| Basic Information | |
|---|---|
| Family ID | F096137 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MTSVGLIGCGGMAQDVVAALRDASTTSGVRIVGALARPGRG |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 20.83 % |
| % of genes near scaffold ends (potentially truncated) | 20.95 % |
| % of genes from short scaffolds (< 2000 bps) | 21.90 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.60 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (77.143 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (24.762 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.571 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.714 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.64% β-sheet: 24.64% Coil/Unstructured: 50.72% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF00171 | Aldedh | 88.57 |
| PF09084 | NMT1 | 1.90 |
| PF01494 | FAD_binding_3 | 1.90 |
| PF01977 | UbiD | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 88.57 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 88.57 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 88.57 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 3.81 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 1.90 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 1.90 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 1.90 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.90 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.90 |
| COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 77.14 % |
| All Organisms | root | All Organisms | 22.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300006186|Ga0075369_10197657 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300009147|Ga0114129_10029016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 7837 | Open in IMG/M |
| 3300010360|Ga0126372_10824013 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300010398|Ga0126383_10982709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 932 | Open in IMG/M |
| 3300012358|Ga0137368_10452772 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300015242|Ga0137412_11315129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300015372|Ga0132256_102987883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 569 | Open in IMG/M |
| 3300020583|Ga0210401_11085866 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300021080|Ga0210382_10407544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 602 | Open in IMG/M |
| 3300021344|Ga0193719_10439140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 532 | Open in IMG/M |
| 3300026295|Ga0209234_1240506 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300026542|Ga0209805_1449007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 503 | Open in IMG/M |
| 3300027181|Ga0208997_1012121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1161 | Open in IMG/M |
| 3300028796|Ga0307287_10211086 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300031764|Ga0318535_10458537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 567 | Open in IMG/M |
