| Basic Information | |
|---|---|
| Family ID | F096260 |
| Family Type | Metagenome |
| Number of Sequences | 105 |
| Average Sequence Length | 47 residues |
| Representative Sequence | RESWRYHFMLHQFVSNTPTALAKVEARKAGGMDAVKKEQGRS |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.95 % |
| % of genes near scaffold ends (potentially truncated) | 97.14 % |
| % of genes from short scaffolds (< 2000 bps) | 100.00 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (63.810 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (11.429 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.429 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (41.905 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.43% β-sheet: 0.00% Coil/Unstructured: 48.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF02515 | CoA_transf_3 | 94.29 |
| PF12172 | DUF35_N | 1.90 |
| PF11005 | DUF2844 | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 94.29 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 63.81 % |
| All Organisms | root | All Organisms | 36.19 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001397|JGI20177J14857_1034912 | Not Available | 557 | Open in IMG/M |
| 3300004479|Ga0062595_100817420 | Not Available | 771 | Open in IMG/M |
| 3300004479|Ga0062595_101967992 | Not Available | 563 | Open in IMG/M |
| 3300004480|Ga0062592_101919294 | Not Available | 583 | Open in IMG/M |
| 3300004643|Ga0062591_102037363 | Not Available | 593 | Open in IMG/M |
| 3300005093|Ga0062594_102482949 | Not Available | 569 | Open in IMG/M |
| 3300005334|Ga0068869_101493300 | Not Available | 600 | Open in IMG/M |
| 3300005365|Ga0070688_101534019 | Not Available | 543 | Open in IMG/M |
| 3300005406|Ga0070703_10148926 | Not Available | 877 | Open in IMG/M |
| 3300005436|Ga0070713_100825193 | Not Available | 890 | Open in IMG/M |
| 3300005529|Ga0070741_10719472 | Not Available | 879 | Open in IMG/M |
| 3300005552|Ga0066701_10508707 | Not Available | 745 | Open in IMG/M |
| 3300005559|Ga0066700_10228671 | Not Available | 1294 | Open in IMG/M |
| 3300005564|Ga0070664_102385336 | Not Available | 502 | Open in IMG/M |
| 3300005587|Ga0066654_10799850 | Not Available | 535 | Open in IMG/M |
| 3300005615|Ga0070702_101554818 | Not Available | 546 | Open in IMG/M |
| 3300005617|Ga0068859_102407567 | Not Available | 580 | Open in IMG/M |
| 3300005618|Ga0068864_102632936 | Not Available | 509 | Open in IMG/M |
| 3300005718|Ga0068866_10621228 | Not Available | 732 | Open in IMG/M |
| 3300005887|Ga0075292_1049439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 607 | Open in IMG/M |
| 3300006041|Ga0075023_100495057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26207 | 549 | Open in IMG/M |
| 3300006047|Ga0075024_100698818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26207 | 556 | Open in IMG/M |
| 3300006059|Ga0075017_100687196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26207 | 786 | Open in IMG/M |
| 3300006806|Ga0079220_10150406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26207 | 1283 | Open in IMG/M |
| 3300006845|Ga0075421_102394734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26207 | 553 | Open in IMG/M |
| 3300006871|Ga0075434_100915477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26207 | 892 | Open in IMG/M |
| 3300009093|Ga0105240_11618517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26207 | 677 | Open in IMG/M |
| 3300009101|Ga0105247_10639848 | Not Available | 793 | Open in IMG/M |
| 3300009137|Ga0066709_102225041 | Not Available | 755 | Open in IMG/M |
| 3300009156|Ga0111538_12441164 | Not Available | 656 | Open in IMG/M |
| 3300009156|Ga0111538_13119283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26207 | 578 | Open in IMG/M |
| 3300009174|Ga0105241_12050995 | Not Available | 564 | Open in IMG/M |
| 3300009176|Ga0105242_10326820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26207 | 1409 | Open in IMG/M |
| 3300009824|Ga0116219_10238029 | Not Available | 1035 | Open in IMG/M |
| 3300009873|Ga0131077_10522597 | Not Available | 1093 | Open in IMG/M |
| 3300010043|Ga0126380_11679543 | Not Available | 570 | Open in IMG/M |
| 3300010303|Ga0134082_10267551 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300010359|Ga0126376_12064478 | Not Available | 613 | Open in IMG/M |
| 3300010399|Ga0134127_13732586 | Not Available | 500 | Open in IMG/M |
| 3300010400|Ga0134122_12755893 | Not Available | 544 | Open in IMG/M |
| 3300012021|Ga0120192_10099891 | Not Available | 586 | Open in IMG/M |
| 3300012285|Ga0137370_10863785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium | 560 | Open in IMG/M |
| 3300012958|Ga0164299_11568778 | Not Available | 517 | Open in IMG/M |
| 3300012961|Ga0164302_10681290 | Not Available | 758 | Open in IMG/M |
| 3300012988|Ga0164306_11703835 | Not Available | 547 | Open in IMG/M |
| 3300013306|Ga0163162_12059606 | Not Available | 654 | Open in IMG/M |
| 3300013308|Ga0157375_11310502 | Not Available | 852 | Open in IMG/M |
| 3300014166|Ga0134079_10306634 | Not Available | 707 | Open in IMG/M |
| 3300014299|Ga0075303_1122678 | Not Available | 528 | Open in IMG/M |
| 3300014325|Ga0163163_12557615 | Not Available | 568 | Open in IMG/M |
| 3300014326|Ga0157380_13295840 | Not Available | 516 | Open in IMG/M |
| 3300014745|Ga0157377_11269359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26207 | 574 | Open in IMG/M |
| 3300014745|Ga0157377_11321816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 565 | Open in IMG/M |
| 3300015374|Ga0132255_100825971 | Not Available | 1382 | Open in IMG/M |
| 3300016387|Ga0182040_11359110 | Not Available | 601 | Open in IMG/M |
| 3300018422|Ga0190265_11362310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26207 | 825 | Open in IMG/M |
| 3300018422|Ga0190265_12425672 | Not Available | 624 | Open in IMG/M |
| 3300018429|Ga0190272_10199433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26207 | 1444 | Open in IMG/M |
| 3300018432|Ga0190275_12814906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26207 | 562 | Open in IMG/M |
| 3300018432|Ga0190275_12933830 | Not Available | 552 | Open in IMG/M |
| 3300018481|Ga0190271_10395330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26207 | 1475 | Open in IMG/M |
| 3300021403|Ga0210397_10482695 | Not Available | 937 | Open in IMG/M |
| 3300021519|Ga0194048_10213974 | Not Available | 710 | Open in IMG/M |
| 3300025445|Ga0208424_1043224 | Not Available | 556 | Open in IMG/M |
| 3300025907|Ga0207645_10292086 | Not Available | 1084 | Open in IMG/M |
| 3300025918|Ga0207662_10770840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26207 | 677 | Open in IMG/M |
| 3300025937|Ga0207669_11966927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26207 | 500 | Open in IMG/M |
| 3300025940|Ga0207691_11634703 | Not Available | 523 | Open in IMG/M |
| 3300025942|Ga0207689_11145323 | Not Available | 655 | Open in IMG/M |
| 3300025961|Ga0207712_11593750 | Not Available | 585 | Open in IMG/M |
| 3300025981|Ga0207640_11716750 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300026041|Ga0207639_12285838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 502 | Open in IMG/M |
| 3300026089|Ga0207648_10731747 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300026089|Ga0207648_11358203 | Not Available | 668 | Open in IMG/M |
| 3300026089|Ga0207648_11653217 | Not Available | 602 | Open in IMG/M |
| 3300026095|Ga0207676_11925422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 590 | Open in IMG/M |
| 3300027480|Ga0208993_1037195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26207 | 870 | Open in IMG/M |
| 3300027907|Ga0207428_10418259 | Not Available | 980 | Open in IMG/M |
| 3300028869|Ga0302263_10109841 | Not Available | 1096 | Open in IMG/M |
| 3300029923|Ga0311347_10846654 | Not Available | 556 | Open in IMG/M |
| 3300030000|Ga0311337_11769947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26207 | 542 | Open in IMG/M |
| 3300030294|Ga0311349_10868270 | Not Available | 848 | Open in IMG/M |
| 3300030943|Ga0311366_10872491 | Not Available | 780 | Open in IMG/M |
| 3300030943|Ga0311366_11003558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26207 | 722 | Open in IMG/M |
| 3300031152|Ga0307501_10271905 | Not Available | 512 | Open in IMG/M |
| 3300031228|Ga0299914_10286009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26207 | 1454 | Open in IMG/M |
| 3300031240|Ga0265320_10428954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26207 | 584 | Open in IMG/M |
| 3300031543|Ga0318516_10866770 | Not Available | 509 | Open in IMG/M |
| 3300031640|Ga0318555_10111547 | Not Available | 1448 | Open in IMG/M |
| 3300031713|Ga0318496_10815736 | Not Available | 514 | Open in IMG/M |
| 3300031716|Ga0310813_10436950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26207 | 1133 | Open in IMG/M |
| 3300031726|Ga0302321_100652083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26207 | 1177 | Open in IMG/M |
| 3300031726|Ga0302321_101771855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26207 | 715 | Open in IMG/M |
| 3300031751|Ga0318494_10842825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26207 | 537 | Open in IMG/M |
| 3300031772|Ga0315288_10292080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1708 | Open in IMG/M |
| 3300031846|Ga0318512_10445674 | Not Available | 653 | Open in IMG/M |
| 3300031902|Ga0302322_101371681 | Not Available | 861 | Open in IMG/M |
| 3300031902|Ga0302322_102123296 | Not Available | 691 | Open in IMG/M |
| 3300032003|Ga0310897_10452742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26207 | 616 | Open in IMG/M |
| 3300032075|Ga0310890_11561554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26207 | 545 | Open in IMG/M |
| 3300032160|Ga0311301_12686039 | Not Available | 549 | Open in IMG/M |
| 3300032421|Ga0310812_10310262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26207 | 702 | Open in IMG/M |
| 3300032516|Ga0315273_11655182 | Not Available | 778 | Open in IMG/M |
