| Basic Information | |
|---|---|
| Family ID | F096032 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 39 residues |
| Representative Sequence | SLTGNCEKTNIPKTINIRDITQATTGLLILTSVIYI |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.05 % |
| % of genes from short scaffolds (< 2000 bps) | 96.19 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (75.238 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (25.714 % of family members) |
| Environment Ontology (ENVO) | Unclassified (64.762 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (83.810 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF16576 | HlyD_D23 | 61.90 |
| PF00581 | Rhodanese | 5.71 |
| PF12700 | HlyD_2 | 1.90 |
| PF00873 | ACR_tran | 0.95 |
| PF01625 | PMSR | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 75.24 % |
| All Organisms | root | All Organisms | 24.76 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001955|GOS2237_1055632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 615 | Open in IMG/M |
| 3300002913|JGI26060J43896_10043993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1287 | Open in IMG/M |
| 3300003494|JGI26240J51127_1066293 | Not Available | 551 | Open in IMG/M |
| 3300005931|Ga0075119_1070520 | Not Available | 816 | Open in IMG/M |
| 3300006024|Ga0066371_10161967 | Not Available | 689 | Open in IMG/M |
| 3300006024|Ga0066371_10274703 | Not Available | 528 | Open in IMG/M |
| 3300006166|Ga0066836_10555455 | Not Available | 695 | Open in IMG/M |
| 3300006190|Ga0075446_10142741 | Not Available | 685 | Open in IMG/M |
| 3300006308|Ga0068470_1887763 | Not Available | 622 | Open in IMG/M |
| 3300006332|Ga0068500_1793963 | Not Available | 620 | Open in IMG/M |
| 3300006351|Ga0099953_1424770 | Not Available | 971 | Open in IMG/M |
| 3300006357|Ga0075502_1180559 | Not Available | 571 | Open in IMG/M |
| 3300006413|Ga0099963_1337213 | Not Available | 799 | Open in IMG/M |
| 3300006565|Ga0100228_1425026 | Not Available | 513 | Open in IMG/M |
| 3300007692|Ga0102823_1082741 | Not Available | 852 | Open in IMG/M |
| 3300007778|Ga0102954_1077365 | Not Available | 926 | Open in IMG/M |
| 3300007862|Ga0105737_1170492 | Not Available | 570 | Open in IMG/M |
| 3300007962|Ga0102907_1079752 | Not Available | 863 | Open in IMG/M |
| 3300007981|Ga0102904_1029988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1221 | Open in IMG/M |
| 3300008253|Ga0105349_10339605 | Not Available | 625 | Open in IMG/M |
| 3300008961|Ga0102887_1105182 | Not Available | 889 | Open in IMG/M |
| 3300009054|Ga0102826_1076250 | Not Available | 803 | Open in IMG/M |
| 3300009074|Ga0115549_1133681 | Not Available | 813 | Open in IMG/M |
| 3300009172|Ga0114995_10176179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1190 | Open in IMG/M |
| 3300009172|Ga0114995_10605509 | Not Available | 599 | Open in IMG/M |
| 3300009409|Ga0114993_11148795 | Not Available | 548 | Open in IMG/M |
| 3300009420|Ga0114994_11007869 | Not Available | 538 | Open in IMG/M |
| 3300009425|Ga0114997_10169102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1278 | Open in IMG/M |
| 3300009425|Ga0114997_10527160 | Not Available | 627 | Open in IMG/M |
| 3300009425|Ga0114997_10687941 | Not Available | 535 | Open in IMG/M |
| 3300009436|Ga0115008_10811265 | Not Available | 686 | Open in IMG/M |
| 3300009447|Ga0115560_1094160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1240 | Open in IMG/M |
| 3300009476|Ga0115555_1169524 | Not Available | 909 | Open in IMG/M |
