| Basic Information | |
|---|---|
| Family ID | F096278 |
| Family Type | Metagenome |
| Number of Sequences | 105 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MAAPGNSPIAIAFEGISGTGSIPTPVLLAGMLRASEKVSDLIFSPG |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 95.24 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 86.67 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.571 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (12.381 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.952 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.762 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.03% β-sheet: 21.62% Coil/Unstructured: 51.35% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF13620 | CarboxypepD_reg | 15.24 |
| PF13432 | TPR_16 | 14.29 |
| PF13414 | TPR_11 | 4.76 |
| PF06508 | QueC | 4.76 |
| PF05635 | 23S_rRNA_IVP | 3.81 |
| PF13181 | TPR_8 | 3.81 |
| PF13424 | TPR_12 | 3.81 |
| PF07719 | TPR_2 | 1.90 |
| PF00515 | TPR_1 | 1.90 |
| PF12704 | MacB_PCD | 1.90 |
| PF01128 | IspD | 0.95 |
| PF04055 | Radical_SAM | 0.95 |
| PF00330 | Aconitase | 0.95 |
| PF01850 | PIN | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG0037 | tRNA(Ile)-lysidine synthase TilS/MesJ | Translation, ribosomal structure and biogenesis [J] | 4.76 |
| COG0137 | Argininosuccinate synthase | Amino acid transport and metabolism [E] | 4.76 |
| COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 4.76 |
| COG0301 | Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 4.76 |
| COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 4.76 |
| COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 4.76 |
| COG0603 | 7-cyano-7-deazaguanine synthase (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 4.76 |
| COG0780 | NADPH-dependent 7-cyano-7-deazaguanine reductase QueF, C-terminal domain, T-fold superfamily | Translation, ribosomal structure and biogenesis [J] | 4.76 |
| COG1606 | ATP-utilizing enzyme, PP-loop superfamily | General function prediction only [R] | 4.76 |
| COG0746 | Molybdopterin-guanine dinucleotide biosynthesis protein A | Coenzyme transport and metabolism [H] | 0.95 |
| COG1207 | Bifunctional protein GlmU, N-acetylglucosamine-1-phosphate-uridyltransferase/glucosamine-1-phosphate-acetyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.95 |
| COG1211 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase | Lipid transport and metabolism [I] | 0.95 |
| COG2068 | CTP:molybdopterin cytidylyltransferase MocA | Coenzyme transport and metabolism [H] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.57 % |
| Unclassified | root | N/A | 11.43 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10147757 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 890 | Open in IMG/M |
| 3300000567|JGI12270J11330_10289320 | Not Available | 513 | Open in IMG/M |
| 3300000574|JGI1357J11328_10092066 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 977 | Open in IMG/M |
| 3300001356|JGI12269J14319_10349124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 521 | Open in IMG/M |
| 3300001593|JGI12635J15846_10613033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 632 | Open in IMG/M |
| 3300001593|JGI12635J15846_10690164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 589 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100899266 | Not Available | 767 | Open in IMG/M |
| 3300005440|Ga0070705_100341590 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1088 | Open in IMG/M |
| 3300005536|Ga0070697_100281301 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1427 | Open in IMG/M |
| 3300005557|Ga0066704_10737412 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300005944|Ga0066788_10045707 | Not Available | 1024 | Open in IMG/M |
| 3300006059|Ga0075017_101182284 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300006162|Ga0075030_101575866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300006174|Ga0075014_100745488 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300006174|Ga0075014_100928233 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300006354|Ga0075021_10021599 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3605 | Open in IMG/M |
| 3300009088|Ga0099830_11836925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300009143|Ga0099792_10497261 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 763 | Open in IMG/M |
| 3300009523|Ga0116221_1067650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1621 | Open in IMG/M |
| 3300009523|Ga0116221_1164852 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 963 | Open in IMG/M |
| 3300009525|Ga0116220_10124295 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1101 | Open in IMG/M |
| 3300009525|Ga0116220_10611963 | Not Available | 502 | Open in IMG/M |
| 3300009618|Ga0116127_1126213 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300009624|Ga0116105_1007606 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2202 | Open in IMG/M |
| 3300009637|Ga0116118_1174097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300009638|Ga0116113_1036412 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1119 | Open in IMG/M |
| 3300009638|Ga0116113_1093796 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300009641|Ga0116120_1037348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1706 | Open in IMG/M |
| 3300009683|Ga0116224_10332740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 722 | Open in IMG/M |
| 3300009759|Ga0116101_1043597 | Not Available | 951 | Open in IMG/M |
| 3300009762|Ga0116130_1198684 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300009792|Ga0126374_11022730 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300009824|Ga0116219_10226180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1066 | Open in IMG/M |
| 3300010379|Ga0136449_103809427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300012189|Ga0137388_11145161 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
| 3300012189|Ga0137388_11685352 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300012200|Ga0137382_10129384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1695 | Open in IMG/M |
| 3300012353|Ga0137367_10628915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 750 | Open in IMG/M |
| 3300012361|Ga0137360_10588134 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 952 | Open in IMG/M |
| 3300012362|Ga0137361_11129998 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
| 3300012363|Ga0137390_11944262 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300012683|Ga0137398_10079644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2017 | Open in IMG/M |
| 3300012685|Ga0137397_10889005 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300014154|Ga0134075_10477564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300014199|Ga0181535_10558129 | Not Available | 659 | Open in IMG/M |
| 3300014494|Ga0182017_10057182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2593 | Open in IMG/M |
| 3300014838|Ga0182030_11261185 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300017822|Ga0187802_10048994 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1541 | Open in IMG/M |
| 3300017933|Ga0187801_10057803 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1419 | Open in IMG/M |
| 3300017933|Ga0187801_10189292 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 812 | Open in IMG/M |
| 3300017938|Ga0187854_10015064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4555 | Open in IMG/M |
| 3300017940|Ga0187853_10161583 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1067 | Open in IMG/M |
| 3300017940|Ga0187853_10462750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300017995|Ga0187816_10351175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300017998|Ga0187870_1072466 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1397 | Open in IMG/M |
| 3300018016|Ga0187880_1358926 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300018022|Ga0187864_10031010 | All Organisms → cellular organisms → Bacteria | 3163 | Open in IMG/M |
| 3300018033|Ga0187867_10298847 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 901 | Open in IMG/M |
| 3300018034|Ga0187863_10009974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6218 | Open in IMG/M |
| 3300018040|Ga0187862_10130592 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1712 | Open in IMG/M |
| 3300018043|Ga0187887_10895369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300018043|Ga0187887_10967161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300018057|Ga0187858_10306747 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1005 | Open in IMG/M |
| 3300018057|Ga0187858_10472812 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 770 | Open in IMG/M |
| 3300018058|Ga0187766_10715330 | Not Available | 693 | Open in IMG/M |
| 3300018090|Ga0187770_11446481 | Not Available | 559 | Open in IMG/M |
| 3300020581|Ga0210399_10101030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2359 | Open in IMG/M |
| 3300021168|Ga0210406_10840549 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| 3300021181|Ga0210388_11759523 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300021477|Ga0210398_10034648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4214 | Open in IMG/M |
| 3300022521|Ga0224541_1020145 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
| 3300023088|Ga0224555_1154984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300025475|Ga0208478_1067005 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300025498|Ga0208819_1020049 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1853 | Open in IMG/M |
| 3300025553|Ga0208080_1023557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2012 | Open in IMG/M |
| 3300025612|Ga0208691_1151817 | Not Available | 522 | Open in IMG/M |
| 3300025812|Ga0208457_1065521 | Not Available | 719 | Open in IMG/M |
| 3300025922|Ga0207646_10273680 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1526 | Open in IMG/M |
| 3300026480|Ga0257177_1016828 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1012 | Open in IMG/M |
| 3300026498|Ga0257156_1033296 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1045 | Open in IMG/M |
| 3300026499|Ga0257181_1048816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
| 3300027334|Ga0209529_1071333 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300027505|Ga0209218_1084469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
| 3300027610|Ga0209528_1088932 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300027645|Ga0209117_1034795 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1555 | Open in IMG/M |
| 3300027824|Ga0209040_10509019 | Not Available | 533 | Open in IMG/M |
| 3300027854|Ga0209517_10234044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1110 | Open in IMG/M |
| 3300027854|Ga0209517_10498956 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
| 3300027875|Ga0209283_10173845 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1430 | Open in IMG/M |
| 3300027879|Ga0209169_10198829 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1047 | Open in IMG/M |
| 3300027903|Ga0209488_10212290 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1457 | Open in IMG/M |
| 3300027911|Ga0209698_10086330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2652 | Open in IMG/M |
| 3300028649|Ga0302162_10073653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 780 | Open in IMG/M |
| 3300028678|Ga0302165_10005294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3941 | Open in IMG/M |
| 3300028759|Ga0302224_10322114 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300029907|Ga0311329_10266205 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1265 | Open in IMG/M |
| 3300030014|Ga0302175_10052831 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 882 | Open in IMG/M |
| 3300030114|Ga0311333_11483015 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300031258|Ga0302318_10119706 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1199 | Open in IMG/M |
| 3300031446|Ga0170820_14121920 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1036 | Open in IMG/M |
| 3300031708|Ga0310686_107287500 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1718 | Open in IMG/M |
| 3300031708|Ga0310686_111577584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7322 | Open in IMG/M |
| 3300032805|Ga0335078_11780934 | Not Available | 671 | Open in IMG/M |
| 3300032892|Ga0335081_10120042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3845 | Open in IMG/M |
| 3300034091|Ga0326724_0493541 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 12.38% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.38% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 11.43% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 10.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.67% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.67% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.71% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.81% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 3.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.90% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.90% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.90% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.90% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.90% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.95% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.95% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.95% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.95% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.95% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.95% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.95% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300000574 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009618 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300017998 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300022521 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24 | Environmental | Open in IMG/M |
| 3300023088 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34 | Environmental | Open in IMG/M |
| 3300025475 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025498 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025553 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025812 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027505 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028649 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_2 | Environmental | Open in IMG/M |
| 3300028678 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_2 | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030014 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_3 | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031258 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_101477571 | 3300000567 | Peatlands Soil | MAATGNSPIAIAFEGISGTDSIPTPVLLAGMLRTSEKVSDLMFSPG |
| JGI12270J11330_102893201 | 3300000567 | Peatlands Soil | MAAPGNSPIAVAFEGISGTGSIPTPVLLAGMLRASEKVSDLIFSPGR |
| JGI1357J11328_100920661 | 3300000574 | Groundwater | MAAPGSSPIAIAFEGMSGSGLVPTPVLLAGMLRASEKVSDLIFSP |
| JGI12269J14319_103491241 | 3300001356 | Peatlands Soil | MAAPGNSPIAIAFDGISGTDSIPTPVLLAGMLRASEKVSDLIFSPGR |
| JGI12635J15846_106130331 | 3300001593 | Forest Soil | MAAPGNSPISIAFEGISGTGSIPTSVLLAGMLRASEKVSDLIFSPGRPP |
| JGI12635J15846_106901641 | 3300001593 | Forest Soil | MAAPGNSPIAIAFEGISGTDSIPTTVLLAGMLRTSEKVSDLMFSPGRPPQVE |
| JGIcombinedJ26739_1008992661 | 3300002245 | Forest Soil | MAAPGNSPIAIAFEGLSGTGTGSIPTSALLAGMLRASEKVSDLI |
| Ga0070705_1003415901 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAPGTSPIAIAFEGVSGSGLVPTPVLLAGMLRASEKVSDLIFS |
| Ga0070697_1002813011 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MAAPGNSPIAIAFEGINGTGSIPTSVLLAGMLRASEKVRDLIFSPGR |
| Ga0066704_107374122 | 3300005557 | Soil | MAAPGNSPIAIAFEGISGTGSIPTSVLLAGMLRASEKVSDLIFSPG |
| Ga0066788_100457071 | 3300005944 | Soil | MAAPGVAPISISVEGFSGTGRAATPVLLGAMLRASEKVSDLIFSPG |
| Ga0075017_1011822842 | 3300006059 | Watersheds | MAAPGNSPIAIAFEGLSGSGTIPTPILLAGMLRASEKVSDLIFSP |
| Ga0075030_1015758661 | 3300006162 | Watersheds | MAAPGNSPIAIAFEGVSGTGSIPTPVLLAGMLRASEKVSDLIFSPG |
| Ga0075014_1007454882 | 3300006174 | Watersheds | MAAPGNSPIAIAFEGLSASGTIPTPVLLAGMLRASEKV |
| Ga0075014_1009282331 | 3300006174 | Watersheds | MAAPGNSPIAIAFEGLSGSGSIPTPVLLAGMLRASEKVSDL |
| Ga0075021_100215995 | 3300006354 | Watersheds | MAAPGNSPIAIAFEGLSGSGSIPTSVLLAGMLRASEK |
| Ga0099830_118369251 | 3300009088 | Vadose Zone Soil | MAAPGNSPIAITFEGISGTGSIPTSVLLAGMLRASEKVSDLIFSPGRPPQ |
| Ga0099792_104972611 | 3300009143 | Vadose Zone Soil | MAAPGNSPIAIAFEGISGTGSIPTSALLAGMLRASEKVSDLIFSPGRPP |
| Ga0116221_10676501 | 3300009523 | Peatlands Soil | MAAPGNSPIAIALEGISGTGLIPTSVLLAGMLRASEKVSDLIFSPGR |
| Ga0116221_11648522 | 3300009523 | Peatlands Soil | MAAPGNSPIAIAFDGISGTDSIPTPVLLAGMLRASEKVSDLIFSPGRPP |
| Ga0116220_101242951 | 3300009525 | Peatlands Soil | MQMAAPGNSPIAVAFEGISGTGSIPTPVLLAGMLRASEKV |
| Ga0116220_106119631 | 3300009525 | Peatlands Soil | MAAPGNSPIAIAFDGISGTDSIPTPVLLAGMFRASERVSDLTFWPAGPPRAE |
| Ga0116127_11262132 | 3300009618 | Peatland | MAAPGNSPIAIAFEGISGTGSIPTPVLLAGMLRASD |
| Ga0116105_10076061 | 3300009624 | Peatland | MAAPGNSPISIAFEGISSTDAIPTPVLLAGMLRASDKVSDLIFSP |
| Ga0116118_11740971 | 3300009637 | Peatland | MAATGNSPIAIAFEGVSGGDSIPTPVLLAGMLRTSEKVSDLMFSP |
| Ga0116113_10364121 | 3300009638 | Peatland | MAAPGSSPIVSGGTGRTIPTPVLLAGMLRASEKISDLIF |
| Ga0116113_10937962 | 3300009638 | Peatland | MAATGNSPIAIAFEGISGTDSIPTPVLLAGMLRTSEKVSDL |
| Ga0116120_10373481 | 3300009641 | Peatland | MAAPGNSPIAIAFEGIIATGSIPTPVLLAGMLRAAYKVSDLIF |
| Ga0116224_103327402 | 3300009683 | Peatlands Soil | MLMTGVYAMAAPGNSPIATAFEGISGTGSIPTPVLLAGMLRASEKVSDLIFSPGRPPQ |
| Ga0116101_10435971 | 3300009759 | Peatland | MAAPGSSSTAIAFDGIGGTDSIPTSVLLAGMLRVSEKVSDLIFSPG |