| 3300031771|Ga0318546_10154244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1549 | Open in IMG/M |
| 3300031793|Ga0318548_10531651 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300031880|Ga0318544_10110814 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300031981|Ga0318531_10385104 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300032035|Ga0310911_10291691 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300032063|Ga0318504_10046461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1806 | Open in IMG/M |
| 3300032075|Ga0310890_10113962 | All Organisms → cellular organisms → Bacteria | 1723 | Open in IMG/M |
| 3300032076|Ga0306924_11487268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 719 | Open in IMG/M |
| 3300032180|Ga0307471_102440706 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 24.76% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.52% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.86% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.90% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.90% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.90% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.90% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.95% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.95% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.95% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.95% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.95% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006186 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Host-Associated | Open in IMG/M |
| 3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300027181 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027381 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICCgaii200_07016231 | 2228664021 | Soil | MTAVGLIGCGGIAQDVLAALRASPANGVSIVGALARP |
| Ga0066680_108442451 | 3300005174 | Soil | MTAIGLIGCGGMAQDVVAALRGADTADGVRIVGALARPGRGDA |
| Ga0066684_100478761 | 3300005179 | Soil | MTSVGLIGCGGMAQDVVAALRSASASHGVQIVGALARPGRAPAAR |
| Ga0066676_103182411 | 3300005186 | Soil | MTAIGLIGCGGMAQDVVAALRSAGAESGVRIVAALARPGR |
| Ga0066388_1045329262 | 3300005332 | Tropical Forest Soil | MTSVGLIGCGGMARDVVAALRGGDTTDGVRIVGALARPGRG |
| Ga0066388_1074636651 | 3300005332 | Tropical Forest Soil | MTSVGLIGCGGIAQDVIATVRAAPECGVTIIAALARPGRVA |
| Ga0070691_103328022 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MTAVGLIGCGGIAQDVLAALHASPANGVSIVGALARPGRGEAARAKL |
| Ga0070674_1010931252 | 3300005356 | Miscanthus Rhizosphere | MTVVGLIGCGGIAQDVLAALRASPANGVSIVGALARPGRGA |
| Ga0008090_101954681 | 3300005363 | Tropical Rainforest Soil | MTSVGLIGCGGMARDVVAALHGGDTASGVRIVGALARPGRGGEARAK |
| Ga0066670_100386594 | 3300005560 | Soil | MTAIGLIGCGGMAQDVVAALRSAGAESGVRIVAALAR |
| Ga0068851_106279592 | 3300005834 | Corn Rhizosphere | MTAVGLIGCGGIAQDVLAALRASPANGVSVIGALARPGRGEAARAK |
| Ga0075365_106610302 | 3300006038 | Populus Endosphere | MTAVGLIGCGGIAQDVVAALRASPANGVSVIGALA |
| Ga0075432_102043032 | 3300006058 | Populus Rhizosphere | MTSVGLIGCGGMAQDVVAALCGARTTGGVRIIGALARPGRGDEARAK |
| Ga0070715_101125692 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MTAVGLIGCGGIAQDVLAALRASPANGVSIVGALARPGRGEAARAK |
| Ga0075369_101976572 | 3300006186 | Populus Endosphere | VTAVGLIGCGGIAQDVVAALCASPANGVSVIGALARPGRGEAARAKLC |
| Ga0074051_116917991 | 3300006572 | Soil | MTAVGLIGCGGIAQDVLAALRASPANGVSVIGALARP |
| Ga0074049_130428671 | 3300006580 | Soil | MTAVGLIGCGGIAQDVLAALRASPANGVSVIGALARPGRGE |
| Ga0074049_131824191 | 3300006580 | Soil | MISVGLIGCGGIAQDLMTALGNEGPPPEVKIVAALARPGRT |
| Ga0074062_100242052 | 3300006606 | Soil | MTSVGLIGCGGMAQDVVTALCGAGTTSGVRVIGALARPGRGDEARAKL |
| Ga0066665_109984331 | 3300006796 | Soil | MTAIGLIGCGGMAQDVVAALRAAGAESGVRIVGAPARPRRG |
| Ga0075420_1004758211 | 3300006853 | Populus Rhizosphere | MTAVGLIGCGGMAQDVVAALRAADTAVRIVGALARPGRGERARA |
| Ga0099828_101030141 | 3300009089 | Vadose Zone Soil | MTSVGLIGCGGMAQDVVAALRGARTTSGVRIIGALARP |
| Ga0099827_110868481 | 3300009090 | Vadose Zone Soil | MTSAGLIGCGGISQDVVAAFRSADAAGCRIVGALARPGRAGKVRAALTDIEI |
| Ga0114129_100290161 | 3300009147 | Populus Rhizosphere | MTAVGLIGCGGIAQDVLAALRASPANGVSIVGALARPGRGAAARAKLC* |
| Ga0126380_101620322 | 3300010043 | Tropical Forest Soil | MTAAGLIGCGGMAQDVVAALRASPGNGVAIVGALARPGRGG |
| Ga0126380_110744561 | 3300010043 | Tropical Forest Soil | MTSVGLIGCGGMARDVVAALHGGDTASGVRIVGALARPGRGGE |
| Ga0126382_114672171 | 3300010047 | Tropical Forest Soil | MTLVGLIGCGGMARDVVAALHGGDTASGVRIVGALARPGRGGEAR |
| Ga0126370_114929732 | 3300010358 | Tropical Forest Soil | MTSVGLIGCGGMARDVVTALHGGDTASGVRIVGALARPGRGEEARA |
| Ga0126376_103585902 | 3300010359 | Tropical Forest Soil | MTSVGLIGCGGMAQDVVAALRDASTTSGVRIVGALARPGRG |
| Ga0126372_108240131 | 3300010360 | Tropical Forest Soil | MTSVGLIGCGGIAQDVVAALRASPESGASIVGALARPGRGDAARAKLCGV |
| Ga0126377_104396582 | 3300010362 | Tropical Forest Soil | MTSVGLIGCGGMAQDVVATLRGTGTTNGVRIVGALARP |
| Ga0126381_1019992662 | 3300010376 | Tropical Forest Soil | MTAIGLIGCGGMAQDVVAALRAADPAGGVRIVGALAR |
| Ga0126383_109827091 | 3300010398 | Tropical Forest Soil | MTAVALIGCGGIAQDVVAALRASRANGVAIVGALARPGRGEDARGKLDA |
| Ga0124844_12405281 | 3300010868 | Tropical Forest Soil | MTSVGLIGCGGMARDVVTALHGGDTASGVRIVGALARPGRGEE |
| Ga0124844_12663542 | 3300010868 | Tropical Forest Soil | MTSVGLIGCGGMARDVVTALHGGDTASGVRIVGELARPGRGEE |
| Ga0105246_110635452 | 3300011119 | Miscanthus Rhizosphere | MTSVGLIGCGGIAQDVVAALRSEDPANGVRVVAALARAGRADQARA |
| Ga0137377_100808761 | 3300012211 | Vadose Zone Soil | MTAIGLIGCGGMAQDVVAALRAADTASGVRIVGALARP |
| Ga0137368_104527722 | 3300012358 | Vadose Zone Soil | MTSTGLIGCGGIAQDVAAAFRSVDAVGCRIVGALARPGRAEKARAALTD |
| Ga0137375_112502331 | 3300012360 | Vadose Zone Soil | MTAIGLIGCGGMAQDVVAALRAADTASGVRIVGALARPGRGE |
| Ga0137390_119845472 | 3300012363 | Vadose Zone Soil | MSWVGLIGCGGIAQDVLAALRSEDTPSNVQIVGALARPGRSD |
| Ga0137416_110227241 | 3300012927 | Vadose Zone Soil | MTSVGLIGCGGIAQDVVAALHASAVNGVHIVGALARPGRADE |
| Ga0164301_114333551 | 3300012960 | Soil | MTAIGLIGCGGMAQDVVAALRAAGAQSGIVGALARIG |
| Ga0164306_118098132 | 3300012988 | Soil | MTAVGLIGCGGIAQDVLAALRASPANGVSIVGALARPGR |
| Ga0137412_113151292 | 3300015242 | Vadose Zone Soil | MTSVGLIGCGGIAQDVVAALHASAVNGVHIVGALARPGRADEARSRLCA |
| Ga0137409_106298641 | 3300015245 | Vadose Zone Soil | MTAVGLIGCGGIAQDVVGALRASPANGVRIVGALARPGRGDEARAKL |
| Ga0137403_110865291 | 3300015264 | Vadose Zone Soil | MTAIGLIGCGGMAQDVVAALRGAGTASGVRIVGALARPGRGEA |
| Ga0132258_138274302 | 3300015371 | Arabidopsis Rhizosphere | MTTVGLIGCGGIAQDVVAALRANSGNGVTIVAALARPGRGNDARAKL |
| Ga0132256_1029878831 | 3300015372 | Arabidopsis Rhizosphere | MTAVGLIGCGGIAQDVLAALRASPANGVSIVGALARPGRGEAARARLC |
| Ga0182041_110223431 | 3300016294 | Soil | MTSVGLIGCGGMAQDVVAALRDAGTTSGVRIVGALARPGR |
| Ga0182032_109285322 | 3300016357 | Soil | MLVGFIGCGGIAQDVIAALRDERMPNDIEIVGALARPGR |
| Ga0190269_117230131 | 3300018465 | Soil | MTAVGLIGCGGIAQDVLAALRASPANGVSVVGALARPG |
| Ga0193727_11553082 | 3300019886 | Soil | MTAVGLIGCGGIAQDVLAALHASPANGVSIVGALARPGRGE |
| Ga0210399_111815882 | 3300020581 | Soil | MTAIGLIGCGGMAQDVVTALRAADAAGGVRIVGAL |
| Ga0210401_110858661 | 3300020583 | Soil | MTSVGLIGCGGMAQDVVTALCGAGTTSGVRVIGALARPGRGDEARAKLCGI |
| Ga0210382_104075441 | 3300021080 | Groundwater Sediment | MTAVGLIGCGGIAQDVLAALHASPANGVSIVGALARPGRGEAARARLC |
| Ga0193719_104391401 | 3300021344 | Soil | MTAVGLIGCGGIAQDVLAALHASPANGVSMVGALARPGRGEAARAKLCGI |
| Ga0126371_110318901 | 3300021560 | Tropical Forest Soil | MTAVALIGCGGIARDVVAALRESPANGVAIVGALARPGRGED |
| Ga0222622_103232491 | 3300022756 | Groundwater Sediment | MTSVGLIGCGGIAQDVVAALRASPANGVSIVGALARPGRS |
| Ga0209438_11618051 | 3300026285 | Grasslands Soil | MTSVGLIGCGGMAQDVVAALRGARTTSGVRIIGALARPSRGDEARA |
| Ga0209234_12405062 | 3300026295 | Grasslands Soil | MTSVGLIGCGGMAQDVVAALCSARTTSGVRIIGALARPGRGGEARAKLCGV |
| Ga0209378_12734241 | 3300026528 | Soil | MTAIGLIGCGGMAQDVVAALRAAGAEGGVRVVGALAR |
| Ga0209805_14490071 | 3300026542 | Soil | MTAIGLIGCGGMAQDVVAALRAVDTANAVRIVGALARPGRGERARAKLCG |
| Ga0208997_10121211 | 3300027181 | Forest Soil | MTAVGLIGCGGIAQDVLAALRASPANGVSIIGALARPGRGEAARAKLCE |
| Ga0208983_10829601 | 3300027381 | Forest Soil | MTAVGLIGCGGIAQDVLAALRASPANGVSIIGALARPGRGEAARA |
| Ga0209283_102826681 | 3300027875 | Vadose Zone Soil | MTSVGLIGCGGMAQDVVAALCGARTTSGVRIIGALARPGRGGEARAKL |
| Ga0209488_107835981 | 3300027903 | Vadose Zone Soil | MTAVGLIGCGGIAQDVLAALHASPANGVSIVGALARPGRG |
| Ga0247822_117744631 | 3300028592 | Soil | MTAVGLIGCGGIAQDVLAALRASPANGVSVIGALARPGRGEAARAKL |
| Ga0307306_100744041 | 3300028782 | Soil | MTSVGLIGCGGIAQDVVAALRASPANGVSIVGALARPGRGEEARAK |
| Ga0307282_104257291 | 3300028784 | Soil | MTAVGLIGCGGIAQDVLAALHASPANGVSIVGALARPGRGEAARA |
| Ga0307287_102110862 | 3300028796 | Soil | MTAVGLIGCGGIAQDVLAALHASPANGVSIIGALARPGRGEAARARLCGI |
| Ga0307503_107008781 | 3300028802 | Soil | MTAIGLIGCGGIAQDVLAALRASPANGVSVIGALAR |
| Ga0247824_104569832 | 3300028809 | Soil | MTAVGLIGCGGIAQDVLAALRASPANGVSVIGALARPGQVV |