| 3300009476|Ga0115555_1228343 | Not Available | 761 | Open in IMG/M |
| 3300009481|Ga0114932_10268674 | Not Available | 1026 | Open in IMG/M |
| 3300009496|Ga0115570_10453256 | Not Available | 540 | Open in IMG/M |
| 3300009508|Ga0115567_10972768 | Not Available | 502 | Open in IMG/M |
| 3300009526|Ga0115004_10222453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1127 | Open in IMG/M |
| 3300009705|Ga0115000_10274923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1094 | Open in IMG/M |
| 3300009705|Ga0115000_10324021 | Not Available | 993 | Open in IMG/M |
| 3300009706|Ga0115002_10813547 | Not Available | 652 | Open in IMG/M |
| 3300009706|Ga0115002_11064486 | Not Available | 552 | Open in IMG/M |
| 3300009785|Ga0115001_10069832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2307 | Open in IMG/M |
| 3300009786|Ga0114999_11190648 | Not Available | 544 | Open in IMG/M |
| 3300009786|Ga0114999_11355047 | Not Available | 502 | Open in IMG/M |
| 3300010883|Ga0133547_10375050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2918 | Open in IMG/M |
| 3300010883|Ga0133547_10546431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2329 | Open in IMG/M |
| 3300010883|Ga0133547_10803725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1847 | Open in IMG/M |
| 3300010883|Ga0133547_11104281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1524 | Open in IMG/M |
| 3300012928|Ga0163110_11587383 | Not Available | 532 | Open in IMG/M |
| 3300012952|Ga0163180_11793414 | Not Available | 521 | Open in IMG/M |
| 3300016771|Ga0182082_1060585 | Not Available | 740 | Open in IMG/M |
| 3300017730|Ga0181417_1113188 | Not Available | 657 | Open in IMG/M |
| 3300017951|Ga0181577_10461768 | Not Available | 799 | Open in IMG/M |
| 3300017964|Ga0181589_10936832 | Not Available | 530 | Open in IMG/M |
| 3300017986|Ga0181569_10986390 | Not Available | 544 | Open in IMG/M |
| 3300018039|Ga0181579_10281444 | Not Available | 938 | Open in IMG/M |
| 3300018424|Ga0181591_11026135 | Not Available | 559 | Open in IMG/M |
| 3300019765|Ga0194024_1014980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1637 | Open in IMG/M |
| 3300020014|Ga0182044_1059354 | Not Available | 501 | Open in IMG/M |
| 3300020194|Ga0181597_10402821 | Not Available | 574 | Open in IMG/M |
| 3300020194|Ga0181597_10454638 | Not Available | 523 | Open in IMG/M |
| 3300020317|Ga0211688_1037362 | Not Available | 1005 | Open in IMG/M |
| 3300020353|Ga0211613_1010155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2138 | Open in IMG/M |
| 3300020376|Ga0211682_10193764 | Not Available | 791 | Open in IMG/M |
| 3300020395|Ga0211705_10068554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1278 | Open in IMG/M |
| 3300020396|Ga0211687_10263447 | Not Available | 685 | Open in IMG/M |
| 3300020419|Ga0211512_10428774 | Not Available | 594 | Open in IMG/M |
| 3300020425|Ga0211549_10321487 | Not Available | 628 | Open in IMG/M |
| 3300020426|Ga0211536_10053450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1598 | Open in IMG/M |
| 3300020438|Ga0211576_10224661 | Not Available | 993 | Open in IMG/M |
| 3300020450|Ga0211641_10415410 | Not Available | 648 | Open in IMG/M |
| 3300020451|Ga0211473_10505947 | Not Available | 615 | Open in IMG/M |
| 3300020454|Ga0211548_10171700 | Not Available | 1048 | Open in IMG/M |
| 3300020459|Ga0211514_10681818 | Not Available | 500 | Open in IMG/M |
| 3300020463|Ga0211676_10214635 | Not Available | 1153 | Open in IMG/M |
| 3300020474|Ga0211547_10105203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1479 | Open in IMG/M |
| 3300020475|Ga0211541_10153128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1136 | Open in IMG/M |
| 3300021378|Ga0213861_10247582 | Not Available | 942 | Open in IMG/M |
| 3300021379|Ga0213864_10224539 | Not Available | 954 | Open in IMG/M |
| 3300021961|Ga0222714_10530619 | Not Available | 599 | Open in IMG/M |
| 3300021964|Ga0222719_10543980 | Not Available | 687 | Open in IMG/M |
| 3300023081|Ga0255764_10418325 | Not Available | 575 | Open in IMG/M |
| (restricted) 3300024324|Ga0233443_1086594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1229 | Open in IMG/M |
| 3300025547|Ga0209556_1050468 | Not Available | 1035 | Open in IMG/M |
| 3300025699|Ga0209715_1240380 | Not Available | 538 | Open in IMG/M |
| 3300025707|Ga0209667_1090917 | Not Available | 994 | Open in IMG/M |
| 3300026123|Ga0209955_1045805 | Not Available | 901 | Open in IMG/M |
| 3300026257|Ga0208407_1251599 | Not Available | 501 | Open in IMG/M |
| 3300027838|Ga0209089_10667579 | Not Available | 537 | Open in IMG/M |
| 3300028134|Ga0256411_1100508 | Not Available | 984 | Open in IMG/M |
| 3300028196|Ga0257114_1077460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1399 | Open in IMG/M |
| 3300028196|Ga0257114_1229134 | Not Available | 671 | Open in IMG/M |
| 3300028489|Ga0257112_10081542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1184 | Open in IMG/M |
| 3300031142|Ga0308022_1116999 | Not Available | 786 | Open in IMG/M |
| 3300031637|Ga0302138_10054939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1533 | Open in IMG/M |
| 3300031659|Ga0307986_10088511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1523 | Open in IMG/M |
| 3300031696|Ga0307995_1120274 | Not Available | 1002 | Open in IMG/M |
| 3300031702|Ga0307998_1165956 | Not Available | 767 | Open in IMG/M |
| 3300031775|Ga0315326_10229051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1220 | Open in IMG/M |
| 3300031775|Ga0315326_10419991 | Not Available | 867 | Open in IMG/M |
| 3300032006|Ga0310344_10254680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1497 | Open in IMG/M |
| 3300032011|Ga0315316_11176009 | Not Available | 617 | Open in IMG/M |
| 3300032011|Ga0315316_11502866 | Not Available | 530 | Open in IMG/M |
| 3300032360|Ga0315334_11629882 | Not Available | 551 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 25.71% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 16.19% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 9.52% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 6.67% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 4.76% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 4.76% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 3.81% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 3.81% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.81% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.86% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 1.90% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.90% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 1.90% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.95% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.95% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.95% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.95% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.95% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 0.95% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.95% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.95% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.95% |
