| Basic Information | |
|---|---|
| Family ID | F096019 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MDQHAQPGQPAPAESFPTDPTGLPEATRPALLELADGD |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 96.19 % |
| % of genes from short scaffolds (< 2000 bps) | 87.62 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.16 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (57.143 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (14.286 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.714 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.810 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.55% β-sheet: 0.00% Coil/Unstructured: 95.45% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.16 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF10604 | Polyketide_cyc2 | 6.67 |
| PF00196 | GerE | 6.67 |
| PF13191 | AAA_16 | 4.76 |
| PF13602 | ADH_zinc_N_2 | 1.90 |
| PF03992 | ABM | 1.90 |
| PF04185 | Phosphoesterase | 0.95 |
| PF13188 | PAS_8 | 0.95 |
| PF12697 | Abhydrolase_6 | 0.95 |
| PF00881 | Nitroreductase | 0.95 |
| PF08241 | Methyltransf_11 | 0.95 |
| PF13487 | HD_5 | 0.95 |
| PF00753 | Lactamase_B | 0.95 |
| PF11716 | MDMPI_N | 0.95 |
| PF14329 | DUF4386 | 0.95 |
| PF01965 | DJ-1_PfpI | 0.95 |
| PF03861 | ANTAR | 0.95 |
| PF01638 | HxlR | 0.95 |
| PF06305 | LapA_dom | 0.95 |
| PF16542 | PNKP_ligase | 0.95 |
| PF00144 | Beta-lactamase | 0.95 |
| PF01850 | PIN | 0.95 |
| PF00211 | Guanylate_cyc | 0.95 |
| PF01740 | STAS | 0.95 |
| PF02583 | Trns_repr_metal | 0.95 |
| PF01966 | HD | 0.95 |
| PF01243 | Putative_PNPOx | 0.95 |
| PF00440 | TetR_N | 0.95 |
| PF00583 | Acetyltransf_1 | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.95 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.95 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.95 |
| COG1937 | DNA-binding transcriptional regulator, FrmR family | Transcription [K] | 0.95 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.95 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.95 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.95 |
| COG3707 | Two-component response regulator, AmiR/NasT family, consists of REC and RNA-binding antiterminator (ANTAR) domains | Transcription [K] | 0.95 |
| COG3771 | Lipopolysaccharide assembly protein YciS/LapA, DUF1049 family | Cell wall/membrane/envelope biogenesis [M] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 57.14 % |
| Unclassified | root | N/A | 42.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000559|F14TC_100286849 | Not Available | 500 | Open in IMG/M |
| 3300001431|F14TB_101002694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 774 | Open in IMG/M |
| 3300005167|Ga0066672_10863899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium URHB0062 | 563 | Open in IMG/M |
| 3300005363|Ga0008090_15048998 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300005435|Ga0070714_101824000 | Not Available | 594 | Open in IMG/M |
| 3300005587|Ga0066654_10651620 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300005764|Ga0066903_100573545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1944 | Open in IMG/M |
| 3300005764|Ga0066903_106927113 | Not Available | 588 | Open in IMG/M |
| 3300005764|Ga0066903_108853764 | Not Available | 511 | Open in IMG/M |
| 3300005981|Ga0081538_10021428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 4718 | Open in IMG/M |
| 3300006169|Ga0082029_1409122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 584 | Open in IMG/M |
| 3300006175|Ga0070712_100691978 | Not Available | 869 | Open in IMG/M |
| 3300006854|Ga0075425_102364973 | Not Available | 590 | Open in IMG/M |
| 3300009143|Ga0099792_10907619 | Not Available | 583 | Open in IMG/M |
| 3300009147|Ga0114129_10744184 | Not Available | 1256 | Open in IMG/M |
| 3300009545|Ga0105237_11198934 | Not Available | 766 | Open in IMG/M |
| 3300009789|Ga0126307_10047321 | All Organisms → cellular organisms → Bacteria | 3354 | Open in IMG/M |
| 3300009789|Ga0126307_11081684 | Not Available | 648 | Open in IMG/M |
| 3300009837|Ga0105058_1089839 | Not Available | 714 | Open in IMG/M |
| 3300010041|Ga0126312_10182870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1462 | Open in IMG/M |
| 3300010041|Ga0126312_10316611 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300010042|Ga0126314_10554152 | Not Available | 837 | Open in IMG/M |
| 3300010043|Ga0126380_10846724 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300010048|Ga0126373_10419776 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
| 3300010140|Ga0127456_1178069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 721 | Open in IMG/M |
| 3300010329|Ga0134111_10462064 | Not Available | 552 | Open in IMG/M |
| 3300010358|Ga0126370_10863425 | Not Available | 813 | Open in IMG/M |
| 3300010361|Ga0126378_10705104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1121 | Open in IMG/M |
| 3300010366|Ga0126379_13184132 | Not Available | 549 | Open in IMG/M |
| 3300010376|Ga0126381_100314513 | All Organisms → cellular organisms → Bacteria | 2150 | Open in IMG/M |
| 3300010398|Ga0126383_11759572 | Not Available | 708 | Open in IMG/M |
| 3300011000|Ga0138513_100057953 | Not Available | 591 | Open in IMG/M |
| 3300012207|Ga0137381_10248917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1545 | Open in IMG/M |
| 3300012355|Ga0137369_10345909 | Not Available | 1088 | Open in IMG/M |
| 3300012356|Ga0137371_10471385 | Not Available | 970 | Open in IMG/M |
| 3300012356|Ga0137371_11035896 | Not Available | 620 | Open in IMG/M |
| 3300012360|Ga0137375_10845448 | Not Available | 732 | Open in IMG/M |
| 3300012939|Ga0162650_100012234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1134 | Open in IMG/M |
| 3300012955|Ga0164298_11139005 | Not Available | 587 | Open in IMG/M |
| 3300016422|Ga0182039_12206747 | Not Available | 508 | Open in IMG/M |
| 3300017966|Ga0187776_11250448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → Jiangella muralis | 559 | Open in IMG/M |
| 3300017973|Ga0187780_10238310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1272 | Open in IMG/M |
| 3300018465|Ga0190269_12046816 | Not Available | 501 | Open in IMG/M |
| 3300018466|Ga0190268_10304396 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300018476|Ga0190274_13688127 | Not Available | 518 | Open in IMG/M |
| 3300021078|Ga0210381_10118697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 874 | Open in IMG/M |
| 3300021171|Ga0210405_10926544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 661 | Open in IMG/M |
| 3300021374|Ga0213881_10273681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 751 | Open in IMG/M |
| 3300021560|Ga0126371_10491902 | Not Available | 1374 | Open in IMG/M |
| 3300021560|Ga0126371_11519298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 797 | Open in IMG/M |
| 3300021560|Ga0126371_11761926 | