Basic Information | |
---|---|
Family ID | F096022 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 105 |
Average Sequence Length | 48 residues |
Representative Sequence | VENEEDKGQIEQRVKALTGRAKVEVLAVRKVLDADGRTRSFEVDIR |
Number of Associated Samples | 91 |
Number of Associated Scaffolds | 105 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 6.67 % |
% of genes from short scaffolds (< 2000 bps) | 6.67 % |
Associated GOLD sequencing projects | 85 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.55 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (98.095 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (13.333 % of family members) |
Environment Ontology (ENVO) | Unclassified (40.952 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (66.667 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.22% β-sheet: 21.62% Coil/Unstructured: 62.16% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 105 Family Scaffolds |
---|---|---|
PF03548 | LolA | 20.00 |
PF04055 | Radical_SAM | 5.71 |
PF00005 | ABC_tran | 1.90 |
PF13023 | HD_3 | 1.90 |
COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
---|---|---|---|
COG2834 | Outer membrane lipoprotein-sorting protein | Cell wall/membrane/envelope biogenesis [M] | 20.00 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 98.10 % |
All Organisms | root | All Organisms | 1.90 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300003993|Ga0055468_10235655 | Not Available | 572 | Open in IMG/M |
3300005294|Ga0065705_10865287 | Not Available | 587 | Open in IMG/M |
3300005354|Ga0070675_101557164 | Not Available | 610 | Open in IMG/M |
3300006173|Ga0070716_100307824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 1105 | Open in IMG/M |
3300012989|Ga0164305_11211677 | Not Available | 655 | Open in IMG/M |
3300020078|Ga0206352_10073658 | Not Available | 643 | Open in IMG/M |
3300031548|Ga0307408_100245694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1473 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 13.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.62% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.71% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.71% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 5.71% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.76% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.81% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.81% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.86% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.86% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.86% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.86% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.90% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.90% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.90% |
Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 1.90% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.90% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.90% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.90% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.90% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.95% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.95% |
Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.95% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.95% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.95% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.95% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.95% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.95% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.95% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.95% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.95% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.95% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.95% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.95% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.95% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.95% |
Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.95% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300002886 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm | Environmental | Open in IMG/M |
3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010122 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012402 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300025796 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300034663 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
MRS1b_0776.00001270 | 2162886011 | Miscanthus Rhizosphere | ETDKGQIEQRVKELTGRKQVEVVAVRRVVGEDGKTRSFEVDIR |
ICChiseqgaiiFebDRAFT_124039251 | 3300000363 | Soil | VENEADKGQIEQRVKALTGRAKVEVLEVRKVLDADGRTRSFEVDIR* |
INPhiseqgaiiFebDRAFT_1017640014 | 3300000364 | Soil | IGNEEDKGQIEERVKALTGRSNVEVLAVRKITHPDGRARGFEVDIR* |
JGI25612J43240_10032731 | 3300002886 | Grasslands Soil | GQIGEQIKALTGRAEVEVVAVRKVVGSDGRTISFEVDIR* |
Ga0055468_102356552 | 3300003993 | Natural And Restored Wetlands | ATTLVLSPEVVVNEGDKAQIEQQVRALTGRTTFEVVAVRRVLDTEGRTRSFEVDIR* |
Ga0062595_1005712051 | 3300004479 | Soil | PEIVGNEADRGQIEQRVKALTGRVNVEVVAVRRVVDSEGRTRSFEVDIR* |
Ga0062595_1007562381 | 3300004479 | Soil | PEVVGNEEDKGRIEQQIKALTGRTDVEVLAVRKVLDPSGKIRSFEVDIR* |
Ga0062592_1021404931 | 3300004480 | Soil | SPEVIGSEEDKSQIEQHVKALTGRTDVEVVAVRKVLDPEGRTRSFEVDIR* |
Ga0062591_1016259712 | 3300004643 | Soil | VGNEQDKGQIAQRIKELTGRSEVEVLAVRKITDSNGQTRSFEVDIR* |
Ga0058860_116875841 | 3300004801 | Host-Associated | VVVNESDTGQIEQRIRALTGRSKAEVVAVRKVVGPDGRAVSFEVDIK* |
Ga0058860_121010802 | 3300004801 | Host-Associated | NEEDKGRIEQQVRALTGRTDAEVLAVRKITGPDGRTLSFEVDIR* |
Ga0065704_107102602 | 3300005289 | Switchgrass Rhizosphere | TLLLPPEVIGNEEDKGQIEQRVKALTGRTNVEVLAVRKITHPDGRARGFEVDIR* |
Ga0065704_107688741 | 3300005289 | Switchgrass Rhizosphere | TLVLSPEGIVNEADRGQIEQRVRSLTGRASAEVVAVRKVVGPDGRTVGFEVDIK* |
Ga0065705_108652871 | 3300005294 | Switchgrass Rhizosphere | RTLVFSPEVIGNEADKLQIEQRVKALTGRTEIEVVEVRKILDPDGKTRSFEVDIR* |
Ga0070676_102434312 | 3300005328 | Miscanthus Rhizosphere | MEHQRPIATKVFLKPEVVVNEADRGQIEQQVRVLTGRSSVEILAVRKVLDTNGRTVSFEVDIR* |
Ga0070677_108109171 | 3300005333 | Miscanthus Rhizosphere | MEHQRPIATKVFLKPEVVVNEADRGQIEQQVRALTGRSSVEILAVRKVLDTNGRTVSFEVDIR* |
Ga0070692_112548871 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | VIDSELIGNEEDRSKIEQRVKAMTGRTNFEVLEVRRIPDAGGRTRSFEVDIR* |
Ga0070675_1015571642 | 3300005354 | Miscanthus Rhizosphere | VVGNEEDRSRIEQRVKELLRRTDVEVLDIRKVSGPDGKTRSFEVDIR* |
Ga0070673_1021227202 | 3300005364 | Switchgrass Rhizosphere | VLNEADRSQLEERVRALTGRTNVEVVNVRKVVAADGKTRSFEVDIR* |
Ga0070688_1004255182 | 3300005365 | Switchgrass Rhizosphere | MPEVVTNEADRGQIEQQVRMLTGRSKVEVIGVRKVVDATGRTVSFEVDIR* |
Ga0070667_1002161833 | 3300005367 | Switchgrass Rhizosphere | TVVLSPEVVLNEADRSQLEERVRALTGRTKVEVVNVRKVVAADGKTRSFEVDIR* |
Ga0070701_110675761 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | EVIKNEEDKAEIAERVKAMTGRSTVEVVAVRKVLDGNGRTISFEVDIR* |
Ga0070701_111715311 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MEHQRPIATKVFLKPEVVVNEADRGQIEQQVRALTGRSSVEILAVRKVLDTNG |
Ga0070705_1006489301 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | LKPEVVVNEADRGQIEQQVRVLTGRSSVEILAVRKVLDTNGRTVSFEVDIR* |
Ga0070705_1016100721 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | PEVVGNEGDKGRIEERVRALTGRTNVEVVAVRKILDPEGRTRSFEVDIR* |
Ga0070705_1018726361 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | EQDKGQIAERVKALTGRSTVEVLAVRRVLDTEGRTRSFEVDIR* |
Ga0070694_1008310821 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | ETDKGQIEQRVKELTGRKQVQVLAVRRVVGEDGKTRSFEVDIR* |
Ga0070681_115082881 | 3300005458 | Corn Rhizosphere | MVDNEEDKGQIEQRVKALTGRAKVEILAVRPVVDSEGRTRSFEVDIR* |
Ga0070707_1015087241 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | PEVVANEADRGQIERQVKALTGRAKVEVLAVRKVVDSEGRTRSFEVDIR* |
Ga0070672_1014381552 | 3300005543 | Miscanthus Rhizosphere | ADRGQIEQRVKALTGRSDVEVLAVRPILDPSGQTQAFEVDIR* |
Ga0070672_1015197461 | 3300005543 | Miscanthus Rhizosphere | TKVFLKPEVVVNEADRGQIEQQVRVLTGRSSVEILAVRKVLDTNGRTVSFEVDIR* |
Ga0070695_1006112131 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | QTLVMRREDLGNEQDKGQIGQRIEALTGRKNVEVVAVRPVRDSKGQTLSFEVDIR* |
Ga0070696_1016960312 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VVANEQDKGQIAQRIKELTGRKEVEVLTVRKVMGDDGQIRSFEVDIR* |
Ga0070696_1019706352 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | NEADRSQLEERVRALTGRTKVEVVNVRKVVAADGKTRSFEVDIR* |
Ga0070704_1003561221 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | TVVLSPEVVGNEGDKGQIEQRIKALTGRAEVEILEVRAIRDAEGRTRSFEVDIR* |
Ga0058697_104440491 | 3300005562 | Agave | QIEQRVKALTGRTDFEVLAVRRILDPEGRTRSFEVDIR* |
Ga0070664_1006569531 | 3300005564 | Corn Rhizosphere | IEQRVRELLRRTDVEVLDVRKIPGPDGKTQSFEVDIR* |
Ga0070664_1016572081 | 3300005564 | Corn Rhizosphere | QIEQRVKALTGRVNVEVVAVRRVVDSEGRTRSFEVDIR* |
Ga0068857_1006972351 | 3300005577 | Corn Rhizosphere | LVLSPEVVGNEEDKSQIEQRVKALTGRTNIEVLEVRRIPDAEGRTRGFEVDIR* |
Ga0068857_1016152651 | 3300005577 | Corn Rhizosphere | QDIVNEADRSQIEQLMRSRTGRADAQVVDVRKVVGADGRTIGFEVDIK* |
Ga0070702_1001390791 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | NEEDKGRIAEQVKAMTGRSTVEVLAVRRVLDREGRTRSFEVDIR* |
Ga0068859_1010116402 | 3300005617 | Switchgrass Rhizosphere | KGQIEQRIKALTGRAEVEILEVRAIRDAEGRTRSFEVDIR* |
Ga0068864_1000219023 | 3300005618 | Switchgrass Rhizosphere | MPEVVTNEADRGQIEQQVRMLTGRSKVEVLNVRKVVDAKGRTVSFEVDIR* |
Ga0068862_1022413922 | 3300005844 | Switchgrass Rhizosphere | VKNEEDKGQIAERVKAMTGRSTVEVVAVRKVLDSEGRTISFEVDIR* |
Ga0082029_12971541 | 3300006169 | Termite Nest | EQVKAMTGRPAVEVLAVRRVLDANGRTLSFEVDIR* |
Ga0070716_1003078241 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LHQTVILSPEVVSSEADKGQIEQRVRAVTGRSKVEVLAVRKVVDAQGRTRSLEVDIR* |
Ga0097621_1020510521 | 3300006237 | Miscanthus Rhizosphere | VLSPEVVLNEADRSQLEERVRALTGRTNVEVVNVRKVVAADGKTRSFEVDIR* |
Ga0075430_1003084151 | 3300006846 | Populus Rhizosphere | RVFLSREVIGNQRDKSQIEQRVKELTGRKEVQVLKVRELLDNDGSIRGFEVDIR* |
Ga0075434_1004686281 | 3300006871 | Populus Rhizosphere | VNEQDRSQIEQRVKALTGRSKVEVLAVRKKVGDDGRTQSFEVDIR* |
Ga0079215_101458801 | 3300006894 | Agricultural Soil | SPEVVVNEADKGHIEQRIKALTGRTKVEVIAVRRVVDSDGRTRSFEVDIR* |
Ga0105250_102551741 | 3300009092 | Switchgrass Rhizosphere | NEGDRSRIKEHVKALTGRTDVEVLAVRKIPGPDGKTRSFEVDIR* |
Ga0111539_122180302 | 3300009094 | Populus Rhizosphere | SPEVVGNEADKGQIEQRVKALTGRAKVEVLAVRKVVDSDGRTRSFEVDIR* |
Ga0105245_119122462 | 3300009098 | Miscanthus Rhizosphere | LVFEPEVILNEADRPQIEQRVKSLTGRTDVEVVAVRKVIDAEGRTRSFEVDIR* |
Ga0105241_102257981 | 3300009174 | Corn Rhizosphere | ERVRALTGRTNVEVVAVRKILDPEGRTRSFEVDIR* |
Ga0126312_108603612 | 3300010041 | Serpentine Soil | NEEDKARIEQHVKALTGLAEVEVLAVRKIAAPDGKTLSFEVDIR* |
Ga0126312_112616571 | 3300010041 | Serpentine Soil | EDVGNEGDKGQIGQRIEALTGRRNVEVLAVRPVLDSEGRTRSFEVDIR* |
Ga0127488_11322912 | 3300010122 | Grasslands Soil | EVIVDERDKAQIEERVKALTGRTEVEVVAVRKMLRPDGRTRSFEVDIR* |
Ga0126306_110392001 | 3300010166 | Serpentine Soil | PEVIDNEEDKAQIEQRVKTMTGRSEVEVLAVRRIRDQQGRTRSFEVDIR* |
Ga0134067_102764211 | 3300010321 | Grasslands Soil | NEIESRLRAITGRSDVEVLSVRPMLDQSGKTVAFEVDIR* |
Ga0134125_129053461 | 3300010371 | Terrestrial Soil | QSRIVTTLVINPEAIDNEGDKGRIAERVKALTGRENVEVLAVRKLQHPDGSTRSFEVDIR |
Ga0134128_117643841 | 3300010373 | Terrestrial Soil | EADRGQIEQQVRVLTGRSSVEILAVRKVLDTNGRTVSFEVDIR* |
Ga0134122_130541941 | 3300010400 | Terrestrial Soil | VSNEEDKAQITERVKAMTGRSTVEVLAVRRVRDAQGRTLSFEVDIR* |
Ga0134123_124439022 | 3300010403 | Terrestrial Soil | VGNEEDRSRIEQRVKELLRRTDVEVLDVRKVSGPDGKTRSFEVDIR* |
Ga0150985_1197994931 | 3300012212 | Avena Fatua Rhizosphere | LVLSPEVVGSEEDKVRIEQRIKALTGRTDVEVLAVRKVLDPEGRTRSFEVDIR* |
Ga0134059_10792982 | 3300012402 | Grasslands Soil | EVVINEADRGQIEERIRMLTGRTQVEVVAVRKVVGPDGRTVSFEVDIR* |
Ga0164299_116484922 | 3300012958 | Soil | IEQRVKELTGRTEVKVLEVRKILDADGKTRSFEVDIR* |
Ga0164305_112116771 | 3300012989 | Soil | HQTVILSPEVVSSEADKGQIEQRVRAVTGRSKVEVLAVRKVVDAQGRTRSLEVDIR* |
Ga0157371_107068932 | 3300013102 | Corn Rhizosphere | EVVGNEEDKGQIEERVKALTGRTNVEVLAVRKITHPDGRARGFEVDIR* |
Ga0157375_111837942 | 3300013308 | Miscanthus Rhizosphere | NEADRGQIEQRVRTLTGQSNAEVVAVRRVVDPEGRTISFEVDIK* |
Ga0157380_117916681 | 3300014326 | Switchgrass Rhizosphere | NEEDKVQIAERVKAMTGRSTVEVLAVRRVLDTGGRTVSFEVDIR* |
Ga0157377_110148322 | 3300014745 | Miscanthus Rhizosphere | APEVVVNESDTGQIEQRIRALTGRSKAEVVAVRKVVGPDGRAVSFEVDIK* |
Ga0132255_1049521252 | 3300015374 | Arabidopsis Rhizosphere | DNEEDKGQIEQRVKALTGRAKVEILAVRPVVDSEGRTRSFEVDIR* |
Ga0132255_1063467171 | 3300015374 | Arabidopsis Rhizosphere | VLLSPEVVSSAADRGQIERQIKTMTGRTKVEILDVRPVVDSDGRPTSFEVDIR* |
Ga0190268_117847471 | 3300018466 | Soil | LVVNEHDTVQIGQRVKELTGRKEVEVLTVRKVVGDDGQIRSFEVDIR |