| Methane Seep Mesocosm | Environmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm | 0.95% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.95% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.95% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001955 | Marine microbial communities from Gulf of Panama, Panama - GS021 | Environmental | Open in IMG/M |
| 3300002913 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - AAIW_A/KNORR_S2/LV | Environmental | Open in IMG/M |
| 3300003494 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_150m_DNA | Environmental | Open in IMG/M |
| 3300005931 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK9 | Environmental | Open in IMG/M |
| 3300006024 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_DCM_ad_63m_LV_B | Environmental | Open in IMG/M |
| 3300006166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 | Environmental | Open in IMG/M |
| 3300006190 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA | Environmental | Open in IMG/M |
| 3300006308 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0500m | Environmental | Open in IMG/M |
| 3300006332 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0200m | Environmental | Open in IMG/M |
| 3300006351 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0045m | Environmental | Open in IMG/M |
| 3300006357 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006413 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0025m | Environmental | Open in IMG/M |
| 3300006565 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_2_0125m | Environmental | Open in IMG/M |
| 3300007692 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743 | Environmental | Open in IMG/M |
| 3300007778 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG | Environmental | Open in IMG/M |
| 3300007862 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2um | Environmental | Open in IMG/M |
| 3300007962 | Estuarine microbial communities from the Columbia River estuary - metaG 1556B-02 | Environmental | Open in IMG/M |
| 3300007981 | Estuarine microbial communities from the Columbia River estuary - metaG 1556A-3 | Environmental | Open in IMG/M |
| 3300008253 | Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN1B Hudson Canyon | Environmental | Open in IMG/M |
| 3300008961 | Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02 | Environmental | Open in IMG/M |
| 3300009054 | Estuarine microbial communities from the Columbia River estuary - metaG S.737 | Environmental | Open in IMG/M |
| 3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009447 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509 | Environmental | Open in IMG/M |
| 3300009476 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009496 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 | Environmental | Open in IMG/M |
| 3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