| Ga0116130_11986842 | 3300009762 | Peatland | VFEMAAPGSSSTAIAFDGIGGTDSIPTSVLLAGMLRVSEKVS |
| Ga0126374_110227301 | 3300009792 | Tropical Forest Soil | MAAPGSSPIAVTFEGVGGSGTIPTPVLLAGMLRASEKVSDLIF |
| Ga0116219_102261801 | 3300009824 | Peatlands Soil | MLMTGVYAMAAPGNSPIATAFEGISGTGSIPTPVLLAGMLRASEKVSDLIFSPG |
| Ga0136449_1038094271 | 3300010379 | Peatlands Soil | MQMAAPGNSPIAVAFEGISGTGSIPTPVLLAGMLRASEKVSD |
| Ga0137388_111451612 | 3300012189 | Vadose Zone Soil | MSAPGTSPIAIAFEGVSGSGLVPTPVLLAGMLRASEKVSDLIFSPGR |
| Ga0137388_116853521 | 3300012189 | Vadose Zone Soil | MAAPGNSPIAITFEGVSGTGSIPTSVLLAGMLRASEKVSDLIFSP |
| Ga0137382_101293841 | 3300012200 | Vadose Zone Soil | MAAPGSSPIAIAFEGVNGSGLIPTPVLLAGMLRASDKVSDLIFSPGR |
| Ga0137367_106289152 | 3300012353 | Vadose Zone Soil | MAAPGNSPIAIAFEGLSGSGSIPTPVLLAGMLRASEKVSDLIFSP |
| Ga0137360_105881342 | 3300012361 | Vadose Zone Soil | MAAPGNSPIAIAFEGISGTGSIPTPVLLAGMLRASEKVSDLTFSPGRPPQ |
| Ga0137361_111299982 | 3300012362 | Vadose Zone Soil | MAAPGSSPIAIALEGVSSAGQVPTPVLLAAMLRAS |
| Ga0137390_119442621 | 3300012363 | Vadose Zone Soil | MAAPGNSPIAIAFEGINGTGSIPTSVLLAGMLRASEKVSDLIFSP |
| Ga0137398_100796441 | 3300012683 | Vadose Zone Soil | MAAPGSSPIAIALEGVSSTGHVPTPMLFVNILAATEKVSDLI |
| Ga0137397_108890052 | 3300012685 | Vadose Zone Soil | MAAPGSSPIAIAFEGVAGSGLVPTPVLLSGMLRASE |
| Ga0134075_104775642 | 3300014154 | Grasslands Soil | MSAPGTSPIAIAFEGVSGSGLVPTPVLLAGMLRASEKVSDLIFSPG |
| Ga0181535_105581292 | 3300014199 | Bog | MAAPGNSPIGIAFEGVSGTGSIPTPVLLAGMLRASEKVSDLIFSPGRPP |
| Ga0182017_100571821 | 3300014494 | Fen | MAAPGNSPIAIAFEGISGTGSIPTSILLAGMLRASDKV |
| Ga0182030_112611851 | 3300014838 | Bog | MAAPGTSQIASAFEGISATDTIPTPVLLAGMLRTSEKVSDLMFSPGRPPQ |
| Ga0187802_100489942 | 3300017822 | Freshwater Sediment | MAAPGNSPIAIAFEGVHGTGAIPTSVLLAGMLRASEKVSDLIFSPGRP |
| Ga0187801_100578032 | 3300017933 | Freshwater Sediment | MAAPGNSPIAIAFEGISGTGSIPTPVLLAGMLRASEKVSDLIFSPGRP |
| Ga0187801_101892922 | 3300017933 | Freshwater Sediment | MAAPGNSPIAIAFEGLSGSGSIPTPVLLAGMLRGSEKVSDLIFSPGRPP |
| Ga0187854_100150641 | 3300017938 | Peatland | MAAPGNSPIAIAFEGISGTGSIPTPVLLAGMLRASEKVSDLI |
| Ga0187853_101615832 | 3300017940 | Peatland | MAAPGNSPIAIAFEGISGTGSIPTPVLLAGMLRASEKVS |
| Ga0187853_104627501 | 3300017940 | Peatland | MAAPGSASIAVSLEGASKAGSIPTPVLLAGMLRASEKVSDLI |
| Ga0187816_103511752 | 3300017995 | Freshwater Sediment | MAAPGNSPIAIAFEGISGTGSIPTPVLLAGMLRASEKVSDLIFSPG |
| Ga0187870_10724661 | 3300017998 | Peatland | MAAPGNSPIAIAFEGISATGSIPTPVLLAGMLRASDKVSDLIFSPGRP |
| Ga0187880_13589262 | 3300018016 | Peatland | MAAPGNSPIAIAFEGISGTDSIPTPVLLAGMLRTSEKVSDLMFSP |
| Ga0187864_100310105 | 3300018022 | Peatland | MAATGNSPIAIAFEGISGTGSIPTPVLLAGMLRASDKVSDLIFSP |
| Ga0187867_102988472 | 3300018033 | Peatland | MAATGNSPIAIAFEGISGTDSIPTPVLLAGMLRTSEKVS |
| Ga0187863_100099741 | 3300018034 | Peatland | MAAPGSSSTAIAFDGIGGTDSIPTSVLLAGMLRVSEKVSDLIFSP |
| Ga0187862_101305921 | 3300018040 | Peatland | MLMTGVHEMAAPGNSPIAIAFEGISETGSIPTPVLLAGMLRASEKVSDLIFSPG |
| Ga0187887_108953692 | 3300018043 | Peatland | MAAPGNSPIAIAFEGVSGTGSIPTSVLLAGMLRASEKVS |
| Ga0187887_109671611 | 3300018043 | Peatland | MAAPGNSPIAIGFDGLNGKDAIPTPGLLAGMLRASEKVSDLIFSPGRPPQV |
| Ga0187858_103067472 | 3300018057 | Peatland | MAAPGNSPIAIAFEGISGTGSIPTPVLLAGMLRASDKVSDLIFS |
| Ga0187858_104728122 | 3300018057 | Peatland | MAAPGNSPIAIAFEGISGTGSIPTPVLLAGMLRASDKVSDLIF |
| Ga0187766_107153303 | 3300018058 | Tropical Peatland | MAAPGNSPIAIALEGASGSELVPTPILLAGMLRASEKVSDLIFSPGRP |
| Ga0187770_114464811 | 3300018090 | Tropical Peatland | MAAPGNSPISIAFEGINGTASIPTSVLLAGMLRASDQVSDLIFSPGRPP |
