NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F096251

Metagenome / Metatranscriptome Family F096251

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F096251
Family Type Metagenome / Metatranscriptome
Number of Sequences 105
Average Sequence Length 46 residues
Representative Sequence ALDKKARRGKVAWVMPRRIGHAEIGHAVPGALVRRVVTRSLA
Number of Associated Samples 86
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.10 %
% of genes from short scaffolds (< 2000 bps) 81.90 %
Associated GOLD sequencing projects 80
AlphaFold2 3D model prediction Yes
3D model pTM-score0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (88.571 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(25.714 % of family members)
Environment Ontology (ENVO) Unclassified
(44.762 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(62.857 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 21.43%    β-sheet: 0.00%    Coil/Unstructured: 78.57%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF01220DHquinase_II 64.76
PF08207EFP_N 11.43
PF03780Asp23 7.62
PF01513NAD_kinase 4.76
PF01029NusB 2.86
PF09285Elong-fact-P_C 2.86
PF02681DUF212 1.90
PF02616SMC_ScpA 0.95
PF01728FtsJ 0.95
PF01761DHQ_synthase 0.95
PF02609Exonuc_VII_S 0.95

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 105 Family Scaffolds
COG07573-dehydroquinate dehydrataseAmino acid transport and metabolism [E] 64.76
COG0231Translation elongation factor P (EF-P)/translation initiation factor 5A (eIF-5A)Translation, ribosomal structure and biogenesis [J] 11.43
COG1302Uncharacterized conserved protein YloU, alkaline shock protein (Asp23) familyFunction unknown [S] 7.62
COG1963Acid phosphatase family membrane protein YuiDGeneral function prediction only [R] 1.90
COG029323S rRNA U2552 (ribose-2'-O)-methylase RlmE/FtsJTranslation, ribosomal structure and biogenesis [J] 0.95
COG1189Predicted rRNA methylase YqxC, contains S4 and FtsJ domainsTranslation, ribosomal structure and biogenesis [J] 0.95
COG1354Chromatin segregation and condensation protein Rec8/ScpA/Scc1, kleisin familyReplication, recombination and repair [L] 0.95
COG1722Exonuclease VII small subunitReplication, recombination and repair [L] 0.95

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms88.57 %
UnclassifiedrootN/A11.43 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_105758402All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia2428Open in IMG/M
3300001409|JGI20185J14861_1004094All Organisms → cellular organisms → Bacteria1310Open in IMG/M
3300001535|A3PFW1_10476274All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300002562|JGI25382J37095_10077823All Organisms → cellular organisms → Bacteria1223Open in IMG/M
3300002916|JGI25389J43894_1061590All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300004479|Ga0062595_100977236All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300004479|Ga0062595_102294401All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300005167|Ga0066672_10160834All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia1413Open in IMG/M
3300005171|Ga0066677_10455113All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300005174|Ga0066680_10954676All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300005179|Ga0066684_10017690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes3643Open in IMG/M
3300005181|Ga0066678_10090591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1832Open in IMG/M