| 3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300009706 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300016771 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071412BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017964 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017986 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018039 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071402CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300020014 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011503CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020194 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041403US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020317 | Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555998-ERR599027) | Environmental | Open in IMG/M |
| 3300020353 | Marine microbial communities from Tara Oceans - TARA_B100000686 (ERX556093-ERR598998) | Environmental | Open in IMG/M |
| 3300020376 | Marine microbial communities from Tara Oceans - TARA_B100000795 (ERX555997-ERR599121) | Environmental | Open in IMG/M |
| 3300020395 | Marine microbial communities from Tara Oceans - TARA_B100000427 (ERX555987-ERR599133) | Environmental | Open in IMG/M |
| 3300020396 | Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555915-ERR599122) | Environmental | Open in IMG/M |
| 3300020419 | Marine microbial communities from Tara Oceans - TARA_X000000263 (ERX555964-ERR598955) | Environmental | Open in IMG/M |
| 3300020425 | Marine microbial communities from Tara Oceans - TARA_B100001765 (ERX556083-ERR598964) | Environmental | Open in IMG/M |
| 3300020426 | Marine microbial communities from Tara Oceans - TARA_B100000378 (ERX555992-ERR599112) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020450 | Marine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077) | Environmental | Open in IMG/M |
| 3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
| 3300020454 | Marine microbial communities from Tara Oceans - TARA_B100001769 (ERX556037-ERR599170) | Environmental | Open in IMG/M |
| 3300020459 | Marine microbial communities from Tara Oceans - TARA_X000000368 (ERX555913-ERR599095) | Environmental | Open in IMG/M |
| 3300020463 | Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050) | Environmental | Open in IMG/M |
| 3300020474 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976) | Environmental | Open in IMG/M |
| 3300020475 | Marine microbial communities from Tara Oceans - TARA_B100002029 (ERX555951-ERR599001) | Environmental | Open in IMG/M |
| 3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
| 3300021379 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247 | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300023081 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG | Environmental | Open in IMG/M |
| 3300024324 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_200_MG | Environmental | Open in IMG/M |
| 3300025547 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_150m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025699 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes) | Environmental | Open in IMG/M |
| 3300025707 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_165m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026123 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026257 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 (SPAdes) | Environmental | Open in IMG/M |
| 3300027838 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300028134 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028196 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10m | Environmental | Open in IMG/M |
| 3300028489 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_1000m | Environmental | Open in IMG/M |
