPMLKA*
Ga0157337_103916713300012483Arabidopsis RhizosphereGLWLHHESFEKQEEGWLVFWSQI*LDVMCMIEYKYLNRNRILKA*
Ga0157325_103273313300012485Arabidopsis RhizosphereESFEKQEQGWLVFWSRI*IHVMCMIEYNNLNRNMIL*
Ga0157343_101799613300012488Arabidopsis RhizosphereHESFEKQEEGWLVFWRRI*LDVMCMIDYKNLNRNRILKA*
Ga0157343_103101713300012488Arabidopsis RhizosphereESFEKQAEGWLVFWSRI*LDVMCMIEYKNLNRKPIL*
Ga0157343_103658113300012488Arabidopsis RhizosphereFEKQEEGWLVFWSRI*LDVMCMIEYKNLNRNPIL*
Ga0157322_102502613300012490Arabidopsis RhizosphereHHESIEKQEEG*LVFWSQI*LDVMCMIEYKNLNRNRILKA*
Ga0157319_105507513300012497Arabidopsis RhizosphereSFEKQEEDWLVFWSRI*LDVNCMIEYKNLNRNPIL*
Ga0157345_100584613300012498Arabidopsis RhizosphereKQEEGWLVFWSRI*LDVMCMIEYKNLNRNRILKA*
Ga0157345_104115613300012498Arabidopsis RhizosphereKDSYGLWLHHESFEKQEEGWLMFWSQICLDAMCMIEYKNLNRNPIF*
Ga0157314_101231013300012500Arabidopsis RhizosphereEKQEEGWLVFSSRI*LVVMCMIEYKNLNRNSILKA*
Ga0157314_103842613300012500Arabidopsis RhizosphereFEKQEEGWLVFWSRI*LDLMCMIEYKNLNRNRILKA*
Ga0157339_104153313300012505Arabidopsis RhizosphereSFEKQEEGWLVFSSRI*LVFMCMIEYKNLNRNSILKA*
Ga0157339_107200213300012505Arabidopsis RhizosphereHHESFDKQEEGWLVFWSRI*HYVMCMIEYKNLNRNPILKA*
Ga0157324_100985013300012506Arabidopsis RhizosphereFEKQEEGWLVFWSRI*LDVMCMIEYKNLNRNPILKA*
Ga0157324_105431413300012506Arabidopsis RhizosphereESFEKQEEGWLVFWSRI*HVVMCMTEYKNLNRNPILKA*
Ga0157342_107935313300012507Arabidopsis RhizosphereGLWLHNESYEKQEEGWLVFLRRI*LDVMCIIEYKNLNRNPILKA*
Ga0157316_101946113300012510Arabidopsis RhizosphereWLHHESFEKQEEGWLVFWSRI*LDLMCMIKYKNLNRNKILKT*
Ga0157326_102575213300012513Arabidopsis RhizosphereFEKQEKGWLVFWSRI*LDVMCMIEYKNLSRNPILKA*
Ga0157326_104428213300012513Arabidopsis RhizosphereESFEKQEEGWLVFWSRI*LDVMCMIEYKNLNRNPIL*
Ga0157326_107671413300012513Arabidopsis RhizosphereESFQKQEEGWLVFWSRI*LDVMCMIEYKNLNRNRILKA*
Ga0136642_109331413300013285FreshwaterYGLWLHHESFEKQEEGWLVFWSRI*LDVMCMIEYKNLNRNQILKA*
Ga0136642_110074923300013285FreshwaterLHHESFENQEEGWLVFWSRI*LDIMCIFEYKNLNRRILKA*
Ga0132258_1206584513300015371Arabidopsis RhizosphereLHHESFKKQEEGWLVFWSRI*LDVMCMIEYKNLNLNRILKA*
Ga0132257_10072856213300015373Arabidopsis RhizosphereHQSFEKQEEAWLGYRSQI*LYVMCMIEYKNLNCNWIFKA*
Ga0132257_10090232113300015373Arabidopsis RhizosphereRRHKAKDSYGLCLHHESFEKQEEGLLVFRSRI*LDVMCMIEYKNLNRNQILKV*
Ga0132257_10107220713300015373Arabidopsis RhizosphereWLHHESFEKQEEDWLVFWSRI*LVVMCMIEYNNLNRNLILQA*
Ga0132257_10107839813300015373Arabidopsis RhizosphereHQSFEKQEEAWLVFWNQI*LDVMCMIEFKNENRNWIFKAEVVFPC*
Ga0132257_10128971413300015373Arabidopsis RhizosphereWLHHESFEEQEEGWLVFWSQI*LDVMCKIEYNNLNRNQILKA*
Ga0132257_10168888913300015373Arabidopsis RhizosphereYQSFEKQEEAWLVFWSQI*VDVMCIIEYKNLNRNRILKD*
Ga0132257_10193242113300015373Arabidopsis RhizosphereFEKQEEGWLVFWSRI*LVVMCMIEYNNLNRNSILKAKVVYRC*
Ga0132257_10206181913300015373Arabidopsis RhizosphereLHHESFEKLEEGWLVFWSRI*LDVMCMIEYKNLNRNTILSA*
Ga0132257_10208095013300015373Arabidopsis RhizosphereLWLHHESFEKQEEGWLVFWSQI*LDVMCMIEYKNLNCNRILKA*
Ga0132257_10214023313300015373Arabidopsis RhizosphereGFWLHHESFEKQEEGWLVFWSRI*IDVMCMIEYKNLNHNPIL*
Ga0132257_10229921613300015373Arabidopsis RhizosphereHQSFKKQEEAWLVFWSRI*LDVMCMIEYKKLNRNQSLKA*
Ga0132257_10255062313300015373Arabidopsis RhizosphereHHESFEKQEEGWLVFWSRI*LDVMYIIEYKNLNRNRILKA*
Ga0132257_10255570713300015373Arabidopsis RhizosphereLHHESFEKLEEAWLVVWSLI*LDVMCMIEYNNLNRNSILKD*
Ga0132257_10273274313300015373Arabidopsis RhizosphereLHHESFEKQEEGWLVFWSRI*LVVMCIIEYKNLNNNTIL*
Ga0132257_10289683913300015373Arabidopsis RhizosphereESFEKQEEG*LVFWSRI*LDGMCMIKYKNLNRKRILKA*
Ga0132257_10295539513300015373Arabidopsis RhizosphereHHESCENQEEGWLVF*SQI*LDVMCMIEYNNLNRNRILKA*
Ga0132257_10310259813300015373Arabidopsis RhizosphereESFEKQDEGWLVFWSRI*LDVMCMIEYKNLNHNRIL*
Ga0132257_10349246813300015373Arabidopsis RhizosphereLHHESFEKQEEGWLVFWSRI*LDVMCMIEYKNLNHNLIL*
Ga0132257_10358336413300015373Arabidopsis RhizosphereESFEKQEEGWLVFWSRI*LDVMCMIEYNNINRNPILKA*
Ga0132257_10363755713300015373Arabidopsis RhizosphereFEKQEEGWLVFWSRI*LDVMCMIEYKNLNRNSIL*
Ga0132257_10377865813300015373Arabidopsis RhizosphereHESFEKQEEGWLVFWSRI*LHVMCMIEYNNLNRNPIL*
Ga0132257_10428113013300015373Arabidopsis RhizosphereEKQEEAWLVFWSRI*LDVMCMIEYKNLNYNLILKA*
Ga0132257_10460103413300015373Arabidopsis RhizosphereQHHESFEKQEEGWLVFWSRI*LDVMRMIEYNNFNRNQILKAKLVFPC*
Ga0132255_10116296913300015374Arabidopsis RhizosphereSFEKQEEAWLVFWSRI*LDAMCMIEYKNLNRNPSLKSKVVFPC*
Ga0132255_10263981013300015374Arabidopsis RhizosphereEKQEEGWLVFWSRI*LDVMCMIEYKNLNPNSILNA*
Ga0132255_10275801713300015374Arabidopsis RhizosphereSFEKQQEGWLVFWSQI*LDVMCMIEYKNLNRNPIL*
Ga0132255_10311153713300015374Arabidopsis RhizosphereIWLHHESFEKQEEGWLVFWSRI*LDVMCMIEYNNLNRNLILQA*
Ga0132255_10320962813300015374Arabidopsis RhizosphereLWLHHESFEKQEEGWLVFWS*I*LDVMCIIEYNNLNRNPILKA*
Ga0132255_10356553113300015374Arabidopsis RhizosphereFEKQEEA*LVFWSRI*LDVMCMIEYKNLNRNHILKP*
Ga0132255_10392674913300015374Arabidopsis RhizosphereQKTEEGWLVFWSRI*LDLMCMIKYKNLNRNKILKA*
Ga0132255_10412573113300015374Arabidopsis RhizosphereKAKDSYGL*LHHESFEKQEEGWLVFWSRI*LDVVCMIVYKNLNRNRILKA*
Ga0132255_10444786223300015374Arabidopsis RhizosphereHHESFEKQEEGWLVFWSRI*FDVMCMIEYKNLNRNRILKA*
Ga0132255_10473773713300015374Arabidopsis RhizosphereHESFEKQEEGWLVFWSRI*LVVMCMIEYNNLNPNSILKA*
Ga0132255_10514162313300015374Arabidopsis RhizosphereHHESFEKQEEGWLVFSSRI*LVVMCMIEYKNLNRNSILKALVVYPC*
Ga0132255_10554795213300015374Arabidopsis RhizosphereHHESFKKQEEGWLVFWSRI*LDVMCLIEYNNLNRNPIL*