3300005334|Ga0068869_101993547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes521Open in IMG/M
3300005440|Ga0070705_101126184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi643Open in IMG/M
3300005440|Ga0070705_101774622All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300005445|Ga0070708_101575375All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia612Open in IMG/M
3300005446|Ga0066686_10245735All Organisms → cellular organisms → Bacteria1207Open in IMG/M
3300005467|Ga0070706_100850484All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300005467|Ga0070706_101546745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales606Open in IMG/M
3300005468|Ga0070707_100715219All Organisms → cellular organisms → Bacteria964Open in IMG/M
3300005468|Ga0070707_102195541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi519Open in IMG/M
3300005471|Ga0070698_100226332All Organisms → cellular organisms → Bacteria1803Open in IMG/M
3300005530|Ga0070679_101268224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales682Open in IMG/M
3300005536|Ga0070697_100810392All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300005552|Ga0066701_10821984All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300005552|Ga0066701_10888849All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300005553|Ga0066695_10146952All Organisms → cellular organisms → Bacteria1466Open in IMG/M
3300005554|Ga0066661_10014554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia4034Open in IMG/M
3300005554|Ga0066661_10397033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia844Open in IMG/M
3300005555|Ga0066692_10004493All Organisms → cellular organisms → Bacteria6055Open in IMG/M
3300005555|Ga0066692_10822878All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300005556|Ga0066707_10013058All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia4180Open in IMG/M
3300005561|Ga0066699_10259102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1230Open in IMG/M
3300005586|Ga0066691_10003661All Organisms → cellular organisms → Bacteria6501Open in IMG/M
3300005764|Ga0066903_107864272All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300006057|Ga0075026_100566124All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300006755|Ga0079222_12131051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales555Open in IMG/M
3300006794|Ga0066658_10770235All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi539Open in IMG/M
3300006806|Ga0079220_10883850All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300006903|Ga0075426_10861481All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300006903|Ga0075426_11439965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium523Open in IMG/M
3300007258|Ga0099793_10625132Not Available541Open in IMG/M
3300007265|Ga0099794_10025154All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes2739Open in IMG/M
3300009012|Ga0066710_100739643All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1503Open in IMG/M
3300009012|Ga0066710_101038245All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1266Open in IMG/M
3300009012|Ga0066710_102348916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia774Open in IMG/M
3300009038|Ga0099829_10256066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1428Open in IMG/M
3300009088|Ga0099830_11167779All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium639Open in IMG/M
3300009093|Ga0105240_12435619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium542Open in IMG/M
3300009137|Ga0066709_101528786All Organisms → cellular organisms → Bacteria961Open in IMG/M
3300009137|Ga0066709_103451257Not Available574Open in IMG/M
3300009661|Ga0105858_1042767All Organisms → cellular organisms → Bacteria1156Open in IMG/M
3300010325|Ga0134064_10323716Not Available594Open in IMG/M
3300010326|Ga0134065_10446872Not Available528Open in IMG/M
3300010326|Ga0134065_10449544All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium527Open in IMG/M
3300010335|Ga0134063_10430217Not Available651Open in IMG/M
3300010336|Ga0134071_10798130Not Available505Open in IMG/M
3300010399|Ga0134127_10419015All Organisms → cellular organisms → Bacteria1330Open in IMG/M
3300010400|Ga0134122_12026547Not Available614Open in IMG/M
3300012198|Ga0137364_10092356All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia2115Open in IMG/M
3300012199|Ga0137383_11091310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium578Open in IMG/M
3300012201|Ga0137365_10478837All Organisms → cellular organisms → Bacteria916Open in IMG/M
3300012211|Ga0137377_10093641All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia2839Open in IMG/M
3300012349|Ga0137387_10234282All Organisms → cellular organisms → Bacteria1321Open in IMG/M
3300012349|Ga0137387_10495160All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes887Open in IMG/M
3300012349|Ga0137387_11219268Not Available530Open in IMG/M
3300012358|Ga0137368_10497494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia786Open in IMG/M
3300012359|Ga0137385_10308513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1360Open in IMG/M
3300012359|Ga0137385_10944067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium712Open in IMG/M
3300012362|Ga0137361_11246246Not Available667Open in IMG/M
3300012399|Ga0134061_1213908Not Available561Open in IMG/M
3300012923|Ga0137359_11304198All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300012927|Ga0137416_10104579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes2136Open in IMG/M
3300012975|Ga0134110_10186746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes866Open in IMG/M
3300012977|Ga0134087_10547902All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300014154|Ga0134075_10075679All Organisms → cellular organisms → Bacteria1409Open in IMG/M
3300014157|Ga0134078_10476892All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium575Open in IMG/M
3300017654|Ga0134069_1138999All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia807Open in IMG/M
3300018431|Ga0066655_10565136All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales762Open in IMG/M
3300020581|Ga0210399_11124052All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium628Open in IMG/M
3300021478|Ga0210402_11909476All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300022691|Ga0248483_170688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium540Open in IMG/M
3300025581|Ga0208355_1047541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales1066Open in IMG/M
3300025922|Ga0207646_10121117All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia2350Open in IMG/M
3300025922|Ga0207646_10807437All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300026298|Ga0209236_1002079All Organisms → cellular organisms → Bacteria12204Open in IMG/M
3300026308|Ga0209265_1212156Not Available526Open in IMG/M
3300026310|Ga0209239_1146179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes946Open in IMG/M
3300026315|Ga0209686_1026016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia2284Open in IMG/M
3300026316|Ga0209155_1135457All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes840Open in IMG/M
3300026329|Ga0209375_1026330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia3218Open in IMG/M
3300026334|Ga0209377_1214043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium637Open in IMG/M
3300026514|Ga0257168_1090409All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium680Open in IMG/M
3300026524|Ga0209690_1173372All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300026524|Ga0209690_1255870Not Available551Open in IMG/M
3300026530|Ga0209807_1336563All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300026532|Ga0209160_1105504All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia1417Open in IMG/M
3300026550|Ga0209474_10047858All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia3075Open in IMG/M
3300026552|Ga0209577_10022744All Organisms → cellular organisms → Bacteria5525Open in IMG/M
3300026552|Ga0209577_10506869All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia799Open in IMG/M
3300027846|Ga0209180_10726420All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300027882|Ga0209590_10021309All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia3276Open in IMG/M
3300027882|Ga0209590_10279273All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1070Open in IMG/M
3300028536|Ga0137415_10153768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes2136Open in IMG/M
3300031754|Ga0307475_10064925All Organisms → cellular organisms → Bacteria2779Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil25.71%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil20.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil10.48%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere10.48%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil9.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.81%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.86%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.90%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.90%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.90%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.90%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.95%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.95%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.95%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.95%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.95%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.95%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.95%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001409Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012EnvironmentalOpen in IMG/M
3300001535Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300002562Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300002916Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cmEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009661Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012399Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300022691Soil microbial communities from Calhoun CZO, South Carolina, United States - 60cm depthEnvironmentalOpen in IMG/M