| 3300031142 | Marine microbial communities from water near the shore, Antarctic Ocean - #353 | Environmental | Open in IMG/M |
| 3300031637 | Marine microbial communities from Western Arctic Ocean, Canada - CBN3_32.1 | Environmental | Open in IMG/M |
| 3300031659 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82 | Environmental | Open in IMG/M |
| 3300031696 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #262 | Environmental | Open in IMG/M |
| 3300031702 | Marine microbial communities from David Island wharf, Antarctic Ocean - #37 | Environmental | Open in IMG/M |
| 3300031775 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 32315 | Environmental | Open in IMG/M |
| 3300032006 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MG | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300032360 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GOS2237_10556322 | 3300001955 | Marine | *TTGG*IPSGNSLTGSYEKTNIPKIIKTKDITHATTGLLILTSVKYI* |
| JGI26060J43896_100439931 | 3300002913 | Marine | SGNSLTGNCEKTNIPKTINIRDITQATTGLLILTSVIYI* |
| JGI26240J51127_10662931 | 3300003494 | Marine | PSGNSLTGNCEKTNIPKTINIRDITQATTGLLILTSVIYI* |
| Ga0075119_10705202 | 3300005931 | Saline Lake | SLTGNCEKTNIPKTINIRDITQATTGLLILTSVIYI* |
| Ga0066371_101619672 | 3300006024 | Marine | GWRPAGSSRTGNFEKTNIPNTTKINENTQATTGLLILTSVIYIFIIY* |
| Ga0066371_102747032 | 3300006024 | Marine | TGNFEKTNIPNITRINDNTQATTGLLMLISVKYIII* |
| Ga0066836_105554552 | 3300006166 | Marine | SSLTGNFEKINIPNTTKIRDNTQATTGLLMLTSVKYIIYLLV* |
| Ga0075446_101427412 | 3300006190 | Marine | *TTGGCKPSGNSLTGNFEKTNIPKTINIRDITQATTGLLMLTSVIYI* |
| Ga0068470_18877631 | 3300006308 | Marine | EGNSLTGNCQNTNIPNTIKIREHTQATTGLLMLKSVIYIIS* |
| Ga0068500_17939631 | 3300006332 | Marine | SRTGNSEKTNTPKIINIKDITHATTGRLILTSVIYI* |
| Ga0099953_14247702 | 3300006351 | Marine | IKDRSKKTKIPKIINIKDITQATTGRLMLTSVIYI* |
| Ga0075502_11805592 | 3300006357 | Aqueous | GSSRTGNSEKTNIPNIIKIRDMTHATTGRLILTSVIYI* |
| Ga0099963_13372131 | 3300006413 | Marine | TGNSKKTKIPKIINIKDMTQATTGRLILTSVIYI* |
| Ga0100228_14250262 | 3300006565 | Marine | SRTGSSEKTKTPNIIKIKDITQATTGRLILTSVIYI* |
| Ga0102823_10827411 | 3300007692 | Estuarine | TGNSKKTKIPNTINIRDITHATTGLLILTSVIYIIF* |
| Ga0102954_10773652 | 3300007778 | Water | PSGSSRTGNSEKTNIPNIIKIRDMTHATTGRLILTSVIYI* |
| Ga0105737_11704921 | 3300007862 | Estuary Water | NSLTGNFEKTKIPKKTRIRDITHATTGLLILTSVIYIIL* |
| Ga0102907_10797522 | 3300007962 | Estuarine | LTGNCEKTNIPKTINIRDITQATTGLLILTSVINIIF* |
| Ga0102904_10299881 | 3300007981 | Estuarine | NCEKTNIPKTINIRDITQATTGLLILTSVINIIF* |
| Ga0105349_103396051 | 3300008253 | Methane Seep Mesocosm | NFKKTKIPNTIKIRDNTQETTGLLILTSVKYIICL* |
| Ga0102887_11051822 | 3300008961 | Estuarine | SGNSLTGNCEKTNIPKTINIRDITQATTGLLILTSVINIIF* |
| Ga0102826_10762502 | 3300009054 | Estuarine | GNSKKTKIPNTINISDITHATTGLLILTSVIYIIF* |
| Ga0115549_11336812 | 3300009074 | Pelagic Marine | SLTGNCEKTNIPKTINIRDITQATTGLLILTSVINIIF* |
| Ga0114995_101761791 | 3300009172 | Marine | GNCEKTNIPKTINIRDITHATTGLLILTSVINIIF* |
| Ga0114995_106055092 | 3300009172 | Marine | GNSLTGNCEKTNIPNTINIRDITQATTGLLILTSVINIIF* |
| Ga0114993_111487952 | 3300009409 | Marine | LICTTGGCNPLGSSLTGSFEKTNIPKTINIRDITQATTGLLILTSVIYIIF* |
| Ga0114994_110078691 | 3300009420 | Marine | NSLTGSLEKTNIPNTINIRDITQATTGLLILTSVINIIFL* |
| Ga0114997_101691023 | 3300009425 | Marine | KPSGNSLTGSLEKTNIPNTINIRDITQATTGLLILTSVINIIFL* |
| Ga0114997_105271602 | 3300009425 | Marine | SGNSLTGSLEKTNIPNTINIRDITHATTGLLILTSVINIIF* |