| Ga0210399_101010303 | 3300020581 | Soil | MAAPGNSPISIAFDGISGTGSIPTSVLLAGMLRASEKVSD |
| Ga0210406_108405491 | 3300021168 | Soil | MAAPGNSPIAIAFEGISGTGSIPTSVLLAGMLRASEKVSDLI |
| Ga0210388_117595231 | 3300021181 | Soil | MAAPGNSPIAIAFEGISGTGAIPTSVLLAGMLRASE |
| Ga0210398_100346485 | 3300021477 | Soil | MAAPGNSPIAIAFEGLSGTGAIPTSVLLAGMLRASDK |
| Ga0224541_10201452 | 3300022521 | Soil | MAAPGNSPIAIAFEGINGTGSIPTSVLLAGMLRASEKVSDLIFSPGRPP |
| Ga0224555_11549841 | 3300023088 | Soil | MAAPGNSPIAIAFEGISGTGSIPTPVLLAGMLRASDKVSDLI |
| Ga0208478_10670051 | 3300025475 | Arctic Peat Soil | MAAPGNSPIAIAFEGISGTGSIPTPVLLAGMLRASEKVSDLIFSPGRPP |
| Ga0208819_10200491 | 3300025498 | Peatland | MAAPGNSPIAIAFEGISATGSIPTPVLLAGMLRAS |
| Ga0208080_10235571 | 3300025553 | Arctic Peat Soil | MAAPGNSPIAIAFEGISGTGSIPTSVLLAGMLRASE |
| Ga0208691_11518172 | 3300025612 | Peatland | MAATGNSPIAIAFEGISGTDSIPTPVLLAGMLRTSEKVSDLMFSPGRP |
| Ga0208457_10655211 | 3300025812 | Peatland | MAAPGNSPIAIAFEGISGTGSVPTPVLLAGMLRASEKVSDLI |
| Ga0207646_102736802 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MAAPGNSPIAIAFEGISGTGSIPTSVLLAGMLRASEKVSDLIF |
| Ga0257177_10168282 | 3300026480 | Soil | MAAPGNSPIAIAFEGINGTGSIPTSVLLAGMLRASEKVSDLIFSPG |
| Ga0257156_10332961 | 3300026498 | Soil | MAAPGSSPIAIAFEGVSGSGLIPTPVLLAGMLRASEKV |
| Ga0257181_10488161 | 3300026499 | Soil | MAAPGNSPIAIAFEGISGTGSIPTSVLLAGMLRASEKVSDLIFSPGRPPQ |
| Ga0209529_10713331 | 3300027334 | Forest Soil | MAAPGNSPIAIAFEGISSTDAIPTPVLLAGMLRASEKVSDLIFSPG |
| Ga0209218_10844691 | 3300027505 | Forest Soil | MAAPGNSTISIPFEGVTERGSMPTSVLLAGMLRSSLKVSDLIFSPN |
| Ga0209528_10889322 | 3300027610 | Forest Soil | MAAPGNSPIAITFEGISGTGSIPTPVLLAGMLRASEKVSDLIFSPGR |
| Ga0209117_10347951 | 3300027645 | Forest Soil | MAAPGNSPIAIAFDGISGTGSIPTPVLLAGMLRASEKV |
| Ga0209040_105090192 | 3300027824 | Bog Forest Soil | MAATGNSPIAIAFEGVSGTDSIPTPVLLAGMLRTSEKVSDLMF |
| Ga0209517_102340442 | 3300027854 | Peatlands Soil | MAATGNSPIAIAFEGISGTDSIPTPVLLAGMLRTSEKVSDLMFSPGRPP |
| Ga0209517_104989562 | 3300027854 | Peatlands Soil | MAAPGNSPIAIAFEGVSGTGSIPTPVLLAGMLRASEKVSDL |
| Ga0209283_101738451 | 3300027875 | Vadose Zone Soil | MAAPGNSPIAIAFEGINGTGSIPTSVLLAGMLRASEKV |
| Ga0209169_101988291 | 3300027879 | Soil | MAAPGNSPIAIAFEGISGTDSIPTTVLLAGMLRTSEKVSD |
| Ga0209488_102122901 | 3300027903 | Vadose Zone Soil | MAAPGSSPIAIALEGVSSAGQVPTPVLLAAMLRASEQVSD |
| Ga0209698_100863301 | 3300027911 | Watersheds | MAAPGNSPIAIAFDGISGTGSIPTSVLLAGMLRAS |
| Ga0302162_100736531 | 3300028649 | Fen | MAAPGNSPIAIAFEGVSGTGSIPTSVLLAGMLRASDKVSDLIFSPGRP |
| Ga0302165_100052941 | 3300028678 | Fen | MAAPGNSPIAIAFEGVSGTGSIPTSVLLAGMLRASDKVSDLIFSPG |
| Ga0302224_103221141 | 3300028759 | Palsa | MAAPGNSSVAIAFDGAGGLGSISTSVLLSGMLRSS |
| Ga0311329_102662052 | 3300029907 | Bog | MAAPGSSPIAIAFEGINGTGSISTSVLLAGMLRASEKVSD |
| Ga0302175_100528312 | 3300030014 | Fen | MAAPGNSPIAIAFEGVSGTGSIPTSVLLAGMLRASDK |
| Ga0311333_114830151 | 3300030114 | Fen | MAAPGNSPIAIAFEGISGTGSIPTQALLSGMLRASEK |
| Ga0302318_101197061 | 3300031258 | Bog | MAAPGSSPIAIAFEGINGTGSISTSVLLAGMLRAS |
| Ga0170820_141219201 | 3300031446 | Forest Soil | MAATGSSPIAINFEGISGTGAIPTAVLLGGMLRVSDK |
| Ga0310686_1072875001 | 3300031708 | Soil | MASPGNSTVSIPFGGVTSRGTIPTSVLLAGMLRTSQKVSDLIFSPNRPPQVEIHG |
| Ga0310686_1115775841 | 3300031708 | Soil | MAAPGNSPIAIAFEGLSGTGTGEIPTSVLLAGMLRASDKVSDL |
| Ga0335078_117809341 | 3300032805 | Soil | MAAPGNSTISVPFEGVTGRGTVPTSILLAAMLRTSQK |
| Ga0335081_101200425 | 3300032892 | Soil | MAAPGSSPAIFEGVNGTGSIPTPVLLSAMLRASEKVS |
| Ga0326724_0493541_470_628 | 3300034091 | Peat Soil | MPINGVYGMAAPGNSPIAIAFEGISGTGSIPTQQLLAGMLRASEKVSDLIFSP |
| ⦗Top⦘ |