| 3300032770|Ga0335085_12378484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26207 | 528 | Open in IMG/M |
| 3300032782|Ga0335082_10484251 | Not Available | 1100 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.43% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 9.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 5.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.76% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.76% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.86% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.86% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.90% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.90% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.90% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.90% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.90% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.95% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.95% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.95% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.95% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.95% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.95% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.95% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.95% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.95% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.95% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.95% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.95% |
| Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001397 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-072012 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005887 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009873 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant | Engineered | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300012021 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1 | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014299 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300025445 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027480 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028869 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_4 | Environmental | Open in IMG/M |
| 3300029923 | II_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
| 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI20177J14857_10349122 | 3300001397 | Arctic Peat Soil | TAEAIKASVNHMLDSAGQRESWRFHFVIHQFVSNTPTALGRLETRREGGMDAVKREQREGS* |
| Ga0062595_1008174202 | 3300004479 | Soil | YHFMVHQFVSNTATALNATEARKQGGMDAVKQEQAGDKRS* |
| Ga0062595_1019679921 | 3300004479 | Soil | LMGQRESWRYHFMLHQFVSNTPTALAKVEARKAGGMEAVKKEQGRS* |
| Ga0062592_1019192942 | 3300004480 | Soil | DGQGQRESWQYHFMVHQFVSASATAVNATEARKQGGMDAVKQEQAGGGSSA* |
| Ga0062591_1020373632 | 3300004643 | Soil | WRYHFMLHQFVSNTPTALAKVDARKAGGMDAVKREQGKR* |
| Ga0062594_1024829492 | 3300005093 | Soil | SWQYHFMVHQFVSNTATALNATEARKQGGMDAVKQEQAGEQRS* |
| Ga0068869_1014933002 | 3300005334 | Miscanthus Rhizosphere | AIKDTINHTVDRMGQRESWQYHFMVHQFVSNSAEATGRTEARRAGGMDAVKAEQAGDTPT |
| Ga0070688_1015340191 | 3300005365 | Switchgrass Rhizosphere | QRDSWRYHFMVHQFVSNTETALARTEARKAGGMDAVKAEQAGESA* |
| Ga0070703_101489262 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | YHFMVHQFVSNSATALNATEARKQGGMDAVKQEQAGAKSPSA* |
| Ga0070713_1008251932 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MGQRESWRYHFMLHQFVSNTPTALAKTEARKSGGMDAVKKEQRGSA* |
| Ga0070741_107194722 | 3300005529 | Surface Soil | RESWKYHFMLHQFVSNTPTALAKTEARRAGGMDAVKAEQQRGDA* |
| Ga0066701_105087072 | 3300005552 | Soil | SWRYHFMIHQFVSNTATALDAAETRQKGGMDSVRAEQRGEKS* |
| Ga0066700_102286712 | 3300005559 | Soil | HQFVSNTATALDAAETRQKGGMDSVRAEQRGEKS* |
| Ga0070664_1023853362 | 3300005564 | Corn Rhizosphere | VKASINHMVDGIGQRESWRYHFMLHQFVSNTPTALAKVDARKAGGMDAVKREQAGVQEKR |
| Ga0066654_107998501 | 3300005587 | Soil | WRYHFMIHQFVSNTATALDAAETRQKGGMDSVRAEQRGEKS* |
| Ga0070702_1015548182 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | GQRESWQYHFMVHQFVSNTAEATGRTEARRAGGMDAVKAEQAGDAPT* |
| Ga0068859_1024075672 | 3300005617 | Switchgrass Rhizosphere | HFMLHQFVSNTPTALAKVDARKAGGMDAVKREQGKS* |
| Ga0068864_1026329362 | 3300005618 | Switchgrass Rhizosphere | ESWQYHFMVHQFVSNSAEATGRTEARRAGGMDAVKAEQAGAAPTH* |
| Ga0068866_106212282 | 3300005718 | Miscanthus Rhizosphere | QRESWQYHFMVHQFVSNSATALNATEARKQGGMDAVKQEQAGAKSPSA* |
| Ga0075292_10494392 | 3300005887 | Rice Paddy Soil | ESWKYHFMVHQFVSNTATALGAMETRKQGGMDAVKAEQRGDQ* |
| Ga0075023_1004950571 | 3300006041 | Watersheds | ESWRYHFMLHQFVSNTPTALAKVEARRAGGMDAVKKEQGRS* |
| Ga0075024_1006988182 | 3300006047 | Watersheds | KDTINHTVDTMGQRESWRYHFMVHQHVSNSPEALSRVEARRAGGMDAVRAEQAGDTT* |
| Ga0075017_1006871962 | 3300006059 | Watersheds | TAEMVKSSINHMVDGMGQRESWKYHFMLHQFVSNTPTALEKVEARKQGGMDAVKKEQSGTQGKR* |
| Ga0079220_101504064 | 3300006806 | Agricultural Soil | YHFMIHQFVSNTATALDAAEVRQKGGMDSVRAEQRGEKS* |
| Ga0075421_1023947342 | 3300006845 | Populus Rhizosphere | RMGQRDSWRHHFMVHQFVSNTPTALGLMRERAAGGMEHVKREQAGPKP* |
| Ga0075434_1009154772 | 3300006871 | Populus Rhizosphere | EMVKASINHMVDGMGQRESWRYHFMLHQFVSNTPTALAKVEARKQGGMDAVKREQGTS* |
| Ga0105240_116185172 | 3300009093 | Corn Rhizosphere | DGMGQRESWRYHFMLHQFVSNTPTALAKVDARKAGGMDAVKREQGKR* |
| Ga0105247_106398482 | 3300009101 | Switchgrass Rhizosphere | QGQRESWQYHFMVHQFVSNSATALNATEARKQGGMDAVKREQGAS* |
| Ga0066709_1022250411 | 3300009137 | Grasslands Soil | RESWRYHFMLHQFVSNTPTALAKVEARKAGGMDAVKKEQGRS* |
| Ga0111538_124411642 | 3300009156 | Populus Rhizosphere | VINHMVDGQGQRESWQYHFMVHQFVSASATAVNATEARKQGGMDAVKQEQAGGGSSA* |
| Ga0111538_131192831 | 3300009156 | Populus Rhizosphere | DGMGQRESWRYHFMLHQFVSNTPTALSKVEDRKRGGMDAVKKEQRGE* |
| Ga0105241_120509951 | 3300009174 | Corn Rhizosphere | DTINHTVDRMGQRESWQYHFMVHQFVSNSAEATGRAEARRAGGMDAVKAEQAGE* |
| Ga0105242_103268202 | 3300009176 | Miscanthus Rhizosphere | ALTAEMVKASINHMVDGMGQRESWRYHFMLHQFVSNTPTALAKVDARKAGGMDAVKREQGKR* |
| Ga0116219_102380292 | 3300009824 | Peatlands Soil | FVSNTPTALAKVDARKQGGMDAVKREQSGEQDNP* |
| Ga0131077_105225971 | 3300009873 | Wastewater | QRESWRYHFMVHQFVSNTSVALDRTEARRAGGMDAVKAEQRGETSR* |
| Ga0126380_116795432 | 3300010043 | Tropical Forest Soil | YHFMIHQFVSNTPTALDRAEARRQGGMDAVKREQKG* |
| Ga0134082_102675512 | 3300010303 | Grasslands Soil | TAEMVKESINHMVDGMGQRESWRYHFMLHQFVSNTPTALAKVEARKQGGMDAVKREQGKTERRPQAER* |
| Ga0126376_120644781 | 3300010359 | Tropical Forest Soil | RESWRYHFMVHQYVSNTATALHAAQAREKGGMEAVRAEQRGNQS* |
| Ga0134127_137325861 | 3300010399 | Terrestrial Soil | MLHQFVSNTPTALAKVEARKEGGMDAVKREQGAS* |
| Ga0134122_127558932 | 3300010400 | Terrestrial Soil | WRYHFMLHQFVSNTPTALAKVEARKHGGMDAVKREQGTS* |
| Ga0120192_100998912 | 3300012021 | Terrestrial | GQRDSWRHHFIVHQFVSNTETALGLMRERMAGGMDHVKREQAGDLQ* |
| Ga0137370_108637852 | 3300012285 | Vadose Zone Soil | VKASINHMVDGMGQRESWRYHFMLHQFVSNTPTALAKVEARKAGGMEAVKKEQGRS* |
| Ga0164299_115687781 | 3300012958 | Soil | QYHFMVNQFVSNTAEATGRTEARRVGGMDAVKAEQAGESAKP* |
| Ga0164302_106812902 | 3300012961 | Soil | RESWQYHFMVHQFVSNSAEATGRTEARRAGGVDAVKAEQAGDAPT* |
| Ga0164306_117038352 | 3300012988 | Soil | FMLHQFVSNTPTALAKVEARKQGGMDAVKREQGTS* |
| Ga0163162_120596062 | 3300013306 | Switchgrass Rhizosphere | WQYHFMVHQFVSNSAEATGRTEARRAGGMDAVRAEQAGESSR* |
| Ga0157375_113105022 | 3300013308 | Miscanthus Rhizosphere | LDGQGQRDSWRYHFMVHQFVSNTETALARTEARKAGGMDAVKAEQAGESAKP* |
| Ga0134079_103066342 | 3300014166 | Grasslands Soil | FMLHQFVSNTATALDAGEARQKGGMDSVRAEQRGENA* |
| Ga0075303_11226781 | 3300014299 | Natural And Restored Wetlands | YHFMLHQFVSNTPTALSKVEARKAGGMDAVKKEQQG* |
| Ga0163163_125576152 | 3300014325 | Switchgrass Rhizosphere | WQYHFMVHQFVSNTAEATGRTEARRAGGMDAVKAEQAGESATS* |
| Ga0157380_132958401 | 3300014326 | Switchgrass Rhizosphere | MVHQFVSNSATALNATEARKQGGMDAVKQEQAGAKSPSA* |
| Ga0157377_112693591 | 3300014745 | Miscanthus Rhizosphere | MVKASINHMVDGMGQRESWRYHFMLHQFVSNTPTALAKVEARKEGGMDAVKREQGAS* |
| Ga0157377_113218161 | 3300014745 | Miscanthus Rhizosphere | SWRHHFMIHQFVSNTATALGAASTRAAGGMDAVKAEQRGEPGSGGPRR* |
| Ga0132255_1008259712 | 3300015374 | Arabidopsis Rhizosphere | KDVINHMVDGQGQRESWQYHFMVHQFVSNSATALNATEARKQGGMDAVKQEQAGAKSTSA |
| Ga0182040_113591101 | 3300016387 | Soil | FMIHQLVSNTATALAASEARSQGGMDAVKREQAGR |
| Ga0190265_113623101 | 3300018422 | Soil | PAATAEAIKTSVNNMLDTAGQRESWRFHFVIHQFVSNTPTALDRLDARREGGMDAVKRERGRA |
| Ga0190265_124256721 | 3300018422 | Soil | QRESWQYHFMVHQFVSNSAEALGRTEARRQGGMDAVRAEQAGESEPT |
| Ga0190272_101994332 | 3300018429 | Soil | INHMVDRMGQRDSWRYHFALHQFVSNTPTALARAEVRKAGGMDAVRAEQAGEQSK |
| Ga0190275_128149061 | 3300018432 | Soil | MIDGMGQRESWRYHFMLHQFVSNTPTALAKVDARKASGMDAVKREQGKR |
| Ga0190275_129338301 | 3300018432 | Soil | DTAGQRDSWRYHFMVHQFVSNTADALGRTDARREGGMDAVRAEQADRS |
| Ga0190271_103953303 | 3300018481 | Soil | AVKASINNMVDGMGQRENWRYHFMLHQFVSNTPTALAKVETRKAGGMDAVKKEQQG |
| Ga0210397_104826951 | 3300021403 | Soil | RDSWRYHFMIHQLVSNTATALAASEARSKGGMDAVKREQAGR |
| Ga0194048_102139742 | 3300021519 | Anoxic Zone Freshwater | HTIDRMGQRDSWKYHFMVHQFVSNTAMATGATEARREGGMDAVKKEQAGR |
| Ga0208424_10432241 | 3300025445 | Aqueous | YHFMVHQFVSASDTATSAMSSRKEGGMDAVKKEQAGK |
| Ga0207645_102920861 | 3300025907 | Miscanthus Rhizosphere | DGQGQRESWQYHFMVHQFVSNSATALNATEARKQGGMDAVKQEQAGAKSPSA |
| Ga0207662_107708402 | 3300025918 | Switchgrass Rhizosphere | LTAEMVKASINHMVDGMGQRESWRYHFMLHQFVSNTPTALAKVEARKHGGMDAVKREQGT |
| Ga0207669_119669272 | 3300025937 | Miscanthus Rhizosphere | VDGMGQRESWRYHFMLHQFVSNTPTALEKVEARKQGGMDAVKREQGAS |
| Ga0207691_116347031 | 3300025940 | Miscanthus Rhizosphere | WRYHFVLHQFVSNTPTALERTEARKAGGMDAVKREQKS |
| Ga0207689_111453231 | 3300025942 | Miscanthus Rhizosphere | YHFMLHQFVSNTPTALAKVEARKEGGMDAIKKEQR |
| Ga0207712_115937502 | 3300025961 | Switchgrass Rhizosphere | WRYHFMLHQFVSNTPTALAKVDARKAGGMDAVKREQGNS |
| Ga0207640_117167501 | 3300025981 | Corn Rhizosphere | PLTAEAVKASINNMVDGMGQRESWRYHFMLHQFVSNTPTALERVEARKAGGMDAVKKEQR |