| Ga0114997_106879411 | 3300009425 | Marine | TGNCEKTNIPKTINIRDITHATTGLLILTSVINIIF* |
| Ga0115008_108112652 | 3300009436 | Marine | NSLTGNCEKTNIPKTINIRDITQATTGLLILTSVINIIF* |
| Ga0115560_10941601 | 3300009447 | Pelagic Marine | RTGNSEKTNIPNIIKIRDMTHATTGRLMLTSVIYI* |
| Ga0115555_11695242 | 3300009476 | Pelagic Marine | TTGGCKPSGSSLTGNCEKTNIPKTINIRDITQATTGLLILISVINIIF* |
| Ga0115555_12283432 | 3300009476 | Pelagic Marine | GNCEKTNIPKTINIRDITHATTGLLILTSVTNIIF* |
| Ga0114932_102686741 | 3300009481 | Deep Subsurface | GNSLTGSFEKTNIPKTINIRDITHATTGLLILTSVIYIIIYL* |
| Ga0115570_104532562 | 3300009496 | Pelagic Marine | NSEKTNIPKTINIRDITQATTGLLMLTSVIYIIF* |
| Ga0115567_109727681 | 3300009508 | Pelagic Marine | SLTGSSQKTKPPNIIRIRDITHATTGLRILTSVINIFI* |
| Ga0115004_102224531 | 3300009526 | Marine | TGNCEKTNKPKTINIRDITHATTGLLILTSVINIIF* |
| Ga0115000_102749231 | 3300009705 | Marine | TGSLEKTNIPNTINIRDITHATTGLLMLTSVINIIF* |
| Ga0115000_103240212 | 3300009705 | Marine | TTGGCKPSGNSLTGSLEKTNIPNTINIRDITQATTGLLILTSVINIIF* |
| Ga0115002_108135471 | 3300009706 | Marine | TTGGCKPSGNSLTGSLEKTNIPNTINIRDITHATTGLLILTSVINIIF* |
| Ga0115002_110644861 | 3300009706 | Marine | NFEKTNIPKTINIRDITHATTGLLILTSVIYIIF* |
| Ga0115001_100698321 | 3300009785 | Marine | GGCKPSGNSLTGNCEKTNIPKMINIRDITHATTGLLILKSVINIIF* |
| Ga0114999_111906481 | 3300009786 | Marine | GSLEKTNKPKTTSIIEKTAATTGLLILSSVMYIII* |
| Ga0114999_113550471 | 3300009786 | Marine | NCEKTNMPKTINIRDITHATTGLLILTSVINIIF* |
| Ga0133547_103750505 | 3300010883 | Marine | LTGNCEKTNIPKTINIRDITHATTGLLILTSVINIIF* |
| Ga0133547_105464314 | 3300010883 | Marine | SGNSLTGSLEKTNIPNTINIRDITHATTGLLILTSVINIIS* |
| Ga0133547_108037253 | 3300010883 | Marine | SLTGSLEKTNIPNTINIRDITHATTGLLILTSVINIIF* |
| Ga0133547_111042813 | 3300010883 | Marine | TGSLEKTNIPNTINIRDITHATTGLLILTSVINIIF* |
| Ga0163110_115873831 | 3300012928 | Surface Seawater | TGSSANTNIPKIISIKDITQATTGRLILTSVIYI* |
| Ga0163180_117934141 | 3300012952 | Seawater | PSGSSRTGNSRKTKIPKIINIKDITQATTGRLMLTSVIYI* |
| Ga0182082_10605851 | 3300016771 | Salt Marsh | RTGNSEKTNIPNIIKIRDMTHATTGRLILTSVIYI |
| Ga0181417_11131881 | 3300017730 | Seawater | TTGGXIPSGSSLTGNSEKTNIPKIIKINDMTQATTGRLILTSVIYI |
| Ga0181577_104617681 | 3300017951 | Salt Marsh | TXTTGGXIPSGSSRTGNSEKTNIPNIIKIRDMTHATTGRLMLTSVIYI |
| Ga0181589_109368322 | 3300017964 | Salt Marsh | VXTXTTGGXIPSGSSRTGNSEKTNIPNIIKIRDMTHATTGRLILTSVIYI |
| Ga0181569_109863902 | 3300017986 | Salt Marsh | SLTGNSEKTNTPKIINIKDITQATTGRLILTSVIYI |
| Ga0181579_102814442 | 3300018039 | Salt Marsh | PSGSSRTGNSEKTNIPNIIKIRDMTHATTGRLILTSVIYI |
| Ga0181591_110261351 | 3300018424 | Salt Marsh | GSSRTGNSEKTNIPNIIKIRDMTHATTGRLILTSVIYI |
| Ga0194024_10149803 | 3300019765 | Freshwater | SVXTXTTGGXIPSGSSRTGNSEKTNIPNIIKIRDMTHATTGRLILTSVIYI |
| Ga0182044_10593542 | 3300020014 | Salt Marsh | RTGNSEKTNIPNIIKIRDMTHATTGRLMLTSVIYI |
| Ga0181597_104028211 | 3300020194 | Salt Marsh | SGSSRTGNSEKTNIPNIIKIRDMTHATTGRLILTSVIYI |
| Ga0181597_104546382 | 3300020194 | Salt Marsh | XTXTTGGXIPSGSSRTGNSEKTNIPNIIKIRDMTHATTGRLMLTSVIYI |
| Ga0211688_10373621 | 3300020317 | Marine | NSLTGSCEKTNIPKTINIRDITHATTGLLILTSVINIIF |
| Ga0211613_10101554 | 3300020353 | Marine | SLTGNFQKTKIPNTIKINEKTHATVGLLILTSVIYIFIFL |
| Ga0211682_101937641 | 3300020376 | Marine | NSLTGNCEKTNIPKTINIRDITHATTGLLILTSVINIIF |
| Ga0211705_100685541 | 3300020395 | Marine | GGCIPSGSSRTGNSKKTKIPKIINIKDMTQATTGRLMLTSVIYI |
| Ga0211687_102634472 | 3300020396 | Marine | SLTGNCEKTNIPKTINIRDITQATTGLLMLKSVINIIF |
| Ga0211512_104287742 | 3300020419 | Marine | TTGGXIPSGSSLTGNSEKTNIPKIIKIKDMTQATTGLLILTSVIYI |
| Ga0211549_103214871 | 3300020425 | Marine | EGSSLTGNFQKTNIPKTISIRDITQDTTGLLMLTSVIYI |
| Ga0211536_100534501 | 3300020426 | Marine | PSGSSRTGNSKKTKIPKIINIKDITQATTGRLMLTSVIYI |
| Ga0211576_102246612 | 3300020438 | Marine | SGSSLTGSSEKTNIPKIIKIKDMTQATTGRLILTSVIYI |
| Ga0211641_104154101 | 3300020450 | Marine | GSSRTGSSEKTNIPKIIKINDMTQATTGRLILTSVIYI |
| Ga0211473_105059471 | 3300020451 | Marine | SLTGNFENTNIPNTTKISDNTHATTGLLILKSVIYIWLI |
| Ga0211548_101717001 | 3300020454 | Marine | PFGSSLTGNSEKTKIPNTIKTRDITHATTGLLILKSVIYIKLTLKLV |
| Ga0211514_106818181 | 3300020459 | Marine | IPSGSSLTGNSEKTNIPKIIKINDMTQATTGRLILTSVIYI |
| Ga0211676_102146352 | 3300020463 | Marine | XIPSGSSRTGSSEKTNIPKIIKIKDMTQATTGRLILTSVTNI |
| Ga0211547_101052031 | 3300020474 | Marine | CTIGGCIPEGSSRTGSLENTNNPNTIKIKDKTQATTGLLILTSVKYIFIFLLD |
| Ga0211541_101531283 | 3300020475 | Marine | LTGNSAKTKIPKIININDITQATTGLFMLTSVIYI |
| Ga0213861_102475821 | 3300021378 | Seawater | SRTGNSEKTNIPNIIKIRDMTHATTGRLMLTSVIYI |
| Ga0213864_102245392 | 3300021379 | Seawater | TGGXIPSGSSRTGNSEKTNIPNIIKIRDMTHATTGRLILTSVIYI |
| Ga0222714_105306191 | 3300021961 | Estuarine Water | GSSRTGNSEKTNIPNIIKIRDMTHATTGRLMLTSVIYI |
| Ga0222719_105439801 | 3300021964 | Estuarine Water | TGSSQNTKPPNIIRIRDITHATTGLRILTSVINIFI |
| Ga0255764_104183252 | 3300023081 | Salt Marsh | GSSLTGNSKKTKIPKIINIKDMTQATTGRLILTSVIYI |
| (restricted) Ga0233443_10865943 | 3300024324 | Seawater | LTGNCEKTNIPKTINIRDITHATTGLLILISVINIIF |
| Ga0209556_10504682 | 3300025547 | Marine | SGSSLTGNCEKTNIPKTINIRDITQATTGLLILISVINIIF |
| Ga0209715_12403802 | 3300025699 | Pelagic Marine | LTGNSEKTNIPNTIKISDITQATTGLLILISVIYIIS |
| Ga0209667_10909172 | 3300025707 | Marine | SLTGSCEKTNIPKTINIRDITHATTGLLILISVINIIF |
| Ga0209955_10458051 | 3300026123 | Water | GSSQKTKPPNIINIKDITHATTGLRILTSVINIFIL |
| Ga0208407_12515991 | 3300026257 | Marine | NTNNPKTIKIRDNTHATTGLLMLTSVIYIVILFIF |
| Ga0209089_106675791 | 3300027838 | Marine | TGGCKPEGSSLTGSLEKTNKPKMTSIIEKTIATTGLLILTSVIYIF |
| Ga0256411_11005081 | 3300028134 | Seawater | TGNFEKTKIPKTTRIRDITHATTGLLILTSVIYIIL |
| Ga0257114_10774603 | 3300028196 | Marine | LTGSSEYTNKPNTISIKDRTQATTGRFILTSVMYI |
| Ga0257114_12291342 | 3300028196 | Marine | TGNCEKTNIPKTINIRDITQATTGLLILTSVINIIF |
| Ga0257112_100815423 | 3300028489 | Marine | TGSFQKTNIPKTIKIKEKTDETTGLFILKSVIYIN |
| Ga0308022_11169991 | 3300031142 | Marine | TGNCEKTNIPKTINIRDITHATTGLLILTSVINIIFL |
| Ga0302138_100549391 | 3300031637 | Marine | GSCEKTNIPKTINIRDITHATTGLLILISVINIIF |
| Ga0307986_100885111 | 3300031659 | Marine | SLTGNCEKTNIPKTINIRDITHATTGLLILISVINIIF |
| Ga0307995_11202741 | 3300031696 | Marine | NSLTGNCEKTNIPKTINIRDITQATTGLLILTSVIYI |
| Ga0307998_11659561 | 3300031702 | Marine | TGNWEKTNIPKTINIRDITHATTGLLILTSVINIIF |
| Ga0315326_102290513 | 3300031775 | Seawater | SLTGNFEKTNKPKTTSIIEKTTATTGLLILSSVMYIIV |
| Ga0315326_104199911 | 3300031775 | Seawater | SLTGNFEKTNIPKTINIRDITQATTGLLILTSVKYIIF |
| Ga0310344_102546803 | 3300032006 | Seawater | LTGNFQKTKIPNTIKIRDKTHATTGLLMLTSVKYI |
| Ga0315316_111760091 | 3300032011 | Seawater | GSFEKTNIPKTINIRDITQATTGLLILTSVIYIIF |
| Ga0315316_115028662 | 3300032011 | Seawater | GCNPLGSSLTGSFEKTNIPKTINIRDITQATTGLLMLTSVIYIIF |
| Ga0315334_116298821 | 3300032360 | Seawater | GGXIPSGSSLTGSSEKTNIPKIIKIKDMTQATTGRLILTSVIYI |
| ⦗Top⦘ |