NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F096089

Metagenome / Metatranscriptome Family F096089

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F096089
Family Type Metagenome / Metatranscriptome
Number of Sequences 105
Average Sequence Length 42 residues
Representative Sequence VAVRTPDSGFENLERRYESVARLVPYLLLVVPFIPYVLSQ
Number of Associated Samples 98
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 99.05 %
% of genes near scaffold ends (potentially truncated) 99.05 %
% of genes from short scaffolds (< 2000 bps) 96.19 %
Associated GOLD sequencing projects 93
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (60.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(31.429 % of family members)
Environment Ontology (ENVO) Unclassified
(34.286 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(38.095 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 47.06%    β-sheet: 0.00%    Coil/Unstructured: 52.94%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF01061ABC2_membrane 89.52
PF00005ABC_tran 4.76
PF08241Methyltransf_11 0.95
PF00282Pyridoxal_deC 0.95
PF12698ABC2_membrane_3 0.95
PF12840HTH_20 0.95

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 105 Family Scaffolds
COG0076Glutamate or tyrosine decarboxylase or a related PLP-dependent proteinAmino acid transport and metabolism [E] 0.95


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms60.00 %
UnclassifiedrootN/A40.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001991|JGI24743J22301_10048414Not Available863Open in IMG/M
3300004092|Ga0062389_104827197Not Available508Open in IMG/M
3300005341|Ga0070691_10062630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1791Open in IMG/M
3300005436|Ga0070713_101533987All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales646Open in IMG/M
3300005439|Ga0070711_100947861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales736Open in IMG/M
3300005533|Ga0070734_10670042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia590Open in IMG/M
3300005538|Ga0070731_10519325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales793Open in IMG/M
3300005541|Ga0070733_10144508All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1540Open in IMG/M
3300005563|Ga0068855_100924185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales920Open in IMG/M
3300005602|Ga0070762_10982974Not Available578Open in IMG/M
3300005614|Ga0068856_101689550All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia646Open in IMG/M
3300005841|Ga0068863_101238258Not Available752Open in IMG/M
3300006163|Ga0070715_10836148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia562Open in IMG/M
3300006914|Ga0075436_101471903Not Available517Open in IMG/M
3300009090|Ga0099827_10127763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2055Open in IMG/M
3300009520|Ga0116214_1148576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales872Open in IMG/M
3300009545|Ga0105237_10434548All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1318Open in IMG/M
3300009545|Ga0105237_10846563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales921Open in IMG/M
3300009700|Ga0116217_10636038Not Available663Open in IMG/M
3300010398|Ga0126383_10791800All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1031Open in IMG/M
3300012210|Ga0137378_11346610Not Available629Open in IMG/M
3300012359|Ga0137385_10307634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1363Open in IMG/M
3300012984|Ga0164309_10677939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales815Open in IMG/M
3300013105|Ga0157369_11501929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales685Open in IMG/M
3300014166|Ga0134079_10183769All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales866Open in IMG/M
3300014969|Ga0157376_11972079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia621Open in IMG/M
3300015372|Ga0132256_101006784All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales949Open in IMG/M
3300016294|Ga0182041_10824329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales830Open in IMG/M
3300016294|Ga0182041_11211638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia689Open in IMG/M
3300016357|Ga0182032_10341210All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1196Open in IMG/M
3300016422|Ga0182039_11770025All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales566Open in IMG/M
3300017932|Ga0187814_10055656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces longwoodensis1456Open in IMG/M
3300017959|Ga0187779_10945741Not Available595Open in IMG/M
3300017973|Ga0187780_10728572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales716Open in IMG/M
3300017994|Ga0187822_10041316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1268Open in IMG/M
3300018001|Ga0187815_10137282All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1034Open in IMG/M
3300018085|Ga0187772_10273528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1152Open in IMG/M
3300018086|Ga0187769_10234756All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura kijaniata1362Open in IMG/M
3300020150|Ga0187768_1031792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1152Open in IMG/M
3300021374|Ga0213881_10398952Not Available619Open in IMG/M
3300021439|Ga0213879_10259752Not Available527Open in IMG/M
3300021479|Ga0210410_10919690Not Available762Open in IMG/M
3300021560|Ga0126371_10274570All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1806Open in IMG/M
3300024178|Ga0247694_1025848Not Available659Open in IMG/M
3300024251|Ga0247679_1094948Not Available505Open in IMG/M
3300024310|Ga0247681_1027980Not Available828Open in IMG/M
3300025898|Ga0207692_10900970Not Available582Open in IMG/M
3300025905|Ga0207685_10276887All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales822Open in IMG/M
3300025907|Ga0207645_10467204Not Available852Open in IMG/M
3300025914|Ga0207671_10167043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1707Open in IMG/M
3300025935|Ga0207709_10374402Not Available1082Open in IMG/M
3300025945|Ga0207679_11117304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales723Open in IMG/M
3300025949|Ga0207667_10847046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales909Open in IMG/M
3300027604|Ga0208324_1190202Not Available547Open in IMG/M
3300027725|Ga0209178_1351480Not Available552Open in IMG/M
3300027729|Ga0209248_10137198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales731Open in IMG/M
3300027857|Ga0209166_10636295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura540Open in IMG/M
3300027869|Ga0209579_10344688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia806Open in IMG/M
3300027910|Ga0209583_10366405Not Available676Open in IMG/M
3300028828|Ga0307312_10510073All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales794Open in IMG/M
3300030053|Ga0302177_10626386All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria548Open in IMG/M
3300030494|Ga0310037_10149823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1058Open in IMG/M
3300030503|Ga0311370_11771880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria629Open in IMG/M
3300030524|Ga0311357_10406397All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1284Open in IMG/M
3300030862|Ga0265753_1149834Not Available503Open in IMG/M
3300030906|Ga0302314_10414476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1487Open in IMG/M
3300031544|Ga0318534_10807889Not Available527Open in IMG/M
3300031545|Ga0318541_10842114Not Available512Open in IMG/M
3300031549|Ga0318571_10297073All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura606Open in IMG/M
3300031564|Ga0318573_10774231Not Available515Open in IMG/M
3300031681|Ga0318572_10651884Not Available627Open in IMG/M
3300031681|Ga0318572_10659801Not Available623Open in IMG/M
3300031716|Ga0310813_11128592Not Available720Open in IMG/M
3300031747|Ga0318502_10291355Not Available959Open in IMG/M
3300031748|Ga0318492_10645422Not Available566Open in IMG/M
3300031751|Ga0318494_10189438All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1169Open in IMG/M
3300031751|Ga0318494_10627131Not Available629Open in IMG/M
3300031770|Ga0318521_10948630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales527Open in IMG/M
3300031771|Ga0318546_10329069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1061Open in IMG/M
3300031779|Ga0318566_10041031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2170Open in IMG/M
3300031782|Ga0318552_10721866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura508Open in IMG/M
3300031795|Ga0318557_10511943Not Available551Open in IMG/M
3300031831|Ga0318564_10082259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1424Open in IMG/M
3300031831|Ga0318564_10111090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura kijaniata1219Open in IMG/M
3300031890|Ga0306925_11584966Not Available637Open in IMG/M
3300031894|Ga0318522_10258707Not Available660Open in IMG/M
3300031897|Ga0318520_10300814Not Available966Open in IMG/M
3300031942|Ga0310916_10610965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales926Open in IMG/M
3300032008|Ga0318562_10163588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1284Open in IMG/M
3300032008|Ga0318562_10342706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales869Open in IMG/M
3300032041|Ga0318549_10368145Not Available648Open in IMG/M
3300032042|Ga0318545_10178973Not Available757Open in IMG/M
3300032052|Ga0318506_10101496All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1230Open in IMG/M
3300032054|Ga0318570_10576095Not Available513Open in IMG/M
3300032055|Ga0318575_10335682Not Available765Open in IMG/M
3300032065|Ga0318513_10013640All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3246Open in IMG/M
3300032068|Ga0318553_10435972Not Available686Open in IMG/M
3300032076|Ga0306924_11391311Not Available749Open in IMG/M
3300032076|Ga0306924_12015676Not Available594Open in IMG/M
3300032783|Ga0335079_11283065Not Available732Open in IMG/M
3300032896|Ga0335075_10733253All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales942Open in IMG/M
3300032897|Ga0335071_10734910All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales936Open in IMG/M
3300032955|Ga0335076_10129320All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2446Open in IMG/M
3300033134|Ga0335073_10778568All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1031Open in IMG/M
3300033158|Ga0335077_11269277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales717Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil31.43%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.67%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.71%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.71%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil4.76%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.81%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.81%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.81%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.86%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.86%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.86%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.86%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.90%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.90%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.95%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.95%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.95%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.95%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.95%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.95%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.95%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.95%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.95%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.95%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001991Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2Host-AssociatedOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300020150Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MGEnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021439Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03EnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300024178Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK35EnvironmentalOpen in IMG/M
3300024251Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20EnvironmentalOpen in IMG/M
3300024310Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027604Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027729Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030862Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030906Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI24743J22301_1004841413300001991Corn, Switchgrass And Miscanthus RhizosphereVAVRTPDSGFENLERRYESVARLVPYLLLVVPFIPYVLS
Ga0062389_10482719723300004092Bog Forest SoilVTVRTPDSGFESIEHRYDRLERFLPLLLLAVPLVPYVLSQSPTAGAFG
Ga0070691_1006263013300005341Corn, Switchgrass And Miscanthus RhizosphereVAVRTPDSGFENLERRYESVARLVPYLLLVVPFIPYVLSQAPSAGAIG
Ga0070713_10153398713300005436Corn, Switchgrass And Miscanthus RhizosphereVRTPDSSFEPLELRFERIQRFVPYLLLTFPLIPYVLSQNPSAG
Ga0070711_10094786123300005439Corn, Switchgrass And Miscanthus RhizosphereVTVRTPDSGFESLEKRYESLSRIIPYLLLAIPLVPYALSQSPT
Ga0070734_1067004223300005533Surface SoilVSAVTVRTPDSGFESLDQRFESLMRLAPYALLIVPLVPYVLSMSPSAGAFGV
Ga0070731_1051932523300005538Surface SoilVSAVTVRTPDSGFESLERRFERIDRFIPYLLLAFPLLPYVFSQDPSAG
Ga0070733_1014450813300005541Surface SoilVTVGTPDSGFESLERRYESLARVLQYVLLAVPLIPYVLVFRPSAGA
Ga0068855_10092418523300005563Corn RhizosphereVNAVTVRTPDSGFENLERRYESVARLVPYLLLVVP
Ga0070762_1098297423300005602SoilVALRTPDSGFESLFIRYEKFERLLPLLLLVLPLLPYVLSQSPSAAAAG
Ga0068856_10168955023300005614Corn RhizosphereVNAVTVRTPDSGFENLERRYESVARLVPYLLLVVPFIPYVLSQAPSAG
Ga0068863_10123825813300005841Switchgrass RhizosphereVVAVRTPDSGFENLERRYESVARLVPYLLLVVPFIPYVLS
Ga0070715_1083614823300006163Corn, Switchgrass And Miscanthus RhizosphereVRTPDSGFEPLELRFERIQRLVPYLLLTFPLIPYVLSQNPSAGAV
Ga0075436_10147190323300006914Populus RhizosphereVTVRTPDSGFEALEQRYESASRFIPYLLLAVPLVPYLL
Ga0099827_1012776333300009090Vadose Zone SoilVTVRTPDSGFEALEKRYESLSRVIPYLLLAVPLGPYALSQQPSAGAFG
Ga0116214_114857623300009520Peatlands SoilMTVSTPDSGLELLEQRYERLAHVIVYVLLAVPLIPY
Ga0105237_1043454833300009545Corn RhizosphereVSVVAVRTPDSGFENLERRYESVARLVPYLLLVVPFIPYVLSQAP
Ga0105237_1084656323300009545Corn RhizosphereVNAVTVRTPDSGFENLERRYESVARLVPYLLLVVPFIPYVLSQAP
Ga0116217_1063603823300009700Peatlands SoilVTVRTPDSGFESIEQRFDRLERVIPFLLLAVPLIPYVLSQSPTAG
Ga0126383_1079180033300010398Tropical Forest SoilVSAVTVRTPDSGFENIERRYESVARVVPYLLLVVPLIPYVLS
Ga0137378_1134661023300012210Vadose Zone SoilMTVRTPDSGFENLDRRYESVARLVPYLLLVVPLIPYALSQ
Ga0137385_1030763433300012359Vadose Zone SoilMSAVTVRTPDSGLENLERRHDSVARVVPYLLLVVPL
Ga0164309_1067793923300012984SoilVSEVTVRTPDSGFEPLELRFERIQRLVPYLLLTFPLIPYVLSQ
Ga0157369_1150192913300013105Corn RhizosphereVSAVAVRTPDSGFENLERRYESVARLVPYLLLVVPFI
Ga0134079_1018376923300014166Grasslands SoilVSTVAVRTPDSGFESLEQRYETLSRFIPYLLLAVPLVPYALSQ
Ga0157376_1197207913300014969Miscanthus RhizosphereVNAVTVRTPDSGFENLERRYESVARLVPYLLLVVPFIPYVL
Ga0132256_10100678423300015372Arabidopsis RhizosphereVSAVTVRTPDSGFENLERRYETVARLVPYLLLVVPFIPYVLSQSPT
Ga0182041_1082432913300016294SoilVTVRTPDSGFENLERRYESVARWVPYMLLVAPFIPY
Ga0182041_1121163813300016294SoilVTVRTPDRGFIELEQRYEKLGRVLPYVLLGVPLIPYVLSQNPTTG
Ga0182032_1034121013300016357SoilVSPVTVRTPDSGFEAVEQRYQSLTRVIPYLLLAVPLV
Ga0182039_1177002523300016422SoilVTVRTPDSGFESIEHRYQRIQRFLPFLRLTVPLIPYVLS
Ga0187814_1005565633300017932Freshwater SedimentVTVRTPDSGLESLERRYESLARVIQYVLLAIPLIPYVLVFRPSAG
Ga0187779_1094574123300017959Tropical PeatlandVRTPDSGLESIEQRYDSLLRLMPYLLLAVPLIPYALSEST
Ga0187780_1072857213300017973Tropical PeatlandVTVRTPDSSLESIEQRYDLVMRLVPYLLLAVPLIPYALSQSPTAG
Ga0187822_1004131623300017994Freshwater SedimentVTVRTPDSGFESLERRFERIDRLIPYLLLAFPLLPYVFSENPSAG
Ga0187815_1013728233300018001Freshwater SedimentMTVRTPDSNLESLEQRYDSLLRLLPFLLLTVPLLPYVLSQS
Ga0187772_1027352833300018085Tropical PeatlandVTVLTPDSGLESIEQRYDSLLRLMPYLLLAVPLIPYALSE
Ga0187769_1023475633300018086Tropical PeatlandVTARTPDSGLESIEQRYNWFLRLIPYLLLVVPLIPYALSQSP
Ga0187768_103179213300020150Tropical PeatlandVTVRTPDSGFESLDRRYESIMRWLPYLLLAVPLVLYVLTQSPSAGAF
Ga0213881_1039895213300021374Exposed RockVRTPDSGFENLDRRYESAGRLVPFLLLVVPLVPYVLTQAPSAGAAGI
Ga0213879_1025975223300021439Bulk SoilVTIRTPDSNLESLEQRYESIMRWVPYLVLAVPFLPYVLSQSPTTG
Ga0210410_1091969023300021479SoilVTVRTPDSDIESMEQRYDSLLRLLPFLLLTVPLLPYFLSQRPTAGA
Ga0126371_1027457013300021560Tropical Forest SoilVTVRTPDSGFENLDRRYESVARWVPFVLLVVPFIPYVLSQAPSAG
Ga0247694_102584813300024178SoilVAVRTPDSGFENLERRYESVARLVPYLLLVVPFIPY
Ga0247679_109494823300024251SoilVVAVRTPDSGFENLERRYESVARLVPYLLLVVPFIPYVLSQA
Ga0247681_102798023300024310SoilVAVRTPDSGFENLERRYESVARLVPYLLLVVPFIPYVLSQAPSAGAV
Ga0207692_1090097013300025898Corn, Switchgrass And Miscanthus RhizosphereVRTPDSGFEPLELRFERLQRFVPYLLLTFPLIPYVLSQNPSAG
Ga0207685_1027688723300025905Corn, Switchgrass And Miscanthus RhizosphereVSTVTVRTPDSGFESLEKRYESLSRIIPYLLLVIPLVPYALSQS
Ga0207645_1046720423300025907Miscanthus RhizosphereVAVRTPDSGFENLERRYESVARLVPYLLLVVPFIPYVLSQ
Ga0207671_1016704313300025914Corn RhizosphereVNAVTVRTPDSGFENLERRYESVARLVPYLLLVVPFIPYVLSQAPSAGAIG
Ga0207709_1037440233300025935Miscanthus RhizosphereVAVRTPDSGFENLERRYESVARLVPYLLLVVPFIPYVLSQA
Ga0207679_1111730413300025945Corn RhizosphereVRTPDSGFENLDRRYESAGRLVPFLLLVVPLILYVLTQTPSAGAA
Ga0207667_1084704613300025949Corn RhizosphereVNAVTVRTPDSGFENLERRYESVARLVPYLLLVVPF
Ga0208324_119020233300027604Peatlands SoilVTVRTPDSSFESIEHRYERLERFLPLLLLAVPLVPYVLSQSP
Ga0209178_135148023300027725Agricultural SoilVAVRTPDSGFENLERRYESVARLVPYLLLVVPFIPYVLSQAPSAGAI
Ga0209248_1013719823300027729Bog Forest SoilVRTPDSSLESMEQRYDSLLRLLPFLLLTVPLLPYFLSQRPTAG
Ga0209166_1063629523300027857Surface SoilVTVRTPDSSFEALEQKADQYARVLPYLLLAVPLIPYVL
Ga0209579_1034468813300027869Surface SoilVSAVTVRTPDSGFESLDQRFESLMRLAPYALLIVPLVPYVLSMSPSAGAFG
Ga0209583_1036640513300027910WatershedsVTVRTPDSGFESIEQRFERLERFLPFLLLSVPLIPYV
Ga0307312_1051007313300028828SoilVVAVRTPDSGFESLEQRYETLSRFIPYLLLAVPLVPYVLS
Ga0302177_1062638613300030053PalsaVALRTPDSGFESLESRYLAIERFLPFLLLMVPLLPYVLS
Ga0310037_1014982313300030494Peatlands SoilVTVRTPDSSLESLEQRYDSLLRLLPFLLLTVPLLPYY
Ga0311370_1177188023300030503PalsaVALRTPDSGFESLESRYLTIERFLPFLLLTVPLLPY
Ga0311357_1040639733300030524PalsaVTVRTPDSGFEALESQADRLARVAPYLLLAVPLIP
Ga0265753_114983423300030862SoilVTARTPDSGFESIEHRYERLERFLPLLLLAVPLVPYVLS
Ga0302314_1041447613300030906PalsaVALRTPDSGFESLESRYLTIERFLPFLLLTVPLLPYVLSQNPSAG
Ga0318534_1080788923300031544SoilVTVRTPDSNLESVERRYELLLRLVPFLLLVFPLLPYALTQSPS
Ga0318541_1084211423300031545SoilVTVRAPDSGFESLERRYESLMRVVPFVLLTFPLLP
Ga0318571_1029707313300031549SoilVSVRTPDSGFDSLERYDSLLLLAPYLLLAVPLIPYALSQSPTAGAFG
Ga0318573_1077423123300031564SoilVTVRTPDSGLESLERRYESIMRVLPYPLLAVPLVPYALTQNPTAGAFVIT
Ga0318572_1065188423300031681SoilVTVRTPDSGLESLERRYESIMRVLPYPLLAVPLVPYALTQNPTAG
Ga0318572_1065980113300031681SoilVSAVTVRTPDSGFEAVEQRYESLSRVIPFLLLAFPL
Ga0310813_1112859213300031716SoilVSAVTVRTPDSGFENLERRYESVARLVPYLLLVVPLIPYVLSQSPS
Ga0318502_1029135523300031747SoilVTVNTPDSGLESLERRYESIMRVLPYPLLAVPLVPYVLT
Ga0318492_1064542213300031748SoilVVTVRTPDSGFESLERRFQRIDRFTPYLLLAFPLLPYVLSQNP
Ga0318494_1018943813300031751SoilVSAVTVRTPDSGFEAVEQRYESLSRVIPFLLLAFP
Ga0318494_1062713113300031751SoilVTVRTPDSGFESLERRFQRIDRFIPYLLLAFPLLPYVL
Ga0318521_1094863013300031770SoilVSPVTVRTPDSGFEAVEQRYQSLTRVIPYLLLAVPLVPYALSQSPT
Ga0318546_1032906913300031771SoilVTVNTPDSGLESLERRYESIMRVLPYPLLAVPLIPYVITQN
Ga0318566_1004103113300031779SoilVTVNTPDSGLESLERRYESIMRVLPYPLLAVPLVPYVLTQGP
Ga0318552_1072186613300031782SoilVSVRTPDSGFDSLERYDSLLLLAPYLLLAVPLIPYAL
Ga0318557_1051194313300031795SoilVTVNTPDSGLESLEQRYESLLRVLPYVLLAVPLIPYGLAQSPAGGAFGI
Ga0318564_1008225913300031831SoilVTVNTPDSGLESLEQRYESLLRVLPYVLLAVPLIPYGLAQSPAGGAFGITAG
Ga0318564_1011109033300031831SoilVTVNTPDSGLESLERRYESIMRVLPYPLLAVPLVPY
Ga0306925_1158496613300031890SoilVSAVTVRTPDSGFEAVEQRYESLSRVIPFLLLAFPLIPYVI
Ga0318522_1025870713300031894SoilVTVNTPDSGLESLEQRYESLLRVLPYVLLAVPLIPYG
Ga0318520_1030081423300031897SoilVTVRTPDSGFENLERRYESVARWVPYLLLVAPFIPYVLSQAP
Ga0310916_1061096513300031942SoilVSVRTPDSGFDSLERYDSLLLLAPYLLLAVPLIPYALSQSPTAG
Ga0318562_1016358833300032008SoilVTVRTPDSGFENIERRHESVARVVPYLVLVVPLIPY
Ga0318562_1034270623300032008SoilVTVRTPDSGFESLERRFQRIDRFIPYLLLAFPLLPYVLSQNPSAGAV
Ga0318549_1036814513300032041SoilVTVRTPDSGFESLERRFQRIDRFTPYLLLAFPLLPYVLSQN
Ga0318545_1017897313300032042SoilVTVNTPDSGLESLERRYESIMRVLPYPLLAVPLVPYVLTQGPGAG
Ga0318506_1010149613300032052SoilVSVRTPDSGFDSLERYDSLLLLAPYLLLAVPLIPYALSQSPT
Ga0318570_1057609523300032054SoilVTVRTPDSGFENLERRYESVARWVPYLLLVAPFIPYILSQAPS
Ga0318575_1033568213300032055SoilVTVNTPDSGLESLERRYESIMRVLPYPLLAVPLVPYVLTQDPSAGAFAI
Ga0318513_1001364013300032065SoilVTVNTPDSGLESLERRYESIMRVLPYPLLAVPLVPYVLTQDPS
Ga0318553_1043597223300032068SoilVTVNTPDSGLESLERRYESIMRVLPYPLLAVPLVPYVLTQGPG
Ga0306924_1139131123300032076SoilVTVNTPDSGLESLERRYESIMRVLAYPLLAVPLIPYVLTQNPSAGAFAIT
Ga0306924_1201567623300032076SoilVTVRTPDSGFENLERRYESVARWVPYLLLVAPFIP
Ga0335079_1128306513300032783SoilVTVRTPDSGFESLERRFQRIDRFIPYLLLAFPLLPYVLS
Ga0335075_1073325323300032896SoilVSAVTVRTPDSGFESLDQRFESLMRLAPYALLIVPLVPYVLSMSP
Ga0335071_1073491013300032897SoilVTVRTPDSGFENLERRYESVARWVPYLLLVAPFIPYVLSQAPSAGAF
Ga0335076_1012932043300032955SoilVTVRTPDSGFENLERRYESVARWVPYLLLVAPFIPYVLSQAPSA
Ga0335073_1077856833300033134SoilVTVRTPDSGFESLEHRYESAARVVQYLLLVLPLLPYVL
Ga0335077_1126927723300033158SoilVTARTPDSGLESLERRYERIERFLPGLLLAVPLIP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.