| Basic Information | |
|---|---|
| Family ID | F096238 |
| Family Type | Metagenome |
| Number of Sequences | 105 |
| Average Sequence Length | 51 residues |
| Representative Sequence | MFEQPLPRWLGWAADPEQARRAPFLARSPLFAGLPRRLLARLATRFFEK |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 16.19 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 94.29 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.571 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (14.286 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.429 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.714 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.56% β-sheet: 0.00% Coil/Unstructured: 58.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF08031 | BBE | 10.48 |
| PF01925 | TauE | 6.67 |
| PF03466 | LysR_substrate | 5.71 |
| PF00908 | dTDP_sugar_isom | 3.81 |
| PF00903 | Glyoxalase | 2.86 |
| PF01243 | Putative_PNPOx | 2.86 |
| PF12773 | DZR | 2.86 |
| PF00753 | Lactamase_B | 2.86 |
| PF13424 | TPR_12 | 1.90 |
| PF00561 | Abhydrolase_1 | 1.90 |
| PF00211 | Guanylate_cyc | 1.90 |
| PF01370 | Epimerase | 0.95 |
| PF13343 | SBP_bac_6 | 0.95 |
| PF13231 | PMT_2 | 0.95 |
| PF07719 | TPR_2 | 0.95 |
| PF01594 | AI-2E_transport | 0.95 |
| PF00528 | BPD_transp_1 | 0.95 |
| PF04932 | Wzy_C | 0.95 |
| PF12146 | Hydrolase_4 | 0.95 |
| PF00392 | GntR | 0.95 |
| PF01522 | Polysacc_deac_1 | 0.95 |
| PF12802 | MarR_2 | 0.95 |
| PF03795 | YCII | 0.95 |
| PF13458 | Peripla_BP_6 | 0.95 |
| PF00497 | SBP_bac_3 | 0.95 |
| PF13191 | AAA_16 | 0.95 |
| PF00989 | PAS | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 10.48 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 6.67 |
| COG1898 | dTDP-4-dehydrorhamnose 3,5-epimerase or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 3.81 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.90 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.95 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.95 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.95 |
| COG3307 | O-antigen ligase | Cell wall/membrane/envelope biogenesis [M] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.57 % |
| Unclassified | root | N/A | 11.43 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000891|JGI10214J12806_10408309 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1270 | Open in IMG/M |
| 3300001431|F14TB_101435453 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300004025|Ga0055433_10013012 | All Organisms → cellular organisms → Bacteria | 1338 | Open in IMG/M |
| 3300004480|Ga0062592_101750419 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300005294|Ga0065705_10505381 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300005332|Ga0066388_103884446 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 762 | Open in IMG/M |
| 3300005436|Ga0070713_100970292 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 819 | Open in IMG/M |
| 3300005438|Ga0070701_10461476 | Not Available | 817 | Open in IMG/M |
| 3300005467|Ga0070706_101910082 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 539 | Open in IMG/M |
| 3300005468|Ga0070707_101048541 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 781 | Open in IMG/M |
| 3300005518|Ga0070699_100043715 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3877 | Open in IMG/M |
| 3300005526|Ga0073909_10355073 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300005549|Ga0070704_101877317 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300005615|Ga0070702_101533549 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 549 | Open in IMG/M |
| 3300005617|Ga0068859_102947726 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 521 | Open in IMG/M |
| 3300005713|Ga0066905_100925893 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 764 | Open in IMG/M |
| 3300005875|Ga0075293_1022203 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 810 | Open in IMG/M |
| 3300005985|Ga0081539_10475937 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300006844|Ga0075428_102508067 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300006845|Ga0075421_100956779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 973 | Open in IMG/M |
| 3300006852|Ga0075433_10275396 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1491 | Open in IMG/M |
| 3300006854|Ga0075425_100027988 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6237 | Open in IMG/M |
| 3300006854|Ga0075425_101960397 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 655 | Open in IMG/M |
| 3300009038|Ga0099829_10900740 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 734 | Open in IMG/M |
| 3300009090|Ga0099827_11342610 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 622 | Open in IMG/M |
| 3300009147|Ga0114129_12281532 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300009162|Ga0075423_10258220 | All Organisms → cellular organisms → Bacteria | 1825 | Open in IMG/M |
| 3300010047|Ga0126382_11244315 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300010047|Ga0126382_11879736 | Not Available | 566 | Open in IMG/M |
| 3300010360|Ga0126372_10655579 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1017 | Open in IMG/M |
| 3300010360|Ga0126372_12638627 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 554 | Open in IMG/M |
| 3300010397|Ga0134124_11715281 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 661 | Open in IMG/M |
| 3300010401|Ga0134121_12134496 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300010403|Ga0134123_10198327 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1706 | Open in IMG/M |
| 3300011443|Ga0137457_1343875 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 508 | Open in IMG/M |
| 3300012096|Ga0137389_10067366 | All Organisms → cellular organisms → Bacteria | 2758 | Open in IMG/M |
| 3300012199|Ga0137383_10116442 | Not Available | 1947 | Open in IMG/M |
| 3300012201|Ga0137365_10111677 | Not Available | 2056 | Open in IMG/M |
| 3300012202|Ga0137363_11090004 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 679 | Open in IMG/M |
| 3300012203|Ga0137399_11223912 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 632 | Open in IMG/M |
| 3300012207|Ga0137381_11092627 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300012225|Ga0137434_1007168 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
| 3300012350|Ga0137372_10194425 | Not Available | 1628 | Open in IMG/M |
| 3300012355|Ga0137369_10018172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WSM3983 | 6707 | Open in IMG/M |
| 3300012363|Ga0137390_10677719 | Not Available | 994 | Open in IMG/M |
