| Basic Information | |
|---|---|
| Family ID | F096149 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 45 residues |
| Representative Sequence | LPPFLQHEVFNTGAGECQVQTLLAKAQPMRPQYADPELLKLQAEVG |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 12.38 % |
| % of genes near scaffold ends (potentially truncated) | 88.57 % |
| % of genes from short scaffolds (< 2000 bps) | 94.29 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.26 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.857 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (45.714 % of family members) |
| Environment Ontology (ENVO) | Unclassified (46.667 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.952 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.16% β-sheet: 8.11% Coil/Unstructured: 79.73% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF03069 | FmdA_AmdA | 20.00 |
| PF04115 | Ureidogly_lyase | 8.57 |
| PF12974 | Phosphonate-bd | 7.62 |
| PF01494 | FAD_binding_3 | 3.81 |
| PF01979 | Amidohydro_1 | 1.90 |
| PF00848 | Ring_hydroxyl_A | 1.90 |
| PF00890 | FAD_binding_2 | 1.90 |
| PF00355 | Rieske | 1.90 |
| PF00296 | Bac_luciferase | 1.90 |
| PF07883 | Cupin_2 | 1.90 |
| PF00171 | Aldedh | 0.95 |
| PF04073 | tRNA_edit | 0.95 |
| PF01977 | UbiD | 0.95 |
| PF03972 | MmgE_PrpD | 0.95 |
| PF08352 | oligo_HPY | 0.95 |
| PF13181 | TPR_8 | 0.95 |
| PF13416 | SBP_bac_8 | 0.95 |
| PF13361 | UvrD_C | 0.95 |
| PF00211 | Guanylate_cyc | 0.95 |
| PF00392 | GntR | 0.95 |
| PF00120 | Gln-synt_C | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 20.00 |
| COG3194 | Ureidoglycolate hydrolase (allantoin degradation) | Nucleotide transport and metabolism [F] | 8.57 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 7.62 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 3.81 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 3.81 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 3.81 |
| COG4638 | Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit | Inorganic ion transport and metabolism [P] | 3.81 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.90 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.95 |
| COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 0.95 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.95 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.95 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.95 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.86 % |
| Unclassified | root | N/A | 17.14 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001545|JGI12630J15595_10041665 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300004082|Ga0062384_101111035 | Not Available | 571 | Open in IMG/M |
| 3300004091|Ga0062387_101707210 | Not Available | 511 | Open in IMG/M |
| 3300004092|Ga0062389_102141319 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 734 | Open in IMG/M |
| 3300004092|Ga0062389_102992032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 632 | Open in IMG/M |
| 3300004635|Ga0062388_101863377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 619 | Open in IMG/M |
| 3300005436|Ga0070713_100185199 | All Organisms → cellular organisms → Bacteria | 1873 | Open in IMG/M |
| 3300005437|Ga0070710_11072768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 590 | Open in IMG/M |
| 3300005445|Ga0070708_100583275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1054 | Open in IMG/M |
| 3300005534|Ga0070735_10359748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 873 | Open in IMG/M |
| 3300005764|Ga0066903_100301195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. OHSU_III | 2537 | Open in IMG/M |
| 3300005881|Ga0075294_1035644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 525 | Open in IMG/M |
| 3300006163|Ga0070715_10019359 | All Organisms → cellular organisms → Bacteria | 2610 | Open in IMG/M |
| 3300006173|Ga0070716_100017664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3702 | Open in IMG/M |
| 3300006175|Ga0070712_101271503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 641 | Open in IMG/M |
| 3300006176|Ga0070765_101758011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 582 | Open in IMG/M |
| 3300009697|Ga0116231_10046929 | All Organisms → cellular organisms → Bacteria | 3205 | Open in IMG/M |
| 3300010376|Ga0126381_101976688 | Not Available | 840 | Open in IMG/M |
| 3300010376|Ga0126381_103856778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 585 | Open in IMG/M |
| 3300012202|Ga0137363_11443876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 578 | Open in IMG/M |
| 3300012685|Ga0137397_10426851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 987 | Open in IMG/M |
| 3300014658|Ga0181519_10842508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 567 | Open in IMG/M |
| 3300016387|Ga0182040_10955955 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300016404|Ga0182037_11320458 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300016445|Ga0182038_10388030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 20-64-7 | 1167 | Open in IMG/M |
| 3300017955|Ga0187817_10177197 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1357 | Open in IMG/M |
| 3300017974|Ga0187777_10940842 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300018433|Ga0066667_11831364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 550 | Open in IMG/M |
| 3300020580|Ga0210403_10693967 | Not Available | 816 | Open in IMG/M |
| 3300020583|Ga0210401_10372411 | All Organisms → cellular organisms → Bacteria | 1290 | Open in IMG/M |
| 3300021178|Ga0210408_10078511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2587 | Open in IMG/M |
| 3300021358|Ga0213873_10159045 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300021388|Ga0213875_10302741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 757 | Open in IMG/M |
| 3300021405|Ga0210387_11701252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300021406|Ga0210386_11431461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 578 | Open in IMG/M |
| 3300021479|Ga0210410_11209232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 647 | Open in IMG/M |
| 3300022726|Ga0242654_10208927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 682 | Open in IMG/M |
| 3300022726|Ga0242654_10317327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 578 | Open in IMG/M |
| 3300025898|Ga0207692_11061216 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300025906|Ga0207699_10217980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1301 | Open in IMG/M |
| 3300025915|Ga0207693_10661797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 811 | Open in IMG/M |
| 3300025928|Ga0207700_10890954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 796 | Open in IMG/M |
| 3300026498|Ga0257156_1091163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 633 | Open in IMG/M |
| 3300027102|Ga0208728_102773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 575 | Open in IMG/M |
| 3300027167|Ga0208096_108054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 548 | Open in IMG/M |
| 3300027388|Ga0208995_1042726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Prochlorotrichaceae → Halomicronema → unclassified Halomicronema → Halomicronema sp. CCY15110 | 797 | Open in IMG/M |
| 3300027737|Ga0209038_10074310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Prochlorotrichaceae → Halomicronema → unclassified Halomicronema → Halomicronema sp. CCY15110 | 1020 | Open in IMG/M |
| 3300027745|Ga0209908_10210593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 535 | Open in IMG/M |
| 3300027795|Ga0209139_10369524 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 501 | Open in IMG/M |
| 3300027879|Ga0209169_10391037 | Not Available | 731 | Open in IMG/M |
| 3300027986|Ga0209168_10178827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1067 | Open in IMG/M |
| 3300028536|Ga0137415_10454181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1087 | Open in IMG/M |
| 3300030617|Ga0311356_11605712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 585 | Open in IMG/M |
| 3300031446|Ga0170820_11115105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1495 | Open in IMG/M |
| 3300031543|Ga0318516_10495716 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300031543|Ga0318516_10607869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 624 | Open in IMG/M |
| 3300031544|Ga0318534_10239399 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
| 3300031545|Ga0318541_10510701 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300031546|Ga0318538_10551134 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 625 | Open in IMG/M |
| 3300031573|Ga0310915_10412339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae → Methyloversatilis → Methyloversatilis universalis → Methyloversatilis universalis FAM5 | 959 | Open in IMG/M |
| 3300031640|Ga0318555_10345907 | Not Available | 805 | Open in IMG/M |
| 3300031680|Ga0318574_10820342 | Not Available | 545 | Open in IMG/M |
| 3300031682|Ga0318560_10337789 | Not Available | 813 | Open in IMG/M |
| 3300031682|Ga0318560_10433696 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300031682|Ga0318560_10591074 | Not Available | 601 | Open in IMG/M |
| 3300031708|Ga0310686_118518603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2074 | Open in IMG/M |
| 3300031713|Ga0318496_10159556 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1233 | Open in IMG/M |
| 3300031736|Ga0318501_10068158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1712 | Open in IMG/M |
| 3300031763|Ga0318537_10063512 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1349 | Open in IMG/M |
| 3300031763|Ga0318537_10362386 | Not Available | 535 | Open in IMG/M |
| 3300031765|Ga0318554_10152828 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
| 3300031771|Ga0318546_10619720 | Not Available | 761 | Open in IMG/M |
| 3300031771|Ga0318546_10629373 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300031793|Ga0318548_10136062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1193 | Open in IMG/M |
| 3300031797|Ga0318550_10210795 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 941 | Open in IMG/M |
| 3300031797|Ga0318550_10416809 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300031821|Ga0318567_10256537 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 982 | Open in IMG/M |
| 3300031833|Ga0310917_10347504 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300031835|Ga0318517_10115276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1187 | Open in IMG/M |
| 3300031890|Ga0306925_12242662 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300031910|Ga0306923_10551133 | Not Available | 1299 | Open in IMG/M |
| 3300031912|Ga0306921_10762262 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300031941|Ga0310912_10450319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae → Methyloversatilis → Methyloversatilis universalis → Methyloversatilis universalis FAM5 | 1003 | Open in IMG/M |
| 3300031941|Ga0310912_11407823 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300031946|Ga0310910_10822637 | Not Available | 731 | Open in IMG/M |
| 3300031947|Ga0310909_10341238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1257 | Open in IMG/M |
| 3300031947|Ga0310909_10899289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 727 | Open in IMG/M |
| 3300031947|Ga0310909_11400403 | Not Available | 559 | Open in IMG/M |
| 3300031954|Ga0306926_10497292 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1499 | Open in IMG/M |
| 3300031954|Ga0306926_11428743 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300032010|Ga0318569_10317044 | Not Available | 726 | Open in IMG/M |
| 3300032035|Ga0310911_10445498 | Not Available | 750 | Open in IMG/M |
| 3300032044|Ga0318558_10260919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae → Methyloversatilis → Methyloversatilis universalis → Methyloversatilis universalis FAM5 | 854 | Open in IMG/M |
| 3300032051|Ga0318532_10364916 | Not Available | 513 | Open in IMG/M |
| 3300032059|Ga0318533_10381247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae → Methyloversatilis → Methyloversatilis universalis → Methyloversatilis universalis FAM5 | 1029 | Open in IMG/M |
| 3300032060|Ga0318505_10204596 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300032089|Ga0318525_10325086 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300032090|Ga0318518_10186798 | Not Available | 1059 | Open in IMG/M |
| 3300032205|Ga0307472_101756405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 615 | Open in IMG/M |
| 3300032261|Ga0306920_100825436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1359 | Open in IMG/M |
| 3300032261|Ga0306920_100927174 | All Organisms → cellular organisms → Bacteria | 1272 | Open in IMG/M |
| 3300032261|Ga0306920_102506335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae → Methyloversatilis → Methyloversatilis universalis → Methyloversatilis universalis FAM5 | 709 | Open in IMG/M |
| 3300032896|Ga0335075_11126658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 689 | Open in IMG/M |
| 3300032896|Ga0335075_11719809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300034268|Ga0372943_0890236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Prochlorotrichaceae → Halomicronema → unclassified Halomicronema → Halomicronema sp. CCY15110 | 592 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 45.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.48% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.52% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 6.67% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.81% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.90% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.90% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.95% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.95% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.95% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.95% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.95% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.95% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.95% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.95% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.95% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.95% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005881 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_202 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300009697 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300027102 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF028 (SPAdes) | Environmental | Open in IMG/M |
