| Basic Information | |
|---|---|
| Family ID | F096134 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MLTSKEYLQQAEECSQLANASSDVYVKEALTELASDFKAMAKDLEQRNER |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 34.29 % |
| % of genes near scaffold ends (potentially truncated) | 55.24 % |
| % of genes from short scaffolds (< 2000 bps) | 90.48 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.143 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (19.048 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.571 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (48.571 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 88.00% β-sheet: 0.00% Coil/Unstructured: 12.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF11752 | DUF3309 | 3.81 |
| PF05532 | CsbD | 2.86 |
| PF08281 | Sigma70_r4_2 | 2.86 |
| PF00106 | adh_short | 1.90 |
| PF14347 | DUF4399 | 1.90 |
| PF00916 | Sulfate_transp | 1.90 |
| PF13358 | DDE_3 | 1.90 |
| PF00005 | ABC_tran | 1.90 |
| PF04542 | Sigma70_r2 | 1.90 |
| PF00664 | ABC_membrane | 0.95 |
| PF07883 | Cupin_2 | 0.95 |
| PF00313 | CSD | 0.95 |
| PF13384 | HTH_23 | 0.95 |
| PF00392 | GntR | 0.95 |
| PF01710 | HTH_Tnp_IS630 | 0.95 |
| PF09361 | Phasin_2 | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 2.86 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 1.90 |
| COG0659 | Sulfate permease or related transporter, MFS superfamily | Inorganic ion transport and metabolism [P] | 1.90 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 1.90 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.90 |
| COG2233 | Xanthine/uracil permease | Nucleotide transport and metabolism [F] | 1.90 |
| COG2252 | Xanthine/guanine/uracil/vitamin C permease GhxP/GhxQ, nucleobase:cation symporter 2 ( NCS2) family | Nucleotide transport and metabolism [F] | 1.90 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 1.90 |
| COG3415 | CRISPR-associated protein Csa3, CARF domain | Defense mechanisms [V] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.14 % |
| Unclassified | root | N/A | 2.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_17412194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2680 | Open in IMG/M |
| 2166559005|cont_contig68276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 746 | Open in IMG/M |
| 2170459009|GA8DASG02JO9LV | Not Available | 522 | Open in IMG/M |
| 3300000787|JGI11643J11755_11757868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 647 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101034092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 707 | Open in IMG/M |
| 3300002911|JGI25390J43892_10043256 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300002914|JGI25617J43924_10005116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3966 | Open in IMG/M |
| 3300004463|Ga0063356_103817852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 649 | Open in IMG/M |
| 3300004643|Ga0062591_102294674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 563 | Open in IMG/M |
| 3300005147|Ga0066821_1011256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 654 | Open in IMG/M |
| 3300005163|Ga0066823_10019296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1046 | Open in IMG/M |
| 3300005177|Ga0066690_11060477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 506 | Open in IMG/M |
| 3300005181|Ga0066678_10186594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1318 | Open in IMG/M |
| 3300005347|Ga0070668_100662059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 918 | Open in IMG/M |
| 3300005434|Ga0070709_10094270 | All Organisms → cellular organisms → Bacteria | 1980 | Open in IMG/M |
| 3300005436|Ga0070713_100367615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1337 | Open in IMG/M |
| 3300005437|Ga0070710_10037746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2650 | Open in IMG/M |
| 3300005439|Ga0070711_100816611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 792 | Open in IMG/M |
| 3300005440|Ga0070705_100342768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1087 | Open in IMG/M |
| 3300005444|Ga0070694_100053698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2728 | Open in IMG/M |
| 3300005468|Ga0070707_100130461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2444 | Open in IMG/M |
| 3300005471|Ga0070698_100837553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 864 | Open in IMG/M |
| 3300005536|Ga0070697_101654003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 572 | Open in IMG/M |
| 3300005546|Ga0070696_101939486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 511 | Open in IMG/M |
| 3300005557|Ga0066704_10728840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 622 | Open in IMG/M |
| 3300005598|Ga0066706_10292300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1280 | Open in IMG/M |
| 3300006028|Ga0070717_10789998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 863 | Open in IMG/M |
| 3300006042|Ga0075368_10509031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 538 | Open in IMG/M |
| 3300006058|Ga0075432_10550919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300006163|Ga0070715_10159436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1114 | Open in IMG/M |
| 3300006172|Ga0075018_10245271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 865 | Open in IMG/M |
| 3300006173|Ga0070716_100203863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1317 | Open in IMG/M |
| 3300006175|Ga0070712_100295928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1308 | Open in IMG/M |
| 3300006603|Ga0074064_11753837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1162 | Open in IMG/M |
| 3300006845|Ga0075421_100810948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1077 | Open in IMG/M |
| 3300006852|Ga0075433_11654710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300006854|Ga0075425_101337774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 811 | Open in IMG/M |
| 3300006854|Ga0075425_102237354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 608 | Open in IMG/M |
| 3300006871|Ga0075434_102326849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 538 | Open in IMG/M |
| 3300006904|Ga0075424_101305299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 772 | Open in IMG/M |
| 3300007076|Ga0075435_101383907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 616 | Open in IMG/M |
| 3300007076|Ga0075435_101942502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 517 | Open in IMG/M |
| 3300009038|Ga0099829_10306705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1302 | Open in IMG/M |
| 3300009101|Ga0105247_11847563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300009137|Ga0066709_103147405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 603 | Open in IMG/M |
| 3300009156|Ga0111538_12041754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 721 | Open in IMG/M |
| 3300009162|Ga0075423_10849290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 967 | Open in IMG/M |
| 3300009553|Ga0105249_10701618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1072 | Open in IMG/M |
| 3300010154|Ga0127503_10073639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1074 | Open in IMG/M |
| 3300010304|Ga0134088_10082280 | All Organisms → cellular organisms → Bacteria | 1504 | Open in IMG/M |
| 3300010371|Ga0134125_12837814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 526 | Open in IMG/M |
| 3300010403|Ga0134123_12916792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 547 | Open in IMG/M |
| 3300011120|Ga0150983_10151831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 894 | Open in IMG/M |
| 3300011120|Ga0150983_13510750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 831 | Open in IMG/M |
| 3300011269|Ga0137392_10951591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 706 | Open in IMG/M |
| 3300012180|Ga0153974_1096434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 669 | Open in IMG/M |
| 3300012198|Ga0137364_10620786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 815 | Open in IMG/M |
| 3300012206|Ga0137380_10837169 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300012212|Ga0150985_116199113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 584 | Open in IMG/M |
| 3300012356|Ga0137371_11007462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 631 | Open in IMG/M |
| 3300012361|Ga0137360_10238142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1489 | Open in IMG/M |
| 3300012683|Ga0137398_10192422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1342 | Open in IMG/M |
| 3300012923|Ga0137359_10174554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1919 | Open in IMG/M |
| 3300012923|Ga0137359_11185071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 652 | Open in IMG/M |
| 3300012924|Ga0137413_11702217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300012938|Ga0162651_100027535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 815 | Open in IMG/M |
| 3300012957|Ga0164303_10268612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 988 | Open in IMG/M |
| 3300012960|Ga0164301_10369446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 993 | Open in IMG/M |
| 3300012985|Ga0164308_11702973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 585 | Open in IMG/M |
| 3300012986|Ga0164304_11773009 | Not Available | 516 | Open in IMG/M |
| 3300012988|Ga0164306_10731428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 790 | Open in IMG/M |
| 3300015374|Ga0132255_105065611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300016294|Ga0182041_10604126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 964 | Open in IMG/M |
| 3300018468|Ga0066662_12095368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 593 | Open in IMG/M |
| 3300018468|Ga0066662_12421409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300018482|Ga0066669_10804606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 833 | Open in IMG/M |
| 3300020579|Ga0210407_10426889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1037 | Open in IMG/M |
| 3300021405|Ga0210387_10083371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2643 | Open in IMG/M |
| 3300021479|Ga0210410_10184388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1867 | Open in IMG/M |
| 3300025916|Ga0207663_11094424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 640 | Open in IMG/M |
| 3300025922|Ga0207646_10311154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1423 | Open in IMG/M |
| 3300025922|Ga0207646_10344085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1347 | Open in IMG/M |
| 3300025928|Ga0207700_10610329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 971 | Open in IMG/M |
| 3300025928|Ga0207700_11787816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 540 | Open in IMG/M |
| 3300025939|Ga0207665_11422496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300026118|Ga0207675_102247251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 560 | Open in IMG/M |
| 3300026304|Ga0209240_1007799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 4039 | Open in IMG/M |
| 3300026310|Ga0209239_1074629 | All Organisms → cellular organisms → Bacteria | 1475 | Open in IMG/M |
| 3300026489|Ga0257160_1047715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 736 | Open in IMG/M |
| 3300026494|Ga0257159_1030999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 890 | Open in IMG/M |
| 3300026494|Ga0257159_1039322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 796 | Open in IMG/M |
| 3300026557|Ga0179587_10353621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 953 | Open in IMG/M |
| 3300027310|Ga0207983_1036544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 626 | Open in IMG/M |
| 3300028047|Ga0209526_10010683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 6327 | Open in IMG/M |
| 3300028536|Ga0137415_10149082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2176 | Open in IMG/M |
| 3300028720|Ga0307317_10261141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 585 | Open in IMG/M |
| 3300029636|Ga0222749_10345675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 778 | Open in IMG/M |
| 3300029636|Ga0222749_10426965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 706 | Open in IMG/M |
| 3300030902|Ga0308202_1154498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300031231|Ga0170824_114877422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 539 | Open in IMG/M |
| 3300031573|Ga0310915_10016967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 4355 | Open in IMG/M |
| 3300031720|Ga0307469_11813027 | Not Available | 590 | Open in IMG/M |
| 3300031820|Ga0307473_10735708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 697 | Open in IMG/M |
| 3300032180|Ga0307471_103736100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 538 | Open in IMG/M |
| 3300034681|Ga0370546_081919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 541 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 19.05% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.43% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.62% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.81% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.86% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.90% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.95% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.95% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.95% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.95% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.95% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.95% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.95% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.95% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 2170459009 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cm | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005147 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMC | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006042 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006603 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012180 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA058 MetaG | Host-Associated | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012938 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027310 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300034681 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_121 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_00693090 | 2088090014 | Soil | MLTSKKYLQQAEECLKLANASSDVYVKDALTELASDFKAMAKDLEQRNEL |
| cont_0276.00004400 | 2166559005 | Simulated | MLTSKEYLQQAEECSQLANASSDVYVKEALTELASDFKATAKDLEQRNER |
| F47_05468480 | 2170459009 | Grass Soil | MLTSKEYLQRAEECSQLANASSDVYVKKALTELASEFKATAKDLE |
| JGI11643J11755_117578682 | 3300000787 | Soil | MLTSKKYLQQAEECLKLANASSDVYVKDALTELASDFKAMAKDLEQRNEL* |
| JGIcombinedJ26739_1010340922 | 3300002245 | Forest Soil | MLTSKEYLQRAEQCSQLANASCDAYVKEALAELASEFKAMAKDLEQRNER* |
| JGI25390J43892_100432561 | 3300002911 | Grasslands Soil | GEFYLLAFGAVMLTSKEYLQQAEECSQLANASSDVYVKEALTELASDFKAMAKDLEQRNER* |
| JGI25617J43924_100051161 | 3300002914 | Grasslands Soil | MLTSKAYIQQAEECLQLANASSDVYVKEALTELASDFKAMAKDLDQRNER* |
| Ga0063356_1038178521 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MLTSKEYLQQAEECSQLANASSDVYVKEALTELASDFKAMAKDLEQRNER* |
| Ga0062591_1022946742 | 3300004643 | Soil | KEYLQQAEECLQLANASSDVYVKDALTELASDFKAMAKDLEQRNEH* |
| Ga0066821_10112561 | 3300005147 | Soil | MLTSKEYLQQAEECLQLANASSDVYVKDALTELASDFKAMAKDLEQRNEH* |
| Ga0066823_100192962 | 3300005163 | Soil | MLTSKEYLQRAEECSQLANASSDVYVKKALTELACEFKATAKDLEQRNER* |
| Ga0066690_110604771 | 3300005177 | Soil | AEECSQLANASSDVYVKKALTELACEFKATAKDLEQRNER* |
| Ga0066678_101865941 | 3300005181 | Soil | MLTSKEYLQQAEDCSQLANASSDVYVKEALTELASDFKAMAKDLEQRNER |
| Ga0070668_1006620592 | 3300005347 | Switchgrass Rhizosphere | MLTSKKYLQQAEECLKLANASSDVYVKDALTELASDFKAMAKDLEQRNEH* |
| Ga0070709_100942702 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTSKEYVRQAEDCLQLANASSDVYVREALTELASDFKSIAKALEQRERNA* |
| Ga0070713_1003676154 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | QAEECLQLANASSDVYVKDALTELASDFKAMAKDLEQRNEH* |
| Ga0070710_100377467 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | AFGAVMLTSKEYVRQAEDCLQLANASSDVYVREALTELASDFKSIAKALEQRERNA* |
| Ga0070711_1008166111 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTSKKYLQQAEECLQLANASSDVYVKDALTELASDFKAMA |
| Ga0070705_1003427682 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | KEYLQQAEECSQLANATSDVYVKEALTELASDFKAMAKDLEQRNER* |
| Ga0070694_1000536984 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTSKEYLQQAEECSQLANATSDVYVKEALTELASDFKAMAKDLEQRNER* |
| Ga0070707_1001304615 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTSKEYLQRAEECSQLANASSDVYVKKALTELASEFKATAKDLEQRNER* |
| Ga0070698_1008375533 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | GLMLTSKEYLQRAEECSQLANASSDVYVKKALTELASEFKATAKDLEQRKER* |
| Ga0070697_1016540032 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTSKAYIQQAEECLQLANASSDVYVKEALTELASDFKAMAKD |
| Ga0070696_1019394861 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTSKEYLQQAEECSQLANATSDVYVKEALTELASDFKAMAKDLEQRNE |
| Ga0066704_107288402 | 3300005557 | Soil | MLTSKAYLQQAEECLQLANASSDVYVKEALTELASDFKAMAEDLEQRNGR* |
| Ga0066706_102923001 | 3300005598 | Soil | TSKEYLQQAEECSQLANASSDVYVKEALTELASDFKAMAKDLEQRNER* |
| Ga0070717_107899981 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | AFGGLMLTSKEYLQRAEECSQLANASSDVYVKKALTELASEFKATAKDLEQRKER* |
| Ga0075368_105090311 | 3300006042 | Populus Endosphere | MLTSKEYVRQAEDCLQLANASSDVFVREALTELASDFKSIAKALEQRERNA* |
| Ga0075432_105509191 | 3300006058 | Populus Rhizosphere | MLTSKEYLQQAEECLQLANASSDVYVKDALTELASDFKAMAKDLEQRNER* |
| Ga0070715_101594363 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTSKKYLQQAEECLKLANASSDVYVKDALTELASDFKAMA |
| Ga0075018_102452711 | 3300006172 | Watersheds | AFGGLMLTSKEYLQRAEECSQLANASSDVYVKKALTELASEFKATAKDLEQRNER* |
| Ga0070716_1002038631 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTSKEYLQQAEECSQLANASSDVYVKKALTELASEFKATAKDVERATNADEE* |
| Ga0070712_1002959282 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTSKKYLQQAEECLQLANASSDVYVKDALTELASDFKAMAKDLEQRNEH* |
| Ga0074064_117538372 | 3300006603 | Soil | MLTSKEYLQQAEECFQLANASSDVYVKDALTELASDFKAMAKDLEQRNEH* |
| Ga0075421_1008109482 | 3300006845 | Populus Rhizosphere | MLTSKEYLQQAEDCSQLANAPSDVYVKEALTELASDFKAMAKDLEQRNER* |
| Ga0075433_116547101 | 3300006852 | Populus Rhizosphere | TSKEYLQRAEECSQLANASSDVYVKKALTELASEFKATAKDLEQRNER* |
| Ga0075425_1013377741 | 3300006854 | Populus Rhizosphere | MLTSKKYLQQAEECLQLANASSDVYVKDALTELASDFKAMAKDLEQRNE |
| Ga0075425_1022373542 | 3300006854 | Populus Rhizosphere | MLTSKEYVRQAEDCLQLANASSDVYVREALTELASDFK |
| Ga0075434_1023268491 | 3300006871 | Populus Rhizosphere | MLTSKEYLQRAEECSQLANASGDVYVKKALTELACEFKATANNER* |
| Ga0075424_1013052991 | 3300006904 | Populus Rhizosphere | FGAVMLTSKEYVRQAEDCLQLANASSDVYVREALTELASDFKSIAKALEQRERNA* |
| Ga0075435_1013839072 | 3300007076 | Populus Rhizosphere | MLTSKEYLQRAEECSQLANASSDVYVKEALTELASDFKAMAKDLEQRNER* |
| Ga0075435_1019425021 | 3300007076 | Populus Rhizosphere | MLTSKKYLQQAEECLKLANASSDVYVKDALTELASDFKAMAKDLEQRNEP* |
| Ga0099829_103067054 | 3300009038 | Vadose Zone Soil | MLTSKEYLQQAEECLQLANASSDVYVKEALTELASDFKAMAEDLEQRNGR* |
| Ga0105247_118475632 | 3300009101 | Switchgrass Rhizosphere | MLTSKEYLQRAEECSQLANASSDVYVKEALTELASDF |
| Ga0066709_1031474052 | 3300009137 | Grasslands Soil | MLTSKEYLQQAEECSQLANASSDVYVKEALTELASDFKAMA |
| Ga0111538_120417541 | 3300009156 | Populus Rhizosphere | AFGAVMLTSKKYLQQAEECLQLANASSDVYVKDALTELASDFKAMAKDLEQRNEH* |
| Ga0075423_108492902 | 3300009162 | Populus Rhizosphere | MLTSKAYIQQAEECLQLANASSDVYVKEALTELASDFKAMAKDLERRNER* |
| Ga0105249_107016183 | 3300009553 | Switchgrass Rhizosphere | SKEYLQQAEECLQLANASSDVYVKEALTELASDFEAMAKELEQRNER* |
| Ga0127503_100736393 | 3300010154 | Soil | LTSKAYIQQAEECLQLANASSDVYVKEALTELASDFKAMAKDLDQRNER* |
| Ga0134088_100822801 | 3300010304 | Grasslands Soil | AEECSQLANASSDVYVKEALTELASDFKAMAKDLEQRNER* |
| Ga0134125_128378142 | 3300010371 | Terrestrial Soil | GAVMLTSKKYLQQAEECLQLANASSDVYVKDALTELASDFKAMAKDLEQRNEH* |
| Ga0134123_129167921 | 3300010403 | Terrestrial Soil | MLTSKEYVRQAEDCLQLANASSDVYVREALTELASDFKS |
| Ga0150983_101518311 | 3300011120 | Forest Soil | GAVMLTSKEYVRQAEDCLQLANASSDVFVREALTELASDFKSIAKALEQRERNA* |
| Ga0150983_135107503 | 3300011120 | Forest Soil | GLMLTSKEYLQRAEECSQLANASSDVYVKKALTELASEFKATAKDLEQRNER* |
| Ga0137392_109515912 | 3300011269 | Vadose Zone Soil | MLTSKEYLQQAEDCSRLANASSDVYVKEALTELASNFKAMAKDLARNER* |
| Ga0153974_10964342 | 3300012180 | Attine Ant Fungus Gardens | FLPAFGGLMLTSKEYLQRAEECSQLANASSDVYVKKALTELASEFKATAKDLEQRNER* |
| Ga0137364_106207862 | 3300012198 | Vadose Zone Soil | MLTSKEYLQQAEDCSQLANASSDVYVKEALTELASDFKAMAKDLEQRNER* |
| Ga0137380_108371691 | 3300012206 | Vadose Zone Soil | MLRSKEYLQQAEECLQLATASSDVYVKEALTELAS |
| Ga0150985_1161991131 | 3300012212 | Avena Fatua Rhizosphere | KEYVRQAEDCLQLANASSDVYVREALTELASDFKSIAKALEQRERNA* |
| Ga0137371_110074621 | 3300012356 | Vadose Zone Soil | LAFGAVMLTSKEYLQQAEDCSQLANAPSDVYVKEALTELASDFKAMAKDLEQRNER* |
| Ga0137360_102381421 | 3300012361 | Vadose Zone Soil | RERSNYSANCAHERFGAVMLTSKAYIQQAEECLQLANASSDVYVKEALTELASDFKAMAKDLDQRNER* |
| Ga0137398_101924222 | 3300012683 | Vadose Zone Soil | MLTSKEYLQQAEDCSRLANASSDVYVKEALTELASDFKAMAKDLDQRNER* |
| Ga0137359_101745543 | 3300012923 | Vadose Zone Soil | LGELYLLAFGAVMLTSKEYLQQAEDCSQLASASSDVYVKEALTELASDFKAMAKELEQRNER* |
| Ga0137359_111850711 | 3300012923 | Vadose Zone Soil | ANCAHERFGAVMLTSKAYIQQAEECLQLANASSDVYVKEALTELASDFKAMAKDLEQRNER* |
| Ga0137413_117022171 | 3300012924 | Vadose Zone Soil | MLTSKEYLQQAEDCSQLASASSDVYVKEALTELASDFKAMAKELEQRNER* |
| Ga0162651_1000275352 | 3300012938 | Soil | MLTSKAYLQQAEECLQLANASSDVYVKEALTELASDFKAMAENLDQRNER* |
| Ga0164303_102686121 | 3300012957 | Soil | MLTSKEYLQRAEECSQLANASSDVYVKDALTELAS |
| Ga0164301_103694461 | 3300012960 | Soil | MLTSKEYLQQAEECLQLANASSDVYVKDALTELSSDFKAMAKDLEQRNEH* |
| Ga0164308_117029732 | 3300012985 | Soil | LMLTSKEYLQRAEECSQLANASSDVYVKKALTELASEFKATAKDLEQRNER* |
| Ga0164304_117730092 | 3300012986 | Soil | MLTSKEYLQRAEECSQLANASSDVYVKDALTELASDFKAMAKDLEQRNEH* |
| Ga0164306_107314281 | 3300012988 | Soil | KYLQQAEECLKLANASSDVYVKDALTELASDFKAMAKDLEQRNEP* |
| Ga0132255_1050656111 | 3300015374 | Arabidopsis Rhizosphere | MLTSKEYVRQAEDCLQLANASTDVYVREALTELASDFKSIAK |
| Ga0182041_106041262 | 3300016294 | Soil | MLTSKEYLQRAEECSQLANASSDVYVKKALTELACEF |
| Ga0066662_120953681 | 3300018468 | Grasslands Soil | MLTSKEYLQQAEECSQLANASSDVYVKEALTELASDFKAMAKDLEQRNER |
| Ga0066662_124214091 | 3300018468 | Grasslands Soil | MLTSKEYVRQAEDCLQLANASSDVYVREALTELASDFKSIAKALEQRERNA |
| Ga0066669_108046062 | 3300018482 | Grasslands Soil | MLTSKEYLEQAEDCSQLASASSDVYVKEALTELASDFKAMAKDLEQRNER |
| Ga0210407_104268892 | 3300020579 | Soil | MLTSKEYVRQAEDCLQLANASSDVYVREALTELASDFKSIAKALEQREHHGWMENATVGR |
| Ga0210387_100833715 | 3300021405 | Soil | MLTSKEYVRQAEDCLQLANASSDVYVREALTELASDFKSIAKALEQREHHGWMENA |
| Ga0210410_101843884 | 3300021479 | Soil | MLTSKEYVRQAEDCLQLANASSDVYVREALTELASDFKSIAKALEQREH |
| Ga0207663_110944242 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTSKKYLQQAEECLQLANASSDVYVKDALTELASDFKAMAKDLEQRNEP |
| Ga0207646_103111541 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTSKEYLQQAEECSQLANATSDVYVKEALTELASDFKAMAKDLEQRNER |
| Ga0207646_103440853 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTSKEYLQRAEECSQLANASSDVYVKKALTELACEFKAT |
| Ga0207700_106103291 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTSKEYVRQAEDCLQLANASSDVYVREALTELAS |
| Ga0207700_117878161 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | ELYSRAFSAVILTSKEYLQQAEECLQLANASSDVYVKEALTELASDFEAMAKELEQRNER |
| Ga0207665_114224961 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTSKEYLQQAEECSQLANASSDVYVKEALTELASDFKAMAKDLEQRNE |
| Ga0207675_1022472511 | 3300026118 | Switchgrass Rhizosphere | LAFGAVMLTSKEYVRQAEDCLQLANASSDVFVREALTELASDFKSIAKALEQRERNA |
| Ga0209240_10077992 | 3300026304 | Grasslands Soil | MLTSKAYIQQAEECLQLANASSDVYVKEALTELASDFKAMAKDLDQRNER |
| Ga0209239_10746294 | 3300026310 | Grasslands Soil | GAVMLTSKEYLQQAEECSQLANASSDVYVKEALTELASDFKAMAKDLEQRNER |
| Ga0257160_10477152 | 3300026489 | Soil | YLQQAEECLQLANASSDVYVKDALTELASDFKAMAKDLEQRNEH |
| Ga0257159_10309992 | 3300026494 | Soil | MLTSKAYIQQAEECLQLANASGDVYVKEALTELASDFKAMAKDLDQRNER |
| Ga0257159_10393222 | 3300026494 | Soil | MLTSKEYLQRAEECSQLANASSDVYVKDALTELASDFKAMAKDLEQRNEH |
| Ga0179587_103536211 | 3300026557 | Vadose Zone Soil | MLTSKAYIQQAEECLQLANASSDVYVKDALTKLASDFKAMAKDLEQRNEH |
| Ga0207983_10365442 | 3300027310 | Soil | VPSSAFGGLMLTSKEYLQRAEECSQLANASSDVYVKKALTELASEFKATAKDLEQRNER |
| Ga0209526_100106834 | 3300028047 | Forest Soil | MLTSKEYLQRAEECSQLANASSDVYVKKALTELASEFKATAKDLEQRKER |
| Ga0137415_101490825 | 3300028536 | Vadose Zone Soil | MLTSKAYIQQAEECLQLANASSDVYVKEALTELASDFKAMAEDLEQRNGR |
| Ga0307317_102611411 | 3300028720 | Soil | MLTSKEYVRQAEDCLQLANASSDVYVREALTELASDFKSIAKAFEQRERNA |
| Ga0222749_103456752 | 3300029636 | Soil | MLTSKEYLQRAEECSQLANASSDVYVKKALTELASEIKATAKDLEQRNER |
| Ga0222749_104269651 | 3300029636 | Soil | MLTSKEYVRQAEDCLQLAKASSDVYVREALTELASD |
| Ga0308202_11544981 | 3300030902 | Soil | LTSKEYVRQAEDCLQLANASSDVYVREALTELASDFKSIAKALEQRERNA |
| Ga0170824_1148774222 | 3300031231 | Forest Soil | ERFGAVMLTSKAYIQQAEECLQLANASSDVYVKEALTELASDFKAMAKDLDQRNER |
| Ga0310915_100169676 | 3300031573 | Soil | MLTSKEYLQRAEECSQLANASSDVYVKKALTELACEFKATAKDLEQRNER |
| Ga0307469_118130272 | 3300031720 | Hardwood Forest Soil | MLTSKAYLQQAEECLQLANASSDVYVKKALTELACEFKATAKDLEQRNER |
| Ga0307473_107357082 | 3300031820 | Hardwood Forest Soil | MLTSKEYLQQAEECLQLANASSDVYVKDALTELASDFKAMAKDLDQRNER |
| Ga0307471_1037361001 | 3300032180 | Hardwood Forest Soil | MLTSKAYLQQAEECLQFANASSDVYVKEALTELASEWPWTWKQR |
| Ga0370546_081919_257_409 | 3300034681 | Soil | MLTSKEYLQQAEDCSQLANASSDVYVKEALTELASNFKAIAKDLEQRNER |
| ⦗Top⦘ |