| Ga0311333_120540612 | 3300030114 | Fen | MSQITSVGLIGCGGIAKDVVTAIREQDSAGRVRIVGALA |
| Ga0307500_101925101 | 3300031198 | Soil | MTAVGLIGCGGIAQDVLAALRASPANGVSVVGALARPGRG |
| Ga0318538_105395622 | 3300031546 | Soil | MTAIGLIGCGGMAQDVVAALRGADMADGLRIVGALAATG |
| Ga0318571_104602102 | 3300031549 | Soil | MTSVGLIGCGGMAQDVVAALCGARMTSGVRIIGALA |
| Ga0318572_102096422 | 3300031681 | Soil | MTSVGLIGCGGMAQDVVAALCGARMTSGVRIIGALAR |
| Ga0318493_102209162 | 3300031723 | Soil | MTSVGLIGCGGMAQDVVAALRDAGTTSGVRIVGALARPGRGDEAR |
| Ga0306918_100373331 | 3300031744 | Soil | MTSVGLIGCGGMAQDVVAALRDAGATSGVRIVCAL |
| Ga0318535_104585372 | 3300031764 | Soil | MTSVGLIGCGGMAQDVVAALRDAGTTSGVRIVGALARPGRGDEARAKLCG |
| Ga0318521_104560591 | 3300031770 | Soil | MTSVGLIGCGGMAQDVVAALRDAGATSGVRIVCALAR |
| Ga0318546_101542441 | 3300031771 | Soil | MTSVGLIGCGGMAQDVVAALRDADMADGVRIVGALARPGRGDEARTKLC |
| Ga0318548_105316511 | 3300031793 | Soil | MTSVGLIGCGGMAQDVVAALCGARMTSGVRIIGALARPGRGGEARAKL |
| Ga0318503_100738002 | 3300031794 | Soil | MTSVGFIGCGGMARDVVAALHGGDTASGVRIVGALARPGRGGDA |
| Ga0318567_101182382 | 3300031821 | Soil | MTAIGLIGCGGMAQDVVAALRGADMADGVRIVGAAQC |
| Ga0318564_103167651 | 3300031831 | Soil | MTSVGLIGCGGMAQDVVAALRDADMADGVRIVGALARPGRGDEARA |
| Ga0318495_100026097 | 3300031860 | Soil | MTAIGLIGCGGMAQDVVAALRGADMADGLRIVGALAR |
| Ga0318544_101108142 | 3300031880 | Soil | MTSVGLIGCGGMAQDVVAALRDADMADGVRIVGALARPGRGDEARAKL |
| Ga0318551_102396462 | 3300031896 | Soil | MTSVGLIGCGGMAQDVVAALRDAGTTSGVRIVGALARPGRG |
| Ga0318520_102918441 | 3300031897 | Soil | MTSIGLIGCGGMAQDVVAALRSSDKAVQIVGALARP |
| Ga0318520_105814542 | 3300031897 | Soil | MLVGFIGCGGIAQDVIAALRDERMPNDIEIVGALARPG |
| Ga0306923_101847753 | 3300031910 | Soil | MTSVGLIGCGGMAQDVVAALRDAGTTSGVRIVGALARPGRGGEGRGADRGGG |
| Ga0306921_119668872 | 3300031912 | Soil | MTAVALIGCGGIAQDVVAALRASPANGVAIVGALTRPG |
| Ga0310916_101034671 | 3300031942 | Soil | MTSVGLIGCGGMAQDVVAALRDAGTTSGVRIVGALARPGRGGGGRGVLS |
| Ga0310910_100643153 | 3300031946 | Soil | MTSVGLIGCGGMAQDVVAALRDAGTTSGVRIVGALARPGRGGEARAK |
| Ga0318531_103851042 | 3300031981 | Soil | MTAIGLIGCGGMAQDVVAALRGADMADGVRIVGALARPGRGDEARAKLCG |
| Ga0310911_102916911 | 3300032035 | Soil | MTWVGLIGCGGIAQDVVAALREKDMDAEVEIVGLLARPGRSEIARQKFP |
| Ga0318558_102534042 | 3300032044 | Soil | MTSVGLIGCGGMAQDVVAALRDAGATSGVRIVCALARPGRGAAGRGRR |
| Ga0318532_101924421 | 3300032051 | Soil | MTSVGLIGCGGMAQDVVAALRDAGTTSGVRIVGAL |
| Ga0318504_100464611 | 3300032063 | Soil | MTSVGLIGCGGMAQDVVAALCGARMTSGVRIIGALARPGRGGEARAKLC |
| Ga0310890_101139622 | 3300032075 | Soil | MTAVGLIGCGGIAQDVLAALRASPANGVSIVGALARPGRGAAARAKLCEI |
| Ga0306924_114872682 | 3300032076 | Soil | MTAVGLIGCGGIAQDVVAALRASPANGVSIVGALARPGRSGEARAKLDGI |
| Ga0307471_1024407062 | 3300032180 | Hardwood Forest Soil | MTSVGLIGCGGIAQDVVAALRANPESGVSIVGALARLDGAAAARAKLTCNEFV |
| Ga0307472_1023760591 | 3300032205 | Hardwood Forest Soil | MTSVGLIGCGGIAQDVVAALRANPESGVSIVGALAR |
| Ga0310914_102480852 | 3300033289 | Soil | MTTIGLIGCGGMAQDVVAALRAADTASAVRIVGALARPGRAEPARAKL |
| ⦗Top⦘ |