Ga0190274_110316161 | 3300018476 | Soil | EVVTNEADRGQIEQHVRTLTGRSKVEVVDVRKVVGPDGKTISFEVDIR |
Ga0190264_112708731 | 3300019377 | Soil | TPEVVGNEGDKGQIEERVKALTGRSKVEVVAVRKILHPDGRTRSFEVDIR |
Ga0206352_100736582 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | VFSREVVGTQGDKGQIEQRVKALTGRSDVEVLAVRPVLDASGQTQAFEVDIR |
Ga0182009_106118831 | 3300021445 | Soil | SAEVISNEADRGKIEQQVKWLTGRSQVEVLDVRKVVDSDGRTRSFEVDIR |
Ga0210113_10410322 | 3300025796 | Natural And Restored Wetlands | LVLSPEVVVNEGDKAQIEQQVRALTGRTTFEVVAVRRVLDTEGRTRSFEVDIR |
Ga0207647_101848471 | 3300025904 | Corn Rhizosphere | VENEEDKGQIEQRVKALTGRAKVEVLAVRKVLDADGRTRSFEVDIR |
Ga0207707_112836762 | 3300025912 | Corn Rhizosphere | MVDNEEDKGQIEQRVKALTGRAKVEILAVRPVVDSEGRTRSFEVDI |
Ga0207649_109291392 | 3300025920 | Corn Rhizosphere | DRNRIEQRVKELLRRTDVEVLEVRKVSGPDGKTRSFEVDIR |
Ga0207649_111971111 | 3300025920 | Corn Rhizosphere | NEEDKGRIEQQVKALTGRTDAEVLAVRKITGPDGTTLSFEVDIR |
Ga0207652_105602211 | 3300025921 | Corn Rhizosphere | RIEQQIKALTGRTDVEVLAVRKVLDPSGKIRSFEVDIR |
Ga0207650_105857931 | 3300025925 | Switchgrass Rhizosphere | GRIEERVRALTGRTNVEVVAVRKILDPEGRTRSFEVDIR |
Ga0207691_113043442 | 3300025940 | Miscanthus Rhizosphere | KPIATKVFLKPEVVVNEADRGQIEQQVRVLTGRSSVEILAVRKVLDTNGRTVSFEVDIR |
Ga0207679_105011362 | 3300025945 | Corn Rhizosphere | TLVLAPEVVVNESDTGQIEQRIRALTGRSKAEVVAVRKVVGPDGRAVSFEVDIK |
Ga0207667_117383492 | 3300025949 | Corn Rhizosphere | SPEAIGNEEDKANMEERVRALTGRTEVEVIAVRKILYPDGRIRGFEVDIR |
Ga0207651_103463001 | 3300025960 | Switchgrass Rhizosphere | VVTTVVISPELVVNEEDKSKIEQVVKGLTGRTEVEVLKVRRIPYADGRTRSFEVDIR |
Ga0207651_117507971 | 3300025960 | Switchgrass Rhizosphere | LVLSPEDVGNEGDKGRIGQRIEALTGRRNVEVLAVRPVLDSEGRTRSFEVDIR |
Ga0207668_116436312 | 3300025972 | Switchgrass Rhizosphere | SQIEQRVKELTGRTQVEVVNVRKVVGDDGKIRSFEVDIR |
Ga0207703_103092533 | 3300026035 | Switchgrass Rhizosphere | EQRVKALTGRSDVEVLAVRPVLDASGQTQAFEVDIR |
Ga0207676_100275922 | 3300026095 | Switchgrass Rhizosphere | MPEVVTNEADRGQIEQQVRMLTGRSKVEVLNVRKVVDAKGRTVSFEVDIR |
Ga0207675_1007482363 | 3300026118 | Switchgrass Rhizosphere | SQIEQRVKALTGRSDVEVLAVRPVLDASGQTQAFEVDIR |
Ga0209486_110556842 | 3300027886 | Agricultural Soil | EQQVKALTGRSDVEVIAVRKVVDPDGRTRSFEVDIR |
Ga0307498_102487732 | 3300031170 | Soil | KAHQTVVLSPEVIVNEADKGQIEARVRTVTGRSDVEVVAVRKVVGPDGRTVSFEVDIK |
Ga0307408_1002456941 | 3300031548 | Rhizosphere | PVAKTLVLTPEDIGNEGDKGRIRQRIEALTGRKDFEVVEVRPVHDPSGRTRSFEVDIR |
Ga0307405_111250242 | 3300031731 | Rhizosphere | EVVGNEGDKGRIEERVRALTGRTNVEVVAVRKILDPEGRTRSFEVDIR |
Ga0307468_1009865051 | 3300031740 | Hardwood Forest Soil | VLSPEVIVNEEDKGQIAERVKALTGRPTVEVLAVRRVLDPEGRTRSFEVDIR |
Ga0310904_108881772 | 3300031854 | Soil | VNEEDKSKIEQVVKGLTGRTEVEVLKVRRIPYADGRTRSFEVDIR |
Ga0310900_107162382 | 3300031908 | Soil | LTPEVVGNEEDKGRIEQQVKTLTGRTDVEVVAVRKVLDSAGKTRSFEVDIR |
Ga0315912_103319463 | 3300032157 | Soil | EVIGNEADKGQIEQHVKALTGRAKVEVIAVRKVVDPDGRTRSFEVDIR |
Ga0310810_104492421 | 3300033412 | Soil | TPELIGNEEDKTQIEQRVKEVTGRTEVKVLEVRKILDADGKTRSFEVDIR |
Ga0314784_082286_509_643 | 3300034663 | Soil | NERDKSQIEQRVKELTGRTQVEVVNVRKVVGDDGKIRSFEVDIR |
Ga0373950_0153032_383_529 | 3300034818 | Rhizosphere Soil | EVITNEEDKSRIVEQVKAMTGRSTVEVLAVRRVLDREGRTRSFEVDIR |
⦗Top⦘ |