Ga0132255_10555561713300015374Arabidopsis RhizosphereGVRIVFVRRHKAKDSYGL*LHHESFEKQEEGWLGFWSRISIDVMFMIEYKNLNRNRILKE
Ga0132255_10575784913300015374Arabidopsis RhizosphereLWLHHESFEKQEEGWLVFSSQI*LVAMCMIEYNNLNRNSILKA*
Ga0132255_10575854613300015374Arabidopsis RhizosphereSFDKQEEGWLVFWSRI*LDVMCIIEYKNLNRNTFL*
Ga0206356_1131266113300020070Corn, Switchgrass And Miscanthus RhizosphereFEKQEEGWLVFWSRIXLDVMCMIEYKNLNRNPILKA
Ga0209973_100718613300027252Arabidopsis Thaliana RhizosphereHESFKKQEEGWLVFWSRIXLDVMCMIEYKNLNRNPIL
Ga0209973_101083413300027252Arabidopsis Thaliana RhizosphereLWLHHESFEKQEEGWLVFWSRMXLDLMCMIEYKNLNRNMILKA
Ga0209973_101238113300027252Arabidopsis Thaliana RhizosphereSFQKLEEAWLVFWSRIXLDVMCMIEYKNLNRNRILKA
Ga0209973_102313313300027252Arabidopsis Thaliana RhizosphereDSYRLWLHHESFEKQEEGWLVFWSRMXLDLMCMIEYKNLNRNYIL
Ga0209973_102655013300027252Arabidopsis Thaliana RhizosphereWLHHESFEKQEEGWLVFSSRIXLGVMCMIEYNNLNRNSILKA
Ga0209973_103199113300027252Arabidopsis Thaliana RhizosphereGLWLHHESFEKQEEGWLVFWSRIXLDVMCMIEYNNLNRNPILKA
Ga0209973_103427413300027252Arabidopsis Thaliana RhizosphereSFEKQEEGWLVFWSRIXLVVMCMIEYNNLNRNSILKA
Ga0209973_106051713300027252Arabidopsis Thaliana RhizosphereHHESFEKQEEGWLVFWSRIXLDVMCMIENKNLNRILIL
Ga0209984_106769713300027424Arabidopsis Thaliana RhizosphereEKQEEGWLVFWSRIXLDVMCMIEYKNLNRNPIIKA
Ga0209968_109585813300027526Arabidopsis Thaliana RhizosphereESFEKQEEGWLVFSSRIXLVVMCMIEYNNLNRNTILKA
Ga0209970_104739113300027614Arabidopsis Thaliana RhizosphereHHETCEKQEEGWLVFWSRIXLDVMCMIEYKNLNRNRILKA
Ga0209970_107618613300027614Arabidopsis Thaliana RhizosphereMECLHHESFEKQEEGWLVFWSRMXLDLMCMIEYKN
Ga0209998_1009514113300027717Arabidopsis Thaliana RhizosphereHESFEKQEEGWLVFWSXIXLDVMCIIEYKNLNRNIIL
Ga0209998_1014858013300027717Arabidopsis Thaliana RhizosphereSFEKQKEGWLVFWSKIXLDLMCMIEYKDLNRNRILKA
Ga0209998_1017577013300027717Arabidopsis Thaliana RhizosphereSFEKQEEGWLVFWSRIXLDVMCMIEYKNLNRNTILKA
Ga0209974_1017638413300027876Arabidopsis Thaliana RhizosphereSFEKQEEGWLVFWSRIXLDVMCMIEYKNLNRNWILKA
Ga0209974_1018042123300027876Arabidopsis Thaliana RhizosphereLWLHHESFDKQEEGWLVFSSQIXLVVMCMIEYINLNHNSSLKT
Ga0209974_1020672813300027876Arabidopsis Thaliana RhizosphereKQEKAWLLFWSQICLDVMCMIEYKNSNRNWILKAQVVFPC
Ga0209974_1031690313300027876Arabidopsis Thaliana RhizosphereESFDKQEEGWLVFWSRIXLDVICMIEYKNLNRNKILKA
Ga0209974_1036068213300027876Arabidopsis Thaliana RhizosphereLHHESFEKQEEGWLVFWSRIXLDVVCMIEYKNLNRNPIL
Ga0256316_106109813300028261FreshwaterEKQEEGWLLFWSRIXLDLMCMIEYKNLNRNQILKA
Ga0210271_1104987113300030545SoilSYGLWLHHESFEKQEEGWLVFWSRILLDLMCMIEYKNLNRNRIL
Ga0265459_1305668913300030741SoilEKLEEGWLVFWSRIXLDVMCMIEYNNLNRNRILEA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.