| Ga0207639_122858382 | 3300026041 | Corn Rhizosphere | VDRMGQRESWQYHFMVHQFVSNSAEATGRTEARRAGGMDAVKAEQAGDTPT |
| Ga0207648_107317472 | 3300026089 | Miscanthus Rhizosphere | MLDGAGQRESWRFHFVLHQFVSNTPTALDRVEARREGGIDAVKREQQGPT |
| Ga0207648_113582032 | 3300026089 | Miscanthus Rhizosphere | MGQRESWQYHFMVHQFVSNSAEATGRTEARRAGGMDAVKAEQAGE |
| Ga0207648_116532171 | 3300026089 | Miscanthus Rhizosphere | YHFMVHQFVSNTAEATGRTEARRVGGMDAVKAEQAGESAKP |
| Ga0207676_119254221 | 3300026095 | Switchgrass Rhizosphere | RMGQRESWQYHFMVHQFVSNSAEATGRTEARRAGGMDAVKAEQAGAAPTH |
| Ga0208993_10371952 | 3300027480 | Forest Soil | HMVDGMGQRESWRYHFMLHQFVSNTPTALAKTEARKAGGMDAVKKEQGRS |
| Ga0207428_104182591 | 3300027907 | Populus Rhizosphere | VHQFVSNSATALNATEARKQGGMDAVKQEQAGAKSPSA |
| Ga0302263_101098411 | 3300028869 | Fen | RYHFMVHQLVSASATATGALETRKQGGMDAVKKEQAGGKRKS |
| Ga0311347_108466541 | 3300029923 | Fen | QYHFMVHQFVSASATATGALETRKEGGMDAVKKEQAGGGSGQAS |
| Ga0311337_117699472 | 3300030000 | Fen | ESWKYHFMLHQFVSNTPTALEKVEARKQGGMDAVKKEQSGAQETS |
| Ga0311349_108682701 | 3300030294 | Fen | VNHTLDTMGQHEAWKYHFMVHQLVSASATATGALESRKEGGMDAVKKEQAGP |
| Ga0311366_108724911 | 3300030943 | Fen | ESWKYHFMVHQFVSNTPTALDKVEARKAGGMDAVRREQSS |
| Ga0311366_110035581 | 3300030943 | Fen | SWKYHFMLHQFVSNTPTALEKVEARKQGGMDAVKKEQSGAQETS |
| Ga0307501_102719052 | 3300031152 | Soil | FMLHQFVSNTPTALAKVDARKAGGMDAVKKEQGRS |
| Ga0299914_102860091 | 3300031228 | Soil | GQRESWRYHFALHQFVSNTPTALERVEARKAGGMDAVKREQQQG |
| Ga0265320_104289542 | 3300031240 | Rhizosphere | DGMGQRESWKYHFMLHQFVSNTPTALAKVEARKQGGMDAVKNEQSGAQDTH |
| Ga0318516_108667701 | 3300031543 | Soil | YHFMIHQLVSNTATALAASEARSQGGMDAVKREQAGR |
| Ga0318555_101115471 | 3300031640 | Soil | QRDSWRYHFMIHQLVSNTATALAASEARSQGGMDAVKREQAGR |
| Ga0318496_108157362 | 3300031713 | Soil | RYHFMIHQLVSNTATALAASEARSQGGMDAVKREQAGR |
| Ga0310813_104369502 | 3300031716 | Soil | SINHMVDGMGQRESWRYHFMIHQFVSNTPTALERAEARKQGGMDAVKREQQG |
| Ga0302321_1006520831 | 3300031726 | Fen | NHMVDGMGQRESWQYHFMLHQFVSNTPTALSKVEARKQGGMDAVKKEQR |
| Ga0302321_1017718552 | 3300031726 | Fen | RESWKYHFMLHQFVSNTPTALEKVEARKQGGMDAVKKEQSGAQETS |
| Ga0318494_108428252 | 3300031751 | Soil | MGQRESWRYHFMLHQFVSNTPTALAKVEARKQGGMEAVKKEQAGSAD |
| Ga0315288_102920801 | 3300031772 | Sediment | QAIKDTIKHMIDGQGQRESWRYHFMVHQFVSNSATALAATDARKEGGAGKSVMDAVKREQAGE |
| Ga0318512_104456741 | 3300031846 | Soil | RRDRRDQGDSWRYHFMIHQLVSNTATALAASEARSRGGMDAVKREQAGR |
| Ga0302322_1013716811 | 3300031902 | Fen | LDSWRHHFVVHQFVSNTDTALGMMAARTAGGMDAVKREQRGE |
| Ga0302322_1021232961 | 3300031902 | Fen | HTLDTAGQRDSWRYHFMVHQFVSNTADALGRTDARREGGMDAVRAEQADRT |
| Ga0310897_104527421 | 3300032003 | Soil | VTAAAVKDTINHTLDVAGQRESWRYHFMLHQFVSNTPTALAKVEARKEGGMDAVKREQGA |
| Ga0310890_115615542 | 3300032075 | Soil | MGQRESWRYHFMLHQFVSNTPTALAKVDARKAGGMDAVKREQASS |
| Ga0311301_126860392 | 3300032160 | Peatlands Soil | WRYHFMIHQFVSNTATALAASEGRKQGGMDAVKREQAGR |
| Ga0310812_103102621 | 3300032421 | Soil | DGMGQRESWRYHFMIHQFVSNTPTALERVEARKQGGMDAVKREQQG |
| Ga0315273_116551822 | 3300032516 | Sediment | MVHQFVSNTATATGALEARKEGGMDAVKKEQAGGAAK |
| Ga0335085_123784841 | 3300032770 | Soil | INHMVDRMGQRDSWKYHFALHQFVSNTPTALAKSEARKAGGMEAVRAEQQRGDVK |
| Ga0335082_104842512 | 3300032782 | Soil | SWRYHFMLHQFVSNTPTALAKVEARKQGGMDAVMREQGKTARRPQAEH |
| ⦗Top⦘ |