| 3300012929|Ga0137404_11230253 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 689 | Open in IMG/M |
| 3300012930|Ga0137407_11832946 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300012931|Ga0153915_12874146 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 562 | Open in IMG/M |
| 3300012938|Ga0162651_100097984 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300012948|Ga0126375_11275244 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 616 | Open in IMG/M |
| 3300012975|Ga0134110_10161352 | Not Available | 929 | Open in IMG/M |
| 3300014881|Ga0180094_1075792 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 749 | Open in IMG/M |
| 3300014968|Ga0157379_10975535 | Not Available | 807 | Open in IMG/M |
| 3300015053|Ga0137405_1307410 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300015373|Ga0132257_103676083 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300015374|Ga0132255_104519703 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 590 | Open in IMG/M |
| 3300017659|Ga0134083_10228000 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300017973|Ga0187780_10244646 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 1256 | Open in IMG/M |
| 3300018070|Ga0184631_10189996 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300018075|Ga0184632_10051976 | All Organisms → cellular organisms → Bacteria | 1770 | Open in IMG/M |
| 3300018429|Ga0190272_12973931 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300019377|Ga0190264_11232067 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 625 | Open in IMG/M |
| 3300019879|Ga0193723_1027877 | All Organisms → cellular organisms → Bacteria | 1711 | Open in IMG/M |
| 3300019883|Ga0193725_1038990 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
| 3300019998|Ga0193710_1002406 | All Organisms → cellular organisms → Bacteria | 1894 | Open in IMG/M |
| 3300021080|Ga0210382_10557521 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300021178|Ga0210408_10801152 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 738 | Open in IMG/M |
| 3300021560|Ga0126371_11491450 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 805 | Open in IMG/M |
| 3300025160|Ga0209109_10378358 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 663 | Open in IMG/M |
| 3300025521|Ga0210083_1011530 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300025549|Ga0210094_1008999 | All Organisms → cellular organisms → Bacteria | 1491 | Open in IMG/M |
| 3300025551|Ga0210131_1006748 | All Organisms → cellular organisms → Bacteria | 1476 | Open in IMG/M |
| 3300025904|Ga0207647_10095890 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1766 | Open in IMG/M |
| 3300025906|Ga0207699_11089242 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 591 | Open in IMG/M |
| 3300025907|Ga0207645_10054130 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2563 | Open in IMG/M |
| 3300025910|Ga0207684_10626621 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300025922|Ga0207646_10863232 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 804 | Open in IMG/M |
| 3300025922|Ga0207646_11141656 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300025922|Ga0207646_11783998 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300025923|Ga0207681_10883121 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 748 | Open in IMG/M |
| 3300025961|Ga0207712_10134755 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1887 | Open in IMG/M |
| 3300026118|Ga0207675_100750257 | Not Available | 987 | Open in IMG/M |
| 3300026285|Ga0209438_1214724 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 517 | Open in IMG/M |
| 3300026304|Ga0209240_1164590 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 679 | Open in IMG/M |
| 3300026326|Ga0209801_1146269 | Not Available | 999 | Open in IMG/M |
| 3300026469|Ga0257169_1089739 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 506 | Open in IMG/M |
| 3300027562|Ga0209735_1105807 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300027651|Ga0209217_1097044 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 845 | Open in IMG/M |
| 3300027862|Ga0209701_10097621 | All Organisms → cellular organisms → Bacteria | 1839 | Open in IMG/M |
| 3300027907|Ga0207428_10650696 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 756 | Open in IMG/M |
| 3300028711|Ga0307293_10066404 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300028784|Ga0307282_10446875 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300028807|Ga0307305_10094238 | All Organisms → cellular organisms → Bacteria | 1383 | Open in IMG/M |
| 3300028828|Ga0307312_10544091 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 767 | Open in IMG/M |
| (restricted) 3300031150|Ga0255311_1034716 | Not Available | 1053 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10193241 | Not Available | 568 | Open in IMG/M |
| 3300031740|Ga0307468_100858805 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 781 | Open in IMG/M |
| 3300031740|Ga0307468_101836415 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 575 | Open in IMG/M |
| 3300031744|Ga0306918_10438055 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1020 | Open in IMG/M |
| 3300031820|Ga0307473_11503810 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 510 | Open in IMG/M |
| 3300032174|Ga0307470_11185483 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 619 | Open in IMG/M |
| 3300032180|Ga0307471_100481064 | All Organisms → cellular organisms → Bacteria | 1386 | Open in IMG/M |
| 3300033289|Ga0310914_10615497 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 979 | Open in IMG/M |
| 3300033501|Ga0326732_1062401 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 611 | Open in IMG/M |
| 3300033513|Ga0316628_100850652 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.29% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 11.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.57% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.62% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.71% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.76% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.81% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.86% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.86% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.90% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.90% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.90% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.90% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 1.90% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.90% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.95% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.95% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.95% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.95% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.95% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.95% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.95% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.95% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.95% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300004025 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005875 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 | Environmental | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012225 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2 | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012938 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300014881 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1Da | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018070 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b1 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300019998 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m1 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
| 3300025521 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025549 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025551 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033501 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF12FN SIP fraction | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10214J12806_104083093 | 3300000891 | Soil | MLERPLPRWLAWATDPEQLRRVPFLARSPLFTGLPHRLLARLATRFFEKVYHPGEI |
| F14TB_1014354531 | 3300001431 | Soil | MLALHLPRWLAWATDPEQARRAPFLARSPLFAGLPRRLLARLATRFFEKAYRPGDIVFHE |
| Ga0055433_100130121 | 3300004025 | Natural And Restored Wetlands | MSEQHLPRWLVWAADPEQARRARFLARSPLFVGLPRRLLARL |
| Ga0062592_1017504192 | 3300004480 | Soil | MLERRLPRWLAWTIDPEQARRAPFLAHSPLFAGLPRRLLGRLSTRFLEK |
| Ga0065705_105053811 | 3300005294 | Switchgrass Rhizosphere | MFEQPLPRWLAWAADPDQLRRTPFLAGSPLFTGLPRRLLARLATR |
| Ga0066388_1038844462 | 3300005332 | Tropical Forest Soil | MLEQHLPRWLRWAEDSELARRAPFLARAPLFAGLPRRLLGRLAPRFFEKTYHPGE |
| Ga0070713_1009702923 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MFEQPLPRWLGWAADPEQARRTPFLAQSPLFAGLPRRLLARLA |
| Ga0070701_104614762 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MSERPLPRWLAWAADPEQLRRAPFLAHSPLFAGLPRRLLARLATRFFEKVY |
| Ga0070706_1019100821 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MLKRGLPRWLEWAMDREQARRAPFLAHSPLFAGLPRRLLG |
| Ga0070707_1010485412 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MPERRLPRWLAWTMDREQARRAPFLAHSPLFTGLPRRQLGRLATRFLEKAYSAGEVVFHEGD |
| Ga0070699_1000437153 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MLKRRLPRWLAWAMDPEQARRAPFLAHSPLFAGLPRRLLGRLATRFLEKAYSAGEVVFHEGDPG |
| Ga0073909_103550732 | 3300005526 | Surface Soil | MLALHLPRWLTWATDPERARRAPFLARSPLFAGLPRRLLARLATRFFE |
| Ga0070704_1018773171 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MRAMQERRLPRWLVWAIDREQARRAPFLGRSPLFAGLPRRLLGRLATRFLEKAYYPGELVFQEGDPGRA |
| Ga0070702_1015335492 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MLKRRLPRWLAWAMDPEQARRAPFLAHSPLFAGLPRRLLGRLATR |
| Ga0068859_1029477261 | 3300005617 | Switchgrass Rhizosphere | MSERPLPRWLAWAADSEQLRRTPFLAHSPLFAGLPRRLL |
| Ga0066905_1009258932 | 3300005713 | Tropical Forest Soil | MLEQYLPRWLRWAEDPEQARRAPFLARAPLFAGLPRRLLGD |
| Ga0075293_10222031 | 3300005875 | Rice Paddy Soil | MFDQPLPRWLGWATDPDQLRRTPFLASSPLFTGLPRRLLARLATRFFEK |
| Ga0081539_104759371 | 3300005985 | Tabebuia Heterophylla Rhizosphere | VGAMFEHPLPGWLSWATDPEQARRAPFLSRSPLFAGLPRRLLGRLATRFFEKTYRAGDVI |
| Ga0075428_1025080671 | 3300006844 | Populus Rhizosphere | MRAMQERRLPRWLVWAIDREQARRAPFLGRSPLFAGLPRRLLGRLATRFLEKAYYP |
| Ga0075421_1009567792 | 3300006845 | Populus Rhizosphere | MRAMQERRLPRWLVWAIDRKQARRAPFLGRSPLFAGLPRRLLGR |
| Ga0075433_102753961 | 3300006852 | Populus Rhizosphere | MLERRLPRWLAWTIDPEQARRAPFLAHSPLFAGLPRRLLGRLSTRFLEKDYAPGD |
| Ga0075425_1000279887 | 3300006854 | Populus Rhizosphere | MLERHLPRWLTWAEDPEQARRAPFLARAPLFAGLPRRLLGRLAPR |
| Ga0075425_1019603971 | 3300006854 | Populus Rhizosphere | MPLENLPRWLAWVADLKQARRVPFLAHSPLFVGLPRRHLARLATHFFEKAY |
| Ga0099829_109007402 | 3300009038 | Vadose Zone Soil | MLKWRLPRWLEWAMDREQARCAPFLAHSPLFAGLPRRLLGRLATRFLEKAYDAGEVVFHEGD |
| Ga0099827_113426102 | 3300009090 | Vadose Zone Soil | MLKRALPRWLEWAMDREQARRAPFLAHSPLFAGLPRRLLGRLATRFLEKAYSAG |
| Ga0114129_122815322 | 3300009147 | Populus Rhizosphere | MLEQRLPRWLTWAGDPERARRAPFLARSPLFAGLP |
| Ga0075423_102582203 | 3300009162 | Populus Rhizosphere | MLEQRLPRWLTWAGDPERARRAPFLARSPLFAGLPRRLLARLATRFFEKAYRPGDI |
| Ga0126382_112443152 | 3300010047 | Tropical Forest Soil | MRAMLNGRLPRWLAWARDPEQARRVPFLSHAPLFGGLRRRMLGRLGTRFLEKAYRPGDLVFQEG |
| Ga0126382_118797361 | 3300010047 | Tropical Forest Soil | MAARRGRWLAWAQDPEHRRRVALLRASPVFAGLPRRLLGRLAV |
| Ga0126372_106555791 | 3300010360 | Tropical Forest Soil | MLEQHLPRWLRWAEDSELARRAPFLARAPLFAGLPRRLLGRLAPRFFEKTYHPGEI |
| Ga0126372_126386272 | 3300010360 | Tropical Forest Soil | MLEEHLPRWLRWAEDPELARRAPFLARAPLFAGLPRRLLGRLAPRFFEKTYHPGEI |
| Ga0134124_117152811 | 3300010397 | Terrestrial Soil | MFERPLPGWLAWATDPEQLRRAPFLARSPLFVGLPRRLLGRLATRFFEKV |
| Ga0134121_121344961 | 3300010401 | Terrestrial Soil | MFEHPLPGWLSWATDPEQVRRAPFLSRSPLFAGLPRRLLGRLATRFFEKFYHAGDVIFEE |
| Ga0134123_101983271 | 3300010403 | Terrestrial Soil | MLKRRLPRWLAWAMDPEQARRAPFLAHSPLFAGLPRRLLGRLATRFLEKAYSAGEVVFH |
| Ga0137457_13438752 | 3300011443 | Soil | MFEQPLPRWLAWAEDPEQARRAPFLARSPLFAGLPRRLLARLATRFFE |
| Ga0137389_100673661 | 3300012096 | Vadose Zone Soil | MLKRGLPGWLEWAMDREQARRAPFLARSPLFAGLPRRLLGRLATRFLEKAYSAG |
| Ga0137383_101164421 | 3300012199 | Vadose Zone Soil | MLKRGLPRWLEWTMDREQARRAPFLAHSPLFAGLPRRLLGRLATRFLEKAYSAG |
| Ga0137365_101116771 | 3300012201 | Vadose Zone Soil | MLKRGLPRWLEWTMDREQARRAPFLAHSPLFAGLPRRLLGRLATRFLEKAYSAGEVVFHEGDPG |
| Ga0137363_110900042 | 3300012202 | Vadose Zone Soil | MLKRGLPRWLEWAMDREQARRAPFLAHSPLFAGLPRRLLGRL |
| Ga0137399_112239121 | 3300012203 | Vadose Zone Soil | MPERRLSRWLAWARDHEQARRAPFLARSPLFAGLPRRLLGRLATRFLEKAYSAGE |
| Ga0137381_110926271 | 3300012207 | Vadose Zone Soil | MFEQPLPRWLAWAADPDQLRRAPFLAGSPLFTGLPRRLLARLATRFFEKVYHPGEVVFEEGDPGRAL |
| Ga0137434_10071681 | 3300012225 | Soil | MFEQPLPRWLAWAEDPEQARRATFLARSPLFAGLPRRLLARLATRFFEKVYHPGEVVFEE |
| Ga0137372_101944251 | 3300012350 | Vadose Zone Soil | MLKRGLPRWLEWTMDREQARRAPFLAHSPLFAGLPRRLLGRLATR |
| Ga0137369_1001817210 | 3300012355 | Vadose Zone Soil | MQERRLRQWLAWAMDREQARRAPFLARSPLFAGLPRRLLGRLATRFLEKAYDSGEVVF |
| Ga0137390_106777191 | 3300012363 | Vadose Zone Soil | MFEQPLPRWLAWATDPEQVRRAPFLSRSPLFTGLPRRLLARLSTRFFE |
| Ga0137404_112302531 | 3300012929 | Vadose Zone Soil | MPDRRLSRWLAWARDHEQARRAPFLARSPLFAGLPRRLLGRLATRFLEKAYSAGEVVFHEGDPG |
| Ga0137407_118329461 | 3300012930 | Vadose Zone Soil | MFEQPLPRWLAWAADPDQLRRAPFLAGSPLFTGLPRRLLA |
| Ga0153915_128741462 | 3300012931 | Freshwater Wetlands | MFEQPLPRWLAWAADPEQLRRAPFLAGSPLFTGLPRRLLARL |
| Ga0162651_1000979842 | 3300012938 | Soil | MFEQPLPRWLAWAADPDQLRRTPFLAGSPLFTGLPRRLLARLATRFFEKVYH |
| Ga0126375_112752442 | 3300012948 | Tropical Forest Soil | MLEQYLPRWLRWAEDPEQARRAPFLARAPLFAGLPRRLLGRLAPRFFEKTYHAGEIVFHEGD |
| Ga0134110_101613521 | 3300012975 | Grasslands Soil | MLKRGLPRWLEWTMDREQARRAPLLAHSPLFAGLP |
| Ga0180094_10757921 | 3300014881 | Soil | MPDRRLRRWLAWAMDREQARRAPFLSHSPLFAGLPRRMLGR |
| Ga0157379_109755352 | 3300014968 | Switchgrass Rhizosphere | MSERRLPGWLAWAADPEQLRRAPFLAHSPLFAGLP |
| Ga0137405_13074101 | 3300015053 | Vadose Zone Soil | MLAQRLPRWLVWATDPEQARRAPFLARSPLFAGLPRRLL |
| Ga0132257_1036760831 | 3300015373 | Arabidopsis Rhizosphere | VGTMFEHPLPGWLSWATDPEQVRRAPFLSRSPLFAGLPRRLLGRLATRFFEKF |
| Ga0132255_1045197032 | 3300015374 | Arabidopsis Rhizosphere | MFEQPLPRWLGWAGDPEQMRRAPFLAGSPLFTGLPRRLLARLATRFFEKTYRRGEIVFE |
| Ga0134083_102280002 | 3300017659 | Grasslands Soil | MLEERLPRWLTWAGDPERARRAPFLARSPLFAGLPRRLLARLA |
| Ga0187780_102446461 | 3300017973 | Tropical Peatland | MFERPVPRWLAWATDPEQLRRAPFLARSPLFSGLPRRLL |
| Ga0184631_101899962 | 3300018070 | Groundwater Sediment | MFELPLPRWLAWAADPEQQRRAPFLARSPLFAGLPRRLLARLATRFFEKVYRPGDIVF |
| Ga0184632_100519763 | 3300018075 | Groundwater Sediment | MFERPLPRWLAWAADPEQLRRAPFLARSPLFAGLPRRLLARLATRFFEKV |
| Ga0190272_129739311 | 3300018429 | Soil | MFEQPLPRWLAWAADPDQLRRTPFLAGSPLFTGLPRRLLARLATRLFEKVYHPGEIVFEAGDPGRAL |
| Ga0190264_112320671 | 3300019377 | Soil | MLERRLPRWLAWAIDREQARRAPFLAHSPLFAGLPRRLLGRLGTRFLEKCYSAGE |
| Ga0193723_10278771 | 3300019879 | Soil | MFEPPLPRWLGWAADPEQLRRAPFLARSPLFAGLPRRLLGRLATR |
| Ga0193725_10389902 | 3300019883 | Soil | MFEQPLPRWLAWAADPDQLRRAPFLAGSPLFTGLPRRLLARLATRFFEKVYHPGEIVFEE |
| Ga0193710_10024061 | 3300019998 | Soil | MFERPLPRWLGWAADPEQLRRAPFLARSPLFAGLPRRLLGRLATRFFE |
| Ga0210382_105575211 | 3300021080 | Groundwater Sediment | MFEQPLPRWLAWAADPDQLRRTPFLAGSPLFTGLPRRLLARLATRFFEKVYHPGEIVFEEGDPGR |
| Ga0210408_108011522 | 3300021178 | Soil | MAERPLPRWLAWAADPEQLRRAPFLARSPLFTGLPRRLLARLATRFFEKAYRPGEV |
| Ga0126371_114914502 | 3300021560 | Tropical Forest Soil | MLEQHLPRWLRWAEDPELARRAPFLARAPLFAGLPRRLLGRLAPRFF |
| Ga0209109_103783582 | 3300025160 | Soil | MLSGLPRWLGWVRDPEHVRRVTVLARAPVFAGLPRRLLGR |
| Ga0210083_10115301 | 3300025521 | Natural And Restored Wetlands | MSEQHLPRWLVWAADPEQARRARFLARSPLFVGLPRRLLARLA |
| Ga0210094_10089991 | 3300025549 | Natural And Restored Wetlands | MSEQHLPRWLVWAADPEQARRARFLARSPLFVGLPRRLL |
| Ga0210131_10067481 | 3300025551 | Natural And Restored Wetlands | MSEQHLPRWLVWAADPEQARRARFLARSPLFVGLPRRLLARLAPRFFE |
| Ga0207647_100958901 | 3300025904 | Corn Rhizosphere | MFEHPLPGWLSWATDPEQVRRAPFLSRSPLFAGLPRRLLGR |
| Ga0207699_110892421 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MFEQPLPRWLGWAADPEQARRAPFLARSPLFAGLPRRLLARLATRFFEKVYHADDV |
| Ga0207645_100541301 | 3300025907 | Miscanthus Rhizosphere | MFERPLPGWLAWATDPEQLRRAPFLARSPLFVGLPRRLLGR |
| Ga0207684_106266212 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VGAMFEHPLPGWLSWATDPEQVRRAPFLSRSPLFAGLPRRLL |
| Ga0207646_108632321 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MPERRLPRWLAWTMDREQARRAPFLAHSPLFTGLPRRQLGRLATRFLEKAYSAGE |
| Ga0207646_111416563 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MAERRLPRWLAWAADPEQLRRAPFLARSPLFAGLPRRLLARLATRFLEKVYR |
| Ga0207646_117839981 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MFEQPLPRWLAWAADPDQLRRTPFLAGSPLFTGLPRRLLARLATRFFEKVYHPGEVVFEEGDP |
| Ga0207681_108831211 | 3300025923 | Switchgrass Rhizosphere | MFERPLPGWLAWATDPEQLRRAPFLARSPLFVGLPRRLLGRLATRFFEKVYHPGEVIF |
| Ga0207712_101347552 | 3300025961 | Switchgrass Rhizosphere | MFERPLPGWLAWATDPEQLRRAPFLARSPLFVGLPRRLLGRLATRFFEKVYHPGEVIFEVGD |
| Ga0207675_1007502571 | 3300026118 | Switchgrass Rhizosphere | MSERRLPRWLAWAADPEQLRRAPFLARSPLFAGLPRRLLARLGTRFLEKVYRPGEVV |
| Ga0209438_12147241 | 3300026285 | Grasslands Soil | MFEQPLPRWLAWATDPEQVRRAPFLSSSPLFTGLPRRLLARLATRFFEKVYHP |
| Ga0209240_11645901 | 3300026304 | Grasslands Soil | MFEQPLPRWLAWATDPEQVRRAPFLSRSPLFTGLPRRLLARLSTRFFEKAYHPGEVVFEEGDPGRA |
| Ga0209801_11462692 | 3300026326 | Soil | MLKRGLPRWLEWTMDREQARRAPFLAHSPLFAGLPRRLLGRLATRFLEKAYS |
| Ga0257169_10897391 | 3300026469 | Soil | MFEQPLPRWLAWATDPEQVRRAPFLSSSPLFTGLPRRLLARLSTRFFEKA |
| Ga0209735_11058071 | 3300027562 | Forest Soil | MSERPLPRWLAWAADPEQLRRAPFLARSPLFAGLPRRLLARLATR |
| Ga0209217_10970442 | 3300027651 | Forest Soil | MFEQPLPRWLGWAADPEQARRAPFLARSPLFAGLPRRLLARLATRFFEK |
| Ga0209701_100976213 | 3300027862 | Vadose Zone Soil | VRAVLKRGLPRWLEWAMDREQARRAPFLAHSPLFAG |
| Ga0207428_106506962 | 3300027907 | Populus Rhizosphere | MALMHAMLERRLPRWLAWTIDPEQARRAPFLAHAPLFAGLPRRLLGRLSTRFLEKDYAPGDMVFHEGDP |
| Ga0307293_100664041 | 3300028711 | Soil | MFEQPLPRWLAWAADPDQLRRTPFLAGSPLFTGLPRRLL |
| Ga0307282_104468752 | 3300028784 | Soil | MFEQPLPRWLAWAADPDQLRRTPFLAGSPLFTGLPRRLLARLA |
| Ga0307305_100942382 | 3300028807 | Soil | MFEQPLPRWLAWAADPEQLRRAPFLARSPLFAGLPRRMLGRLATRFLEKAYYPGEFVFHE |
| Ga0307312_105440912 | 3300028828 | Soil | MLERRLPRWLAWAIDREQARRAPFLAHSPLFAGLPRRLLGRLGTRFLEK |
| (restricted) Ga0255311_10347161 | 3300031150 | Sandy Soil | VLKRGLPRWLEWAMDREQAQRAPFLAHSPLFAGLPRRLLGR |
| (restricted) Ga0255310_101932411 | 3300031197 | Sandy Soil | MFERPLPRWLAWAADPEQLRRAPFLASAPLFAGLPRRLLARLAT |
| Ga0307468_1008588051 | 3300031740 | Hardwood Forest Soil | MFEQPLPRWLGWAADPEQARRTPFLAQSPLFAGLPRRLLA |
| Ga0307468_1018364152 | 3300031740 | Hardwood Forest Soil | VNTLLERRLPRWLAWTIDPEQARRAPFLSHSPLFAGLPRRLLGRLATR |
| Ga0306918_104380552 | 3300031744 | Soil | MLEQHLPRWLRWAEDPEQARRAPFLARAPLFAGLPRRLLGRLAPRFFEKTYHAGEIVFHEGDPGR |
| Ga0307473_115038102 | 3300031820 | Hardwood Forest Soil | MFEQPLPRWLGWAADPEQARRTPFLAQSPLFAGLPRRLLARLATRFFEKVYHADD |
| Ga0307470_111854833 | 3300032174 | Hardwood Forest Soil | MFEQPLPRWLGWAADPEQARRAPFLARSPLFAGLPRRLLARLATRFFEKV |
| Ga0307471_1004810641 | 3300032180 | Hardwood Forest Soil | MFEQPLPRWLGWAADPEQARRAPFLARSPLFAGLPRRLLARLATRFFEKVYHA |
| Ga0310914_106154972 | 3300033289 | Soil | MLEQHLPRWLRWAEDPEQARRAPFLARAPLFAGLPRRLLGRLAPRFFEKTYHAGEIVF |
| Ga0326732_10624012 | 3300033501 | Peat Soil | MSEQHLPRWLVWAADPEQARRARFLARSPLFVGLPRRLLARLAPRFFEKTY |
| Ga0316628_1008506521 | 3300033513 | Soil | MSDHPLPRWLAWAADPDQLRRTPFLASSPLFTGLPRR |
| ⦗Top⦘ |