| 3300027167 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF034 (SPAdes) | Environmental | Open in IMG/M |
| 3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12630J15595_100416651 | 3300001545 | Forest Soil | FNNGPGDCHVQTLLAKSQPLRPQYADPELLELQAAQG* |
| Ga0062384_1011110352 | 3300004082 | Bog Forest Soil | FLQHEVFNEGAGDCHLQTMLAKPQPLRPHYNNRELLKLQAAEG* |
| Ga0062387_1017072102 | 3300004091 | Bog Forest Soil | FLQHEVFNEGTGDCHLQTMLAKPQPLRPHYNDPELLKLQSAEG* |
| Ga0062389_1021413193 | 3300004092 | Bog Forest Soil | HEIFNDGPGDCHVQTLLAKPQPLRPQYADPELLELQAAQG* |
| Ga0062389_1029920321 | 3300004092 | Bog Forest Soil | LQHEVLNVGAVECHVQTMLAHPTPLRPSYADPELLKLQAAGDK* |
| Ga0062388_1018633771 | 3300004635 | Bog Forest Soil | EKWDLIACPPFMNHEIVNDGTETCHVQTLLSKAEPLRPQYRDPELLKLQAAVT* |
| Ga0070713_1001851991 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | FLQDEVFNEGDNICHRQTLLARPQPLRPQYNNPELLKLQAAIP* |
| Ga0070710_110727681 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | IRLGRWDLVCLPPFLRHEVFNEGSSDCHLQTLLAKPQPLRPQYADPELLRLQAAAG* |
| Ga0070708_1005832752 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | DLVVLPPFLQDEVFNEGDNICHRQTLLARPQPLRPQYNDPELLKLQAAIP* |
| Ga0070735_103597482 | 3300005534 | Surface Soil | QHEVLNDGAGDCHVQTLLSKPQPLRPNYADPELLRLQEADAARRS* |
| Ga0066903_1003011951 | 3300005764 | Tropical Forest Soil | WDLIACPPSVHHEIINDGDETCHVQTLLSKPQPLRPQYRDPELLKLQAAVS* |
| Ga0075294_10356441 | 3300005881 | Rice Paddy Soil | IACPPFVHHEIVNDGNETCHVQTLLSKAVPLRPQYRDPELLKLQAAVP* |
| Ga0070715_100193594 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | VLPPFLQDEVFNEGNNICHPQTLLARPQPLRPQYNNPELLKLQAAIP* |
| Ga0070716_1000176642 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VLPPFLQDEVFNEGDNICHRQTLLARPQPLRPQYNDPELLKLQAAIP* |
| Ga0070712_1012715031 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LPPLMQHEVFNTGSGDCQVQTLLAKPQPLRPQYADPELLKLQAAVA* |
| Ga0070765_1017580111 | 3300006176 | Soil | VLPPFLQDEVFNEGDNICHRQTLLARPQPLRPQYNDPELLKLQAAIQ* |
| Ga0116231_100469295 | 3300009697 | Host-Associated | MKLPVGLQHELHNTGDIDCQVQTLLSAPAPRRPHYNDPELLALQAAV* |
| Ga0126381_1019766883 | 3300010376 | Tropical Forest Soil | VRWDFVCFSPFLQHEVFNTSPGECHLQTLLAKPKPLRPQYADPELLKVQAAEG* |
| Ga0126381_1038567781 | 3300010376 | Tropical Forest Soil | TLGRWDLVALPPFLQHEVFNEGKVICHLQTMLAKPRPLRPQYNDPELLALQAEQG* |
| Ga0137363_114438763 | 3300012202 | Vadose Zone Soil | LPPFLSHEIFNNGPGDCHVQTLLAKPQPLRPQYADPELLELQAAQG* |
| Ga0137397_104268513 | 3300012685 | Vadose Zone Soil | VALPPFLQHEVFNAGTGDCQLQTLLAKAKPLRPQYADPDLLKLQAEQG* |
| Ga0181519_108425081 | 3300014658 | Bog | LKLPVGLQHELHNTGEVDCQVQTLLSAPKPLRPQYNDPELLALQAQVA* |
| Ga0182040_109559551 | 3300016387 | Soil | ISLGRWDLVCLPPFLRHEVFNTGAGECQVQTLLAKAQPMRPQYADPELLKLQAAVP |
| Ga0182037_113204582 | 3300016404 | Soil | CLPPYLQHEVFNTGASECQVQTLLAKAQPKRPQYADPELLKLQAEVG |
| Ga0182038_103880301 | 3300016445 | Soil | TGAGECQVQTLLAKAQPMRPQYADPELLKLQTEVG |
| Ga0187817_101771971 | 3300017955 | Freshwater Sediment | NTGAGECQVQTLLAKAQPLRPQYADPALLKLQAEVG |
| Ga0187777_109408422 | 3300017974 | Tropical Peatland | GKWDLIACPPFTHHEIINDGTEECHVQTLLSKTQPMRPQYKDAELLKLQAAVP |
| Ga0066667_118313641 | 3300018433 | Grasslands Soil | WDLVGLPSFLRHEVFNEGSSDCHLQTLLAKPQPLRPQYADPELLRLQAAAG |
| Ga0210403_106939671 | 3300020580 | Soil | PPFLQHEVFNEGTCDCHLQTMLAKPQPLRPHYNDPELLRLQATEG |
| Ga0210401_103724113 | 3300020583 | Soil | DLVALPPFLQHEVFNTGSGDCQLQTLLAKPQPLRPQYADPELLKLQAAQG |
| Ga0210408_100785113 | 3300021178 | Soil | LSRWDLVALPPFLHHEIFNDGAGDCHIQTLLAKPQPLRPQYADPELLELQAAQG |
| Ga0213873_101590451 | 3300021358 | Rhizosphere | FNTGSGDCQLQTLLAKPQPLRPQYADPELLKLQAAQG |
| Ga0213875_103027411 | 3300021388 | Plant Roots | LGRWDLVCLPPFLQHEVFNTGSGDCQVQTLLAKPQPLRPQYADPELLALQAAQG |
| Ga0210387_117012522 | 3300021405 | Soil | HEVFNTGSGDCQVQTLLAKPQPLRPQYADPELLKLQAAVA |
| Ga0210386_114314612 | 3300021406 | Soil | SAGDNICHRQTLLARPQPLRPQYNDPELLKLQAAIP |
| Ga0210410_112092322 | 3300021479 | Soil | CLPPFMQHEVFNTGSGDCQVQTLLAKPQPLRPQYADPELLKLQAAVA |
| Ga0242654_102089272 | 3300022726 | Soil | RWDLVCLPPFIQHEVFNTGSGDCQVQTLLAKPQPLRPQYADPELLKLQAARA |
| Ga0242654_103173271 | 3300022726 | Soil | VFNAGAGDCQLQTLLAKAKPLRPQYADPDLLKLQAQAG |
| Ga0207692_110612162 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | LRYASVQQRLPPFLRHEVFNEGSSDCHLQTLLAKPQPLRPQYADPELLRLQAAAG |
| Ga0207699_102179801 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VLPPFLQDEVFNEGDNICHRQTLLARPQPLRPQYNDPELLKLQA |
| Ga0207693_106617972 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | RWDLVCLPPLMQHEVFNTGSGDCQVQTLLAKPQPLRPQYADPELLKLQAAVA |
| Ga0207700_108909541 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | TLGRGDLVVLPPFLQDEVFNEGDNICHRQTLLARPQPLRPQYNDPELLKLQAAIP |
| Ga0257156_10911631 | 3300026498 | Soil | MQHEVFNTGSGDCQVQTLLAKPQPLRPQYADPELLKLQAAVA |
| Ga0208728_1027731 | 3300027102 | Forest Soil | FLNHEIFNNGPGDCHVQTLLAKSQPLRPQYADPELLELQAAQG |
| Ga0208096_1080542 | 3300027167 | Forest Soil | LPPFLNHEIFNNGPGDCHVQTLLAKSQPLRPQYADPELLELQAAQG |
| Ga0208995_10427263 | 3300027388 | Forest Soil | IRLGRWDLVCLPPFLRHEVFNEGSGDCHLQTLLAKPQPLRPQYADPELLRLQAAAG |
| Ga0209038_100743101 | 3300027737 | Bog Forest Soil | LGRWDLVALPPFLNHEIFNDGPGDCHVQTLLAKPQPLRPQYADPELLELQAAQG |
| Ga0209908_102105931 | 3300027745 | Thawing Permafrost | RDRYNTGDVDCQVQTLLSAPQPRRPRYEDPELLALQAAVPQLVPG |
| Ga0209139_103695241 | 3300027795 | Bog Forest Soil | LVALPPFLNHEIFNDGPGDCHVQTLLAKPQPLRPQYADPELLELQASQG |
| Ga0209169_103910371 | 3300027879 | Soil | VSDLVALPPFVQHEVFNEGAGECHLQTMLAKPQPLRPQYSDPEL |
| Ga0209168_101788272 | 3300027986 | Surface Soil | QHEVLNDGAGDCHVQTLLSKPQPLRPNYADPELLRLQEADAARRS |
| Ga0137415_104541813 | 3300028536 | Vadose Zone Soil | VALPPFLQHEVFNAGTGDRQLQTLLAKAKPLRPQYADPDLLKLQAEQG |
| Ga0311356_116057122 | 3300030617 | Palsa | NVGAVECHVQTMLAHPTPLRPNYADPKLLELQAGEGKP |
| Ga0170820_111151051 | 3300031446 | Forest Soil | GRVFNEGDNICHWQTLLARPQPLRPQYNDPELLKLQAAIP |
| Ga0318516_104957163 | 3300031543 | Soil | ISLGRWDLVCLPPFLHHEVFNTGAGECQVQTLLAKAQPMRPQYADPELLKLQAEVG |
| Ga0318516_106078692 | 3300031543 | Soil | RWDLVCLPPFLQHEVFNTGSGECQLQTLLAKPQPLRPQYADPELLKLQAAV |
| Ga0318534_102393991 | 3300031544 | Soil | LPPFLQHEVFNTGAGECQVQTLLAKAQPMRPQYADPELLKLQAEVG |
| Ga0318541_105107011 | 3300031545 | Soil | PPFLQHKVFNEGEAICHLQTMLAKPQPPPPQYNDPRLLGLRAKEG |
| Ga0318538_105511341 | 3300031546 | Soil | VCLPPFLRHEVFNTGAGECQVQTLLAKAQPMRPQYADPELLKLQAAVP |
| Ga0310915_104123392 | 3300031573 | Soil | FNTGASECQVQTLLAKAQPMRPQYADPELLKLQAAVP |
| Ga0318555_103459072 | 3300031640 | Soil | NHEIVNDGPGDCHVQTLLAKPQPLRPQYADPQLLELQAAQG |
| Ga0318574_108203422 | 3300031680 | Soil | VSPFLQHEIFNTSPGECHLQTLLAKPKPLRPQYADPELLK |
| Ga0318560_103377891 | 3300031682 | Soil | ALPPFLNHEIFNDGPGDCHVQTLLAKPQPLRPQYADPQLLELQAAQG |
| Ga0318560_104336962 | 3300031682 | Soil | HEVFNTGVGECQVQTLLAKAQPLRPQYADPELLKLQAEVG |
| Ga0318560_105910741 | 3300031682 | Soil | VSAFPQQEVFNTSPGECHLQTLLAKPKPLRPQYANPEL |
| Ga0310686_1185186034 | 3300031708 | Soil | ALPPFLQHEVFNEGAEICHLQTMLAKSQPLRPQYNDPKLLELQSEIA |
| Ga0318496_101595562 | 3300031713 | Soil | LRHEVFNTGASECQVQTLLAKAQPMRPQYADPELLKLQAAVP |
| Ga0318501_100681581 | 3300031736 | Soil | FNTGASECQVQTLLAKAQPKRPQYADPELLKLQAEVG |
| Ga0318537_100635121 | 3300031763 | Soil | QHEVFNTGAGECQVQTLLAKAQPMRPQYADPELLKLQAEVG |
| Ga0318537_103623862 | 3300031763 | Soil | LSPFLQHEVFNTSPGECHLQTLLAKPKPLRPQYADPELLKVQAAEG |
| Ga0318554_101528281 | 3300031765 | Soil | RWDLVCLPPFLQHEVFNTGAGECHVQTLLAKAQPLRPQYADPELLKLQAEVG |
| Ga0318546_106197201 | 3300031771 | Soil | LGRWDLVALPPFLNHEIVNDGPGDCHVQTLLAKPQPLRPQYADPQLLELQAAQG |
| Ga0318546_106293731 | 3300031771 | Soil | DLVCLPPFLQHEVFNTGASECQVQTLLAKAQPKRPQYADPELLKLQAEVG |
| Ga0318548_101360623 | 3300031793 | Soil | VRWDLVCVSPFLQHEVFNTSPGECHLQTLLAKPKPLRPQYADPELLKVQAAEG |
| Ga0318550_102107952 | 3300031797 | Soil | DIALGRWDLVCLPPFLQHEVFNTGVGECQVQTLLAKAQPLRPQYADPELLKLQAEVG |
| Ga0318550_104168091 | 3300031797 | Soil | FNTGAGECQVQTLLAKAQPMRPQYADPELLKLQAAVP |
| Ga0318567_102565371 | 3300031821 | Soil | DISLGRWDLVCLPPFLRHEVFNTGASECQVQTLLAKAQPMRPQYADPELLKLQAAVP |
| Ga0310917_103475042 | 3300031833 | Soil | VCLPPYLQHEVFNTGASECQVQTLLAKAQPKRPQYADPELLKLQAEVG |
| Ga0318517_101152763 | 3300031835 | Soil | LSPFLQHEVFNTSPGECHLQTLLAKPKPLRPQYADPELLKVQA |
| Ga0306925_122426621 | 3300031890 | Soil | FNTGAGECQVQTLLAKAQPMRPQYADPELLKLQAEVG |
| Ga0306923_105511331 | 3300031910 | Soil | SPFLQHEVFNTSPGECHLQTLLAKPKPLRPQYADPELLKVQAAEG |
| Ga0306921_107622621 | 3300031912 | Soil | PFLRHEVFNTGAGECQVQTLLAKAQPMRPQYADPELLKLQAAVP |
| Ga0310912_104503191 | 3300031941 | Soil | EVFNTGASECQVQTLLAKAQPMRPQYADPELLKLQAAVP |
| Ga0310912_114078231 | 3300031941 | Soil | CLPPFLQHEVFNTGVGECQVQTLLAKAQPLRPQYADPELLKLQAEVG |
| Ga0310910_108226371 | 3300031946 | Soil | LNHEIVNDGPGDCHVQTLLAKPQPLRPQYADPQLLELQAAQG |
| Ga0310909_103412383 | 3300031947 | Soil | VRWDLVCVSAFPQQEVFNTSPGECHLQTLLAKPKPLRPQYADPELLKVQAAEG |
| Ga0310909_108992892 | 3300031947 | Soil | FNEGDGECHLQTLLAKPQPLRPQYADPELLRLQSAEG |
| Ga0310909_114004031 | 3300031947 | Soil | LSPFLQHEVFNTSPGECHLQTLLAKPKPLRPQYADPELLKVQARRD |
| Ga0306926_104972922 | 3300031954 | Soil | LPPFLRHEVFNTGAGECQVQTLLAKAQPMRPQYADPELLKLQAAVP |
| Ga0306926_114287434 | 3300031954 | Soil | HEVFNTGAGECQVQTLLAKAQPMRPQYADPELLKLQAEVG |
| Ga0318569_103170443 | 3300032010 | Soil | VSPFLQHEVFNTSPGECHLQTLLAKPKPLRPQYADPELLKVQ |
| Ga0310911_104454983 | 3300032035 | Soil | VSPFLQHEIFNTSPGECHLQTLLAKPKPLRPQYADPELLKVQA |
| Ga0318558_102609192 | 3300032044 | Soil | FNTGVGECQVQTLLAKAQPLRPQYADPELLKLQAEVG |
| Ga0318532_103649161 | 3300032051 | Soil | LQHEVFNTSPGECHLQTLLAKPKPLRPQYADPELLKVQAAEG |
| Ga0318533_103812473 | 3300032059 | Soil | VFNTGVGECQVQTLLAKAQPLRPQYADPELLKLQAEVG |
| Ga0318505_102045961 | 3300032060 | Soil | VFNTGAGECHVQTLLAKAQPLRPQYADPELLKLQAEVG |
| Ga0318525_103250861 | 3300032089 | Soil | QHEVFNTGAGECHVQTLLAKAQPLRPQYADPELLKLQAEVG |
| Ga0318518_101867981 | 3300032090 | Soil | DLVALPPFLNHEIVNDGPGDCHVQTLLAKPQPLRPQYADPQLLELQAAQG |
| Ga0307472_1017564051 | 3300032205 | Hardwood Forest Soil | VCLPPFMQHEVFNTGSGDCQVQTLLAKPQPLRPQYADPELLKLQAAVA |
| Ga0306920_1008254361 | 3300032261 | Soil | VSAFPQQEVFNTSPGECHLQTLLAKPKPLRPQYADPELLKVQA |
| Ga0306920_1009271742 | 3300032261 | Soil | FNDGPGDCHVQTLLAKPQPLRPQYADPQLLELQAAQG |
| Ga0306920_1025063352 | 3300032261 | Soil | ELFNTGAGECQVQTLLAKAQPMRPQYADPELVRRQAEVG |
| Ga0335075_111266582 | 3300032896 | Soil | LQHELHNTGDVDCQVQTLLSAPRPRRPQYDDPELLALQAAASQPVLA |
| Ga0335075_117198092 | 3300032896 | Soil | EVFNEGAEICHLQTMLAKPQPLRPQYNDPKLLELQAEIA |
| Ga0372943_0890236_468_590 | 3300034268 | Soil | HEVFNEGSADCQLQTLLAKPQPRRPQYADPKLLTLQAKAG |
| ⦗Top⦘ |