3300025581Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026298Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026308Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes)EnvironmentalOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026315Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes)EnvironmentalOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300026329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)EnvironmentalOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300026514Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-BEnvironmentalOpen in IMG/M
3300026524Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)EnvironmentalOpen in IMG/M
3300026530Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)EnvironmentalOpen in IMG/M
3300026532Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_10575840213300000956SoilARRGKVAWVMPRRIGHAEIGHAVPGALVRRVVTRSLA*
JGI20185J14861_100409443300001409Arctic Peat SoilRGKVAWVLPRRLGHAETGHAVPGAIVSRVLRKALA*
A3PFW1_1047627413300001535PermafrostDKKARRGKVAWVLPRRLGHAETGHEVPGAIVSRVLRKALA*
JGI25382J37095_1007782333300002562Grasslands SoilRADPKRVLAAIALDKKARRGKVAWVMPRRIGHAEIGHSVPGAIIRRVVTXSLA*
JGI25389J43894_106159013300002916Grasslands SoilVLAAVALDKKARRGKVAWVMPRRIGHAEIGHAVPGALVRRVITRSLA*
Ga0062595_10097723633300004479SoilDKKARRGRVAWVLPRRIGYAEVGHTVPPGLVRRVIRKALA*
Ga0062595_10229440123300004479SoilLGLPDRAPRANAKRVLAAIALDKKARRGKVAWVMPRRIGHAEIGHAVPGALVRRVVTRSLA*
Ga0066672_1016083443300005167SoilAFGLPDRPPHADPKRVLAAMAVDKKARRGKVAWVMPRRIGHAEIGHTVPGAVVRRVLTRSLT*
Ga0066677_1045511333300005171SoilDKKARRGRVAWVLPRRIGHAVIGQDVPARLVRRVVRRAIA*
Ga0066680_1095467613300005174SoilPDKPPHADPKRVLAAVALDKKARRGKVAWVMPRRIGHAEIGHAVPGALVRRVITRSMA*
Ga0066684_1001769013300005179SoilPDKPPHADPKRVLAAMAADKKARRGKVAWVMPRRIGHAEIGHTVPGALVRRVITRSLA*
Ga0066678_1009059113300005181SoilVLAAMALDKKARRGKVAWVMPRRIGHAEIGHSVPAPVVRRVVARSLA*
Ga0068869_10199354713300005334Miscanthus RhizosphereRPPSVDASRVLAAIPHDKKSRRGKVAWVMPRRLGHAEPGHAVPASVVRRVVRKSLA*
Ga0070705_10112618413300005440Corn, Switchgrass And Miscanthus RhizosphereRDKKARRGKVAWVMPRRMGHAEPGHIVPSPLVRRVVTRALA*
Ga0070705_10177462213300005440Corn, Switchgrass And Miscanthus RhizosphereAVDKKARRGKVAWVMPRRIGHAEIGHAVPGALVRRVLIRSLA*
Ga0070708_10157537513300005445Corn, Switchgrass And Miscanthus RhizosphereVDKKARRGKVAWVMPRRIGHAEIGHTVPAPLVRRVVTRSLA*
Ga0066686_1024573513300005446SoilFGLPDRPPSADPDRVLAAIALDKKARRGKVAWVMPRRIGHAEIGHAVPGALVRRVVTRSLA*
Ga0070706_10085048413300005467Corn, Switchgrass And Miscanthus RhizosphereFGLPDRPPHADPRRVLAAIALDKKARRGKVAWVMPRRIGHAEVGHAVPGALVRRVVTRALA*
Ga0070706_10154674523300005467Corn, Switchgrass And Miscanthus RhizosphereMSHDKKARRGKVAWVMPRRLGHAEPGHAVPAAIVRRVVRKALA*
Ga0070707_10071521933300005468Corn, Switchgrass And Miscanthus RhizosphereALDKKARRGKVAWVMPRRIGHAEVGHAVPGALVRRVVTRALA*
Ga0070707_10219554123300005468Corn, Switchgrass And Miscanthus RhizosphereTDKKARRGKVAWVLPRRIGFAEVGHEVPPGLVRRVVRKALA*
Ga0070698_10022633213300005471Corn, Switchgrass And Miscanthus RhizosphereDKKARRGKVAWVMPRRIGHAEVGHAVPGALVRRVVTRALA*
Ga0070679_10126822413300005530Corn RhizosphereLLSDLGLSDRPPSVDASRVLAAIPHDKKSRRGKVAWVMPRRLGHAEPGHAVPASVVRRVVRKSLA*
Ga0070697_10081039213300005536Corn, Switchgrass And Miscanthus RhizospherePRDKKARRGKVAWVMPRRMGHAEPGHTVPSPLVRRVVTRALA*
Ga0066701_1082198413300005552SoilPNRVLAAMALDKKARRGKVAWVMPRRIGHAEVGHAIPGALVRRVVIRSLG*
Ga0066701_1088884923300005552SoilKARRGKVAWVMPRRMGHAEIGHAVPGALVRRVVTRSLA*
Ga0066695_1014695213300005553SoilGKVAWVMPRRIGHAEIGHSVPGAIIRRVVTRSLA*
Ga0066661_1001455413300005554SoilDRPPHADPKRVLAAMAVDKKARRGKVAWVMPRRIGHAEIGHTVPGAVVRRVLTRSLT*
Ga0066661_1039703333300005554SoilRGKVAWVMPRRIGHAEVGHAIPGALVRRVVIRSLG*
Ga0066692_10004493113300005555SoilGKVAWVLPRRIGHSEIGHAVPGAIVRRVITRSLA*
Ga0066692_1082287823300005555SoilHADPKRVLAAMALDKKARRGKVAWVMPRRIGHAEIGHTVPAPVVRRVVTRSLA*
Ga0066707_1001305813300005556SoilADPKRVLAAMAVDKKARRGKVAWVMPRRIGHAEIGHTVPGAVVRRVLTRSLT*
Ga0066699_1025910233300005561SoilADPKRVLAAIAYDKKARRGKVAWVMPRRIGHAEIGHAVPAALVRRVVTRSLA*
Ga0066691_1000366113300005586SoilRGKVAWVMPRRIGHAEIGHTVPGAVVRRVLTRSLT*
Ga0066903_10786427223300005764Tropical Forest SoilAITLDKKARRGKVAWVMPRRIGHAEIGHAVPGATVRRVVTKALA*
Ga0075026_10056612433300006057WatershedsRVLSAIEHDKKARRGRVAWVMPRRLGHAEPGHVVPAGVVRRFVRKALA*
Ga0079222_1213105113300006755Agricultural SoilPPHAAPDRVMQAMTLDKKARRGKVAWVMPRRIGHAEIGHTVPGALVRRVVIRSLS*
Ga0066658_1077023513300006794SoilAAIALDKKARRGKVAWVMPRRIGHAEIGHSVPGAIIRRVVTRSLA*
Ga0079220_1088385013300006806Agricultural SoilADPKRVLAAIALDKKARRGKVAWVMPRRIGHAEIGHAVPGALVRRVVTKALA*
Ga0075426_1086148113300006903Populus RhizosphereTDKKARRGRVAWVLPRRIGFAEIGHEVPPGLVRRVVRKALA*
Ga0075426_1143996523300006903Populus RhizosphereARRGKVAWVMPRRIGHAEPGHAVPGAIVRRVVTRSLR*
Ga0099793_1062513223300007258Vadose Zone SoilMALDKKARRGKVAWVMPRRIGHAEIGHAVPAPLVRRIVTRSLA*
Ga0099794_1002515483300007265Vadose Zone SoilRVLAAIEHDKKARRGRVAWVMPRRLGHAEPGHVVPAGVVRRFVRKALA*
Ga0066710_10073964343300009012Grasslands SoilRGKVAWVMPRRIDHAEIGHMVPGATIRRVVTRSLA
Ga0066710_10103824523300009012Grasslands SoilVLTAFGLPDRPPQADPRRVLAAIALDKKARRGKVAWVMPRRMGHAEIGHAVPGALVRRVVTRSLA
Ga0066710_10234891633300009012Grasslands SoilLPDRAPHADPKRLLVAIALDKKARRGKVAWVMPRRVGHAEIGHAVPGALVRRVLVRSLA
Ga0099829_1025606633300009038Vadose Zone SoilVLAAIEHDKKARRGRVAWVMPRRLGHAEPGHVVPAGVVRRFVRKALA*
Ga0099830_1116777913300009088Vadose Zone SoilMMAAIPADKKARRGRVAWVLPRRIGHAVIGQNVPARLVRRVVRRSLA*
Ga0105240_1243561923300009093Corn RhizosphereDKKSRRGKVAWVMPRRLGHAEPGHAVPASVVRRVVRKSLA*
Ga0066709_10152878613300009137Grasslands SoilDKKARRGRVAWVLPRRIGYAEAGHVVPRGVVRRVLRKAIA*
Ga0066709_10345125723300009137Grasslands SoilRANPNKVLAAMALDKKARRGKVAWVMPRRIGHAEIGHSVPGAIIRRVITRSLA*
Ga0105858_104276713300009661Permafrost SoilRDKKARRGRVAWVMPRRLGHAEIGHEIPSPLVRRVVTRALG*
Ga0134064_1032371613300010325Grasslands SoilLDKKARRGRVAWVMPRRIGHAEPGHAVPGALVRRVVTRSLA*
Ga0134065_1044687223300010326Grasslands SoilDKKARRGKVAWVMPRRIGHAEIGHTVPGALVRRVITRSLA*
Ga0134065_1044954423300010326Grasslands SoilRRGKVAWVMPRRIGHAEIGHTVPGALVRRVLVRSLA*
Ga0134063_1043021713300010335Grasslands SoilDPKRVLAAMAADKKARRGKVAWVMPRRIGHAEIGHTVPGALVRRVITRSLA*
Ga0134071_1079813023300010336Grasslands SoilALDKKARRGKVAWVMPRRIGHAEIGHAVPGALVRRVVTRSLA*
Ga0134127_1041901513300010399Terrestrial SoilKSRRGKVAWVMPRRLGHAEPGHAVPASVVRRVVRKSLA*
Ga0134122_1202654723300010400Terrestrial SoilRVIAAIAFDKKARRGKVAWVMPRRIGHAEIGHTVPGALVRRVVTRSLA*
Ga0137364_1009235613300012198Vadose Zone SoilKRVLAAIALDKKARRGKVAWVMPRRIGHAEIGHMVPGATIRRVVTRSLA*
Ga0137383_1109131013300012199Vadose Zone SoilPTDKKARRGRVAWVLPRRIGHAVIGQDVPARLVRRVVRRAIA*
Ga0137365_1047883713300012201Vadose Zone SoilAAIAVDKKARRGKVAWVLPRRIGHAEIGHAVPSALVRRVIARSLA*
Ga0137377_1009364183300012211Vadose Zone SoilRADPKRVLAAIALDKKARRGKVAWVMPRRIGHAEIGHTVPGATIRRVVTRSLA*
Ga0137387_1023428213300012349Vadose Zone SoilRDKKARRGRVAWVMPRRLGHAETGHAVPPAVVRRVVRRALA*
Ga0137387_1049516033300012349Vadose Zone SoilIALDKKARRGKVAWVMPRRIGHAEIGHSVPGATIRRVVTRSLA*
Ga0137387_1121926823300012349Vadose Zone SoilQLGSPFPLLAAIAVDKKARRGKVAWVLPRRIGHAEIGHAVPSALVRRVIARSLA*
Ga0137368_1049749433300012358Vadose Zone SoilTSLGLCHRAPRADPERVLAAISLDKKARRGKVAWVMPRRIGHAEIGHAVPGPLVRRVVTRSLA*
Ga0137385_1030851343300012359Vadose Zone SoilLGLPDTAPRADPKRVLAAIALDKKARRGKVAWVMPRRIGHAEIGHSVPGAIIRRVVTRSLA*
Ga0137385_1094406723300012359Vadose Zone SoilLGLPDTAPRADPKRVLAAIALDKKARRGKVAWVMPRRIGHAEIGHSVPGATIRRVITRSLA*
Ga0137361_1124624633300012362Vadose Zone SoilADPKRVLAAMALDKKARRGKVAWVMPRRIGHAEIGHTVPAPLVRRVVTRSLA*
Ga0134061_121390823300012399Grasslands SoilGKVAWVMPRRIGHAEIGHAVPGALVRRVVTRSLA*
Ga0137359_1130419823300012923Vadose Zone SoilLAAMSHDKKARRGKVAWVMPRRLGHAEPGHAVPAAVVRRVVRKALA*
Ga0137416_1010457963300012927Vadose Zone SoilMSHDKKARRGKVAWVMPRRLGHAEPGHAVPAAVVRRVVRKALA*
Ga0134110_1018674613300012975Grasslands SoilRRGHVAWVLPRRIGHAVIGQDVPVRLVRRVVRGAIV*
Ga0134087_1054790223300012977Grasslands SoilVLAAIALDKKARRGRVAWVMPRRIGHAEPGHAVPGALVRRVVTRSLA*
Ga0134075_1007567913300014154Grasslands SoilIALDKKARRGKVAWVMPRRIGHAEIGHAVPGALVRRVVTRSLA*
Ga0134078_1047689213300014157Grasslands SoilVLAAIALDKKARRGKVAWVMPRRIGHAEIGHSVPGATIRRIVTRSLA*
Ga0134069_113899933300017654Grasslands SoilADAKKVLGAIALDKKARRGRVAWVMPRRIGHAEPGHAVPGALVRRVVTRSLA
Ga0066655_1056513633300018431Grasslands SoilDKKARRGKVAWVMPRRLGHAEPGHAVPAAIVRRVLRKALA
Ga0210399_1112405233300020581SoilIEHDKKARRGQVAWVMPRRLGHAEPGHVVPAGVVRRFVRKALA
Ga0210402_1190947623300021478SoilRGKVAWVMPRLLGRAEPGHAVPSPLVRRIVTRALA
Ga0248483_17068813300022691SoilRRGKVAWVMPRRLGHAEVGHAVPGAIVRRVVTRSLA
Ga0208355_104754133300025581Arctic Peat SoilRGKVAWVLPRRLGHAETGHAVPGAIVSRVLRKALA
Ga0207646_1012111773300025922Corn, Switchgrass And Miscanthus RhizosphereKRVLAAMAVDKKARRGKVAWVMPRRIGHAEIGHTVPAPLVRRVVTRSLA
Ga0207646_1080743713300025922Corn, Switchgrass And Miscanthus RhizosphereADPKRILAAIALDKKARRGKVAWVMPRRIGHAEPGHAVPGAIVRRVVTRSLQ
Ga0209236_100207913300026298Grasslands SoilRGKVAWVMPRRIGHAEIGHSVPGAIIRRVVTRSLA
Ga0209265_121215613300026308SoilVLAAMAADKKARRGKVAWVMPRRIGHAEIGHTVPGALVRRVITRSLA
Ga0209239_114617913300026310Grasslands SoilADPKRVLAAIALDKKARRGKVAWVMPRRIGHAEIGHSVPGAIIRRVVTRSLA
Ga0209686_102601613300026315SoilPDKPPHADPKRVLAAMALDKKARRGKVAWVMPRRIGHAEIGHSVPAPVVRRVVARSLA
Ga0209155_113545733300026316SoilDPKRVLAAMAVDKKARRGKVAWVMPRRIGHAEIGHTVPGAVVRRVLTRSLT
Ga0209375_102633083300026329SoilTADAKKVLGAIALDKKARRGRVAWVMPRRIGHAEPGHAVPGALVRRVVTRSLA
Ga0209377_121404313300026334SoilDKKARRGKVAWVLPRRIGHSEIGHAVPGAIVRRVITRSLA
Ga0257168_109040913300026514SoilKKARRGKVAWVMPRRLGHAEPGHAVPAAVVRRVVRKALA
Ga0209690_117337233300026524SoilARRGKVAWVMPRRMGHAEIGHAVPGALVRRVVTRSLA
Ga0209690_125587013300026524SoilRVLAAMALDKKARRGKVAWVMPRRIGHAEVGHAIPGALVRRVVIRSLG
Ga0209807_133656323300026530SoilVLAAISLDKKARRGKVAWVLPRRIGHAEIGRSVPGPLVRRVITRSLA
Ga0209160_110550443300026532SoilRVLAAMALDKKARRGKVAWVMPRRIGHAEIGHSVPAPVVRRVVARSLA
Ga0209474_1004785813300026550SoilDRPPHVEPNRVLAAMALDKKARRGKVAWVMPRRIGHAEVGHAIPGALVRRVVIRSLG
Ga0209577_1002274413300026552SoilPPHVEPKRVLAAMALDKKARRGKVAWVMPRRIGHAEVGHAIPGALVRRVVIRSLG
Ga0209577_1050686913300026552SoilVLAAITLDKKALRGKVAWVMPRRIGKAEVGHSVPPAVVRRVVTRALA
Ga0209180_1072642013300027846Vadose Zone SoilAAIEHDKKARRGRVAWVMPRRLGHAEPGHVVPAAVVRKFVRKALA
Ga0209590_1002130983300027882Vadose Zone SoilHDKKARRGKVAWVMPRRLGHAEPGHAVPSALVRRVVRKALA
Ga0209590_1027927313300027882Vadose Zone SoilARRGRVAWVMPRRLGHAEPGHVVPAGVVRRFVRKALA
Ga0137415_1015376813300028536Vadose Zone SoilMSHDKKARRGKVAWVMPRRLGHAEPGHAVPAAVVRRVVRKALA
Ga0307475_1006492583300031754Hardwood Forest SoilDRVVRAITLDKKARRGKVAWVMPRRIGHAEIGHAVPGALVRRVVTRSLS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.