| Basic Information | |
|---|---|
| Family ID | F096150 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 44 residues |
| Representative Sequence | SIRGYLASFPDAGAAAADMRRRFKFLGDTGVWRLLTSASRDIG |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 97.14 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (63.810 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (40.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.762 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.857 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 72.09% β-sheet: 0.00% Coil/Unstructured: 27.91% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF02604 | PhdYeFM_antitox | 8.57 |
| PF00884 | Sulfatase | 7.62 |
| PF13193 | AMP-binding_C | 5.71 |
| PF01850 | PIN | 2.86 |
| PF02566 | OsmC | 1.90 |
| PF02776 | TPP_enzyme_N | 1.90 |
| PF01613 | Flavin_Reduct | 1.90 |
| PF08240 | ADH_N | 1.90 |
| PF01197 | Ribosomal_L31 | 0.95 |
| PF13577 | SnoaL_4 | 0.95 |
| PF09594 | GT87 | 0.95 |
| PF00933 | Glyco_hydro_3 | 0.95 |
| PF12840 | HTH_20 | 0.95 |
| PF01726 | LexA_DNA_bind | 0.95 |
| PF05988 | DUF899 | 0.95 |
| PF06628 | Catalase-rel | 0.95 |
| PF07362 | CcdA | 0.95 |
| PF00440 | TetR_N | 0.95 |
| PF00571 | CBS | 0.95 |
| PF12680 | SnoaL_2 | 0.95 |
| PF13462 | Thioredoxin_4 | 0.95 |
| PF05239 | PRC | 0.95 |
| PF04248 | NTP_transf_9 | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 8.57 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 8.57 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 1.90 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 1.90 |
| COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 1.90 |
| COG0254 | Ribosomal protein L31 | Translation, ribosomal structure and biogenesis [J] | 0.95 |
| COG0753 | Catalase | Inorganic ion transport and metabolism [P] | 0.95 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 0.95 |
| COG2343 | Uncharacterized conserved protein, DUF427 family | Function unknown [S] | 0.95 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.95 |
| COG5302 | Post-segregation antitoxin (ccd killing mechanism protein) encoded by the F plasmid | Mobilome: prophages, transposons [X] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 64.76 % |
| Unclassified | root | N/A | 35.24 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573003|GZIR7W402JFE8D | Not Available | 524 | Open in IMG/M |
| 3300005332|Ga0066388_107234502 | Not Available | 558 | Open in IMG/M |
| 3300005337|Ga0070682_100105622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1867 | Open in IMG/M |
| 3300005435|Ga0070714_100575549 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
| 3300005439|Ga0070711_101224206 | Not Available | 650 | Open in IMG/M |
| 3300005445|Ga0070708_100124154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2385 | Open in IMG/M |
| 3300005537|Ga0070730_10934226 | Not Available | 542 | Open in IMG/M |
| 3300005591|Ga0070761_10107422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1613 | Open in IMG/M |
| 3300005616|Ga0068852_100746758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 990 | Open in IMG/M |
| 3300005921|Ga0070766_10238886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1149 | Open in IMG/M |
| 3300006028|Ga0070717_11842250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 546 | Open in IMG/M |
| 3300006028|Ga0070717_11942115 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300006163|Ga0070715_10017661 | All Organisms → cellular organisms → Bacteria | 2704 | Open in IMG/M |
| 3300006173|Ga0070716_101700217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 520 | Open in IMG/M |
| 3300006175|Ga0070712_100848855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 785 | Open in IMG/M |
| 3300006175|Ga0070712_101513357 | Not Available | 586 | Open in IMG/M |
| 3300006176|Ga0070765_100603738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 1035 | Open in IMG/M |
| 3300006176|Ga0070765_100763175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 914 | Open in IMG/M |
| 3300006176|Ga0070765_101522093 | Not Available | 630 | Open in IMG/M |
| 3300006176|Ga0070765_101659904 | Not Available | 600 | Open in IMG/M |
| 3300006755|Ga0079222_10065630 | All Organisms → cellular organisms → Bacteria | 1761 | Open in IMG/M |
| 3300006854|Ga0075425_100533237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1351 | Open in IMG/M |
| 3300007255|Ga0099791_10583337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 546 | Open in IMG/M |
| 3300009525|Ga0116220_10453056 | Not Available | 578 | Open in IMG/M |
| 3300009683|Ga0116224_10121149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1266 | Open in IMG/M |
| 3300009700|Ga0116217_10446875 | Not Available | 816 | Open in IMG/M |
| 3300010361|Ga0126378_13463580 | Not Available | 500 | Open in IMG/M |
| 3300010375|Ga0105239_10891680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1021 | Open in IMG/M |
| 3300010396|Ga0134126_12469589 | Not Available | 565 | Open in IMG/M |
| 3300012207|Ga0137381_11011440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. Ag82_O1-15 | 717 | Open in IMG/M |
| 3300012356|Ga0137371_11059706 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300012924|Ga0137413_10956996 | Not Available | 669 | Open in IMG/M |
| 3300013296|Ga0157374_10722803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1010 | Open in IMG/M |
| 3300013306|Ga0163162_12314747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 617 | Open in IMG/M |
| 3300013307|Ga0157372_12566502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 585 | Open in IMG/M |
| 3300016270|Ga0182036_11789393 | Not Available | 520 | Open in IMG/M |
| 3300016319|Ga0182033_11091968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 712 | Open in IMG/M |
| 3300017657|Ga0134074_1316691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_71_11 | 571 | Open in IMG/M |
| 3300017821|Ga0187812_1181408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes bogorensis | 674 | Open in IMG/M |
| 3300017937|Ga0187809_10257076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 633 | Open in IMG/M |
| 3300020581|Ga0210399_10711693 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300020582|Ga0210395_10206159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1475 | Open in IMG/M |
| 3300021088|Ga0210404_10335684 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 837 | Open in IMG/M |
| 3300021178|Ga0210408_10301769 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1277 | Open in IMG/M |
| 3300021181|Ga0210388_10434078 | Not Available | 1154 | Open in IMG/M |
| 3300021181|Ga0210388_10982864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 724 | Open in IMG/M |
| 3300021402|Ga0210385_10124091 | Not Available | 1825 | Open in IMG/M |
| 3300021403|Ga0210397_10359813 | Not Available | 1080 | Open in IMG/M |
| 3300021403|Ga0210397_11510694 | Not Available | 521 | Open in IMG/M |
| 3300021403|Ga0210397_11625358 | Not Available | 501 | Open in IMG/M |
| 3300021404|Ga0210389_10256140 | Not Available | 1369 | Open in IMG/M |
| 3300021405|Ga0210387_10547375 | Not Available | 1029 | Open in IMG/M |
| 3300021406|Ga0210386_10941216 | Not Available | 738 | Open in IMG/M |
| 3300021407|Ga0210383_10702132 | Not Available | 869 | Open in IMG/M |
| 3300021475|Ga0210392_10121438 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus | 1749 | Open in IMG/M |
| 3300022529|Ga0242668_1038489 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 811 | Open in IMG/M |
| 3300022724|Ga0242665_10402160 | Not Available | 501 | Open in IMG/M |
| 3300025906|Ga0207699_10243562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1236 | Open in IMG/M |
| 3300025914|Ga0207671_10246313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1405 | Open in IMG/M |
| 3300025916|Ga0207663_10315304 | Not Available | 1173 | Open in IMG/M |
| 3300025916|Ga0207663_11554110 | Not Available | 533 | Open in IMG/M |
| 3300025922|Ga0207646_11083355 | Not Available | 706 | Open in IMG/M |
| 3300025928|Ga0207700_10457804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. E2699 | 1125 | Open in IMG/M |
| 3300025941|Ga0207711_11136137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 722 | Open in IMG/M |
| 3300025949|Ga0207667_10946335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 851 | Open in IMG/M |
| 3300025981|Ga0207640_11960920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 530 | Open in IMG/M |
| 3300026035|Ga0207703_11647335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 617 | Open in IMG/M |
| 3300026497|Ga0257164_1093501 | Not Available | 516 | Open in IMG/M |
| 3300027063|Ga0207762_1056634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 571 | Open in IMG/M |
| 3300027064|Ga0208724_1010516 | Not Available | 886 | Open in IMG/M |
| 3300027787|Ga0209074_10530772 | Not Available | 515 | Open in IMG/M |
| 3300027795|Ga0209139_10320036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 544 | Open in IMG/M |
| 3300027853|Ga0209274_10344821 | Not Available | 767 | Open in IMG/M |
| 3300028023|Ga0265357_1029599 | Not Available | 623 | Open in IMG/M |
| 3300028906|Ga0308309_10886909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 774 | Open in IMG/M |
| 3300029701|Ga0222748_1095503 | Not Available | 572 | Open in IMG/M |
| 3300030730|Ga0307482_1059929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 951 | Open in IMG/M |
| 3300030738|Ga0265462_12617676 | Not Available | 505 | Open in IMG/M |
| 3300031543|Ga0318516_10416430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 773 | Open in IMG/M |
| 3300031561|Ga0318528_10046044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2195 | Open in IMG/M |
| 3300031573|Ga0310915_10878988 | Not Available | 629 | Open in IMG/M |
| 3300031663|Ga0307484_117112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 530 | Open in IMG/M |
| 3300031708|Ga0310686_104512490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 558 | Open in IMG/M |
| 3300031715|Ga0307476_11259873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 540 | Open in IMG/M |
| 3300031718|Ga0307474_11569890 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300031768|Ga0318509_10072473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1810 | Open in IMG/M |
| 3300031769|Ga0318526_10327274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 627 | Open in IMG/M |
| 3300031769|Ga0318526_10473969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 511 | Open in IMG/M |
| 3300031771|Ga0318546_10347917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharothrix → Saccharothrix carnea | 1031 | Open in IMG/M |
| 3300031771|Ga0318546_10831019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 650 | Open in IMG/M |
| 3300031782|Ga0318552_10704143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 515 | Open in IMG/M |
| 3300031798|Ga0318523_10175021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1070 | Open in IMG/M |
| 3300031821|Ga0318567_10474553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharothrix → Saccharothrix carnea | 710 | Open in IMG/M |
| 3300031845|Ga0318511_10606456 | Not Available | 511 | Open in IMG/M |
| 3300031846|Ga0318512_10117992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1260 | Open in IMG/M |
| 3300031846|Ga0318512_10439103 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300031859|Ga0318527_10342517 | Not Available | 637 | Open in IMG/M |
| 3300031896|Ga0318551_10360733 | Not Available | 823 | Open in IMG/M |
| 3300032035|Ga0310911_10343470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 861 | Open in IMG/M |
| 3300032035|Ga0310911_10730880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_71_11 | 573 | Open in IMG/M |
| 3300032035|Ga0310911_10747888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 566 | Open in IMG/M |
| 3300032043|Ga0318556_10462257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharothrix → Saccharothrix carnea | 664 | Open in IMG/M |
| 3300032180|Ga0307471_101361767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 871 | Open in IMG/M |
| 3300033290|Ga0318519_10454708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharothrix → Saccharothrix carnea | 767 | Open in IMG/M |
| 3300033290|Ga0318519_10851150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 562 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 40.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 12.38% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 7.62% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.76% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.81% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.86% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.90% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.90% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.95% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.95% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.95% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.95% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.95% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.95% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573003 | Grass soil microbial communities from Rothamsted Park, UK - FE2 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300022529 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300027063 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes) | Environmental | Open in IMG/M |
| 3300027064 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF003 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031663 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FE2_07200720 | 2189573003 | Grass Soil | LDSCGSIRGYLASFPDVGAAAADMRRRFKFLGDTGVWRLLTSASRDIG |
| Ga0066388_1072345021 | 3300005332 | Tropical Forest Soil | LDEYGSIRGYLASFPDASAAAADMRRRFKFLGDTGMWRLLTSASRDIG* |
| Ga0070682_1001056224 | 3300005337 | Corn Rhizosphere | GEYGSIRGYLASFLDAGAAAADMRRRFKFLGDTGVWRLLTSASHDIG* |
| Ga0070714_1005755494 | 3300005435 | Agricultural Soil | GSIRAYLASFPDAHAAAADMRRRFKFLGDTGVWRLLIGAARDIGG* |
| Ga0070711_1012242062 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | FASFPDAHAASADMRRRFRFLGDTGVWRFLNGAARDIGG* |
| Ga0070708_1001241543 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VENAREVLAVLDSYGSIRAYFASFPDAHTASADMRRRFEFLGDTGVWRLLISAARDIGG* |
| Ga0070730_109342261 | 3300005537 | Surface Soil | YLASFPDARSAANDLHRRFKFLGDTGVWRLLTTAARDLG* |
| Ga0070761_101074221 | 3300005591 | Soil | YGSIRGYLASFPDAAAATADMRRRFKFLGNTGVWRLLTSAAGDNSW* |
| Ga0068852_1007467581 | 3300005616 | Corn Rhizosphere | LASFLDAGAAAADMRRRFKFLGDTGVWRLLTSASHAIG* |
| Ga0070766_102388863 | 3300005921 | Soil | YGSIRGYLASFPDAGAAAADMRRRFKFLGDTGVWRLLTSASRDIG* |
| Ga0070717_118422501 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | ASFLDAGAAAADMRRRFKFLGDTGVWRLLTSASRDIG* |
| Ga0070717_119421152 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | AILDSYGSIHAYFASFEDAPAASRDLQRRFKFIGEAGVQRLLSSAARDIGG* |
| Ga0070715_100176615 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | YLASFLDAGAAAADMRRRFKFLGDTGVWRLLTSASRDIG* |
| Ga0070716_1017002171 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | FLDAGAAAADMRRRFKFLGDTGVWRLLTSGSRDIG* |
| Ga0070712_1008488552 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | SFLDAGAAAADMRRRFKFLGDTGVWRLLTSASRDIG* |
| Ga0070712_1015133573 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LASFPDAGAAAADMRRRFEFLGDTGVWRLLTSASRDIG* |
| Ga0070765_1006037383 | 3300006176 | Soil | IRGYLASFPDAGAAAADMRRRFKFLGDTGVWRLLTSASRDIG* |
| Ga0070765_1007631751 | 3300006176 | Soil | SIRGYLASFPDAGAAAADMRRRFKFLGDTGVWRLLTSASRDIG* |
| Ga0070765_1015220931 | 3300006176 | Soil | NAREVLAILDEYGSIRGYLASSPDAGAAAADMRRRFKFLGDTGVWRLLTSASRDIE* |
| Ga0070765_1016599041 | 3300006176 | Soil | LDEYGSIRGYLASFPDAGAAAADMRRRFKFLGDTGVWRLLTSASRDIG* |
| Ga0079222_100656301 | 3300006755 | Agricultural Soil | LASFLDAGAAAADMRRRFKFLGDTGVWRLLTSASRDIG* |
| Ga0075425_1005332371 | 3300006854 | Populus Rhizosphere | LDAGAAAADMRRRFKFLGDTGVWRLLTSASRDIG* |
| Ga0099791_105833372 | 3300007255 | Vadose Zone Soil | LASSPDAGAAAADMRRRFKFLGDTGVWRLLTSASRDIE* |
| Ga0116220_104530563 | 3300009525 | Peatlands Soil | AYGSIRAYLASFPDAHAASADMRRRFKFLGDTGVWRFLISAARDICG* |
| Ga0116224_101211493 | 3300009683 | Peatlands Soil | SPDAGAAAADMRRRFKFLGDTGVWRLLTSASRDIE* |
| Ga0116217_104468751 | 3300009700 | Peatlands Soil | GSFSDARSAAGDLHRRFRFPGDAGVWRLLTSAARDLG* |
| Ga0126378_134635802 | 3300010361 | Tropical Forest Soil | SFPDARSAAADLHGRFRFLGDAGVWRLLTSAAQDAG* |
| Ga0105239_108916802 | 3300010375 | Corn Rhizosphere | EYGSIRGYLASFLDAGAAAADMRRRFKFLGDTGVWRLLTSGSRDIG* |
| Ga0134126_124695891 | 3300010396 | Terrestrial Soil | ASFPDAGAAAADMRRRFKFLGDTGVWRLLTSASRDIG* |
| Ga0137381_110114402 | 3300012207 | Vadose Zone Soil | FPDAHAASADMRRRFKFLGDTGVWRLLITAARDIGG* |
| Ga0137371_110597062 | 3300012356 | Vadose Zone Soil | IRGYLASFLDAGVAAADMRRRFKFLGDTGVWRLLTSGSRDIG* |
| Ga0137413_109569962 | 3300012924 | Vadose Zone Soil | VLAILDEYGSIRGYLASSPDAGAAAADMRRRFKFLGDTGVWRLLTSASRDIE* |
| Ga0157374_107228031 | 3300013296 | Miscanthus Rhizosphere | LASFPDAGAAAADMRRRFKFLGDTGVWRLLTSASRDIG* |
| Ga0163162_123147472 | 3300013306 | Switchgrass Rhizosphere | EVLAILGEYGSIRGYLASFLDAGAAAADMRRRFKFLGDTGVWRLLTSASHDIG* |
| Ga0157372_125665022 | 3300013307 | Corn Rhizosphere | SIRGYLASFPDAGAAAADMRRRFKFLGDTGVWRLLTSGSRDIG* |
| Ga0182036_117893932 | 3300016270 | Soil | ASFPDAGAAAADLRRRFKFLGDTGVWRLLTSASRDIG |
| Ga0182033_110919681 | 3300016319 | Soil | YGSIRGYLASFPDAGAAAADLRRRFKFLGDTGVWRLLTSASRDIG |
| Ga0134074_13166911 | 3300017657 | Grasslands Soil | VLDSYGSIRAYFASFPDAHAASSDMRRRFKFLGDTGVWRLLTSAARDIGG |
| Ga0187812_11814081 | 3300017821 | Freshwater Sediment | YLASFPDARSAAGALRRRFKFLGDTGVWRLLTSAARDV |
| Ga0187809_102570761 | 3300017937 | Freshwater Sediment | VENAREVLAILDACGSIRGYLASFPDAGAATADMRRRFKFLGDTGTWRLLTSASRDIG |
| Ga0210399_107116933 | 3300020581 | Soil | RGYLASFPDAAAAAADMRRRFKFLGDTGVWRLLTGASRDIG |
| Ga0210395_102061591 | 3300020582 | Soil | TSFPEADAAAAEMRRRFKFLGDTGVWRLLTSAARDIG |
| Ga0210404_103356841 | 3300021088 | Soil | NAREILAILDQYGRIRGYLASFPDAGAAATDMRRRFKFLGDTGVWRLLTSASRDIG |
| Ga0210408_103017691 | 3300021178 | Soil | DEYGSIRGYLASFPDAAAAAADLRRRFKFLGDTGVWRLLISASHDIG |
| Ga0210388_104340781 | 3300021181 | Soil | GEILAILDQYGRIRGYLASFPDAGAAAADMRRRFKFLGDTGVWRLLTSASRDIG |
| Ga0210388_109828641 | 3300021181 | Soil | LAILDEYGSIRGYLASFPDAAAAAADLRRRFKFLGDTGVWRLLTSASRDIG |
| Ga0210385_101240913 | 3300021402 | Soil | SFPDAGAAATDMRRRFKFLGDTGVWRLLTSASRDIG |
| Ga0210397_103598131 | 3300021403 | Soil | FPDASAAATDMRRRFKFLGDTGVWRLLTSASRDIG |
| Ga0210397_115106941 | 3300021403 | Soil | REVLAILDEYGSIRGYLASFPDAGAAAADMRRRFKFLGDTGVWRLLTSAARDIG |
| Ga0210397_116253581 | 3300021403 | Soil | GSIRGYLASFPDAAAAAADLRRRFKFLGDTGVWRLLISASHDIG |
| Ga0210389_102561401 | 3300021404 | Soil | DQYGRIRGYLASFPDAGAAATDMRRRFKFLGDTGVWRLLTSASRDIG |
| Ga0210387_105473752 | 3300021405 | Soil | NAREVLAILNEYRSIRGYLASFPDAGAAAADMRRRFKFLGDTGVWRLLTSASRDIG |
| Ga0210386_109412161 | 3300021406 | Soil | YLASFPDASAAAADMRRRFKFLGDTGVWRLLTSASRDIG |
| Ga0210383_107021321 | 3300021407 | Soil | LASFPDAGAAAADMRRRFKFLGDTGVWRLLTSASRDIG |
| Ga0210392_101214384 | 3300021475 | Soil | DEHGSIRGYLASFPDAGAAAADMRRRFKFLGDTGVWRLLTSASRDIG |
| Ga0242668_10384891 | 3300022529 | Soil | RGYLASFPDAAAAAADLRRRFKFLGETGVWRLLTSASRDIG |
| Ga0242665_104021601 | 3300022724 | Soil | LASFPDAAAAAADLRRRFKFLGDTGVWRLLISASHDIG |
| Ga0207699_102435621 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | GYLASFPDAGAAAADMRRRFKFLGDTGVWRLLTSASRDIG |
| Ga0207671_102463131 | 3300025914 | Corn Rhizosphere | REVLAILGEYGSIRGYLASFLDAGAAAADMRRRFKFLGDTGVWRLLTSASHDIG |
| Ga0207663_103153041 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | YRSIRGYLASFPDAGAAAADMRRRFKFLGDTGVWRLLTSASRDIG |
| Ga0207663_115541102 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | FASFPDAHAASADMRRRFRFLGDTGVWRFLNGAARDIGG |
| Ga0207646_110833551 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | YLASFPDAAVAAGDMRRRFKFLGDTGVWRLLTSASRDIG |
| Ga0207700_104578041 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | QVQAVLDSHGSIRAYLASFPDAHAAAADMRRRFKFLGDTGVWRLLIGAARDIGG |
| Ga0207711_111361371 | 3300025941 | Switchgrass Rhizosphere | YLASFLDAGAAAADMRRRFKFLGDTGVWRLLTSASRDIG |
| Ga0207667_109463352 | 3300025949 | Corn Rhizosphere | SIRGYLASFLDAGAAAADMRRRFKFLGDTGVWRLLTSASRDIG |
| Ga0207640_119609201 | 3300025981 | Corn Rhizosphere | LASFLDAGAAAADMRRRFKFLGDTGVWRLLTSASRDIG |
| Ga0207703_116473352 | 3300026035 | Switchgrass Rhizosphere | GSIRGYLASFLDAGAAAADMRRRFKFLGDTGVWRLLTSASHDIG |
| Ga0257164_10935011 | 3300026497 | Soil | IRGYLASFPDASAAATDMRRRFKFLGDTGVWRLLTSASRDIE |
| Ga0207762_10566342 | 3300027063 | Tropical Forest Soil | ILDEHGSIRGYLASFPGAGAAGADMRQRFKFLGDTGTWRLLTSASRDIG |
| Ga0208724_10105161 | 3300027064 | Forest Soil | FPDAAAAAADMRRRFKFLGDTGVWRLLTSASRDLG |
| Ga0209074_105307721 | 3300027787 | Agricultural Soil | VLAILGEYGDIRGYLASFLDAGAAAADMRRRFKFLGDTGVWRLLTSASRDIG |
| Ga0209139_103200361 | 3300027795 | Bog Forest Soil | DEYGSIRGYLASFPDAAAAAADMRRRFKFLGDTGVWRLLTSAARDIGGDGRP |
| Ga0209274_103448212 | 3300027853 | Soil | LDEYGSIRAYLASWPDAGAAAADMRRRFKFLGDTGVWRLLTSASRDIE |
| Ga0265357_10295991 | 3300028023 | Rhizosphere | LAILDEYGSVRGYLASFPDAGAAAADMRRRFKFLGDTGVWRLLTSASRDIG |
| Ga0308309_108869091 | 3300028906 | Soil | VLAILGEYGSIRGYLASFLDAGAAAADMRRRFKFLGDTGVWRLLTSASRDIG |
| Ga0222748_10955031 | 3300029701 | Soil | QNAREILAILDQYGRIRGYLASFPDAGAAATDMRRRFKFLGDTGVWRLLTSASRDIG |
| Ga0307482_10599292 | 3300030730 | Hardwood Forest Soil | LAILDEYGSIRGYLASFPDAGAAAADLRRRFKFLGDTGVWRLLISASRDIG |
| Ga0265462_126176761 | 3300030738 | Soil | AREVLAILDEYGSIRGYLASFPDAAAAAADLRRRFKFLGDTGVWRLLTSASHDIG |
| Ga0318516_104164302 | 3300031543 | Soil | AILDEYGSIRGYLASFPDAGAAAADMRRRFKFLGDTGIWRLLTSASRDIG |
| Ga0318528_100460443 | 3300031561 | Soil | LGSFPDAGAAAADMRRRFKFLGDTGTWRLLTGASRDIG |
| Ga0310915_108789882 | 3300031573 | Soil | ILGAHGSIRAYLATFPDARSAAGALRRRFKYLGDTGVWRLLTSAARDA |
| Ga0307484_1171123 | 3300031663 | Hardwood Forest Soil | GYLASFPDAAAAGADMRRRFKFLGDTGVWRLLTSASRDLG |
| Ga0310686_1045124902 | 3300031708 | Soil | EVLAILDEYGSIRGYLASFPDAAAAAADMRRRFKFVGDTGVWRLLTSAARDIGG |
| Ga0307476_112598731 | 3300031715 | Hardwood Forest Soil | IRGYLASFPDAAAAAADMRRRFKFLGDTGVWRLLTSASRDIGG |
| Ga0307474_115698902 | 3300031718 | Hardwood Forest Soil | FPDAAAATADMRRRFKFLGDTGVWRLLTSAARDIG |
| Ga0318509_100724731 | 3300031768 | Soil | EYGSIRGYLGSFPDAGAAAADMRRRFKFLGDTGTWRLLTGASRDIG |
| Ga0318526_103272743 | 3300031769 | Soil | YGSIRGYLASFPDAGAAAADLRRRFKFLGDTGVWRLLTSASHDIG |
| Ga0318526_104739691 | 3300031769 | Soil | DQHGSIRGYLASFPDAGAAAADMRRRFKFLGDTGIWRLLTSASRDIG |
| Ga0318546_103479171 | 3300031771 | Soil | YGSIRGYLASFPDAGAAAADMRRRFKFLGDTGVWRLLTRASRDIG |
| Ga0318546_108310193 | 3300031771 | Soil | LASFPDAAAAAADMRRRFKFLGDTGIWRLLTSASRDIG |
| Ga0318552_107041432 | 3300031782 | Soil | SIRGYLASFPDAGAAAADMRRRFKFLGDTGIWRLLTSASRDIG |
| Ga0318523_101750212 | 3300031798 | Soil | GENAREVLAILDEYGSIRGYLGSFPDAGAAAADMRRRFKFLGDTGTWRLLTGASRDIG |
| Ga0318567_104745531 | 3300031821 | Soil | GSIRGYLASFPDAGAAAADLRRRFKFLGDTGVWRLLTSASRDIG |
| Ga0318511_106064561 | 3300031845 | Soil | GYLGSFPDAGAAAADMRRRFKFLGDTGTWRLLTGASRDIG |
| Ga0318512_101179922 | 3300031846 | Soil | GSIRGYLGSFPDAGAAAADMRRRFKFLGDTGTWRLLTGASRDIG |
| Ga0318512_104391033 | 3300031846 | Soil | KYGSIRGYLASFPDAGAAAADMRRRFKFLGDTGVWRLLTRASRDIG |
| Ga0318527_103425172 | 3300031859 | Soil | YLASFSDARSAAGALRRRFKYLGDTGVWRLLTSAARDA |
| Ga0318551_103607332 | 3300031896 | Soil | IRGYLASFSDAGAAAADMRRRFKFLGDTGVWRLLTSASRDIG |
| Ga0310911_103434702 | 3300032035 | Soil | LASFPDAGAAAADMRRRFKFLGDTGIWRLLTSASRDIG |
| Ga0310911_107308801 | 3300032035 | Soil | NAREVLAILDEYGSIRGYLGSFPDAGAAAADMRRRFKFLGDTGTWRLLTGASRDIG |
| Ga0310911_107478881 | 3300032035 | Soil | SFPDAGAAAADLRRRFKFLGDTGVWRLLTSASRDIG |
| Ga0318556_104622571 | 3300032043 | Soil | GYLASFPDAGAAAADLRRRFKFLGDTGVWRLLTSASRDIG |
| Ga0307471_1013617671 | 3300032180 | Hardwood Forest Soil | REVLAILGEYGSIQGYLASFLDAGAAAADMRRRFKFLGDTGVWRLLTSASRDIG |
| Ga0318519_104547083 | 3300033290 | Soil | GSIRGYLASFPDAGAAAADMRRRFKFLGDTGVWRLLTRASRDIG |
| Ga0318519_108511501 | 3300033290 | Soil | ASFPDAGAAAADMRRRFKFLGDTGIWRLLTSASRDIG |
| ⦗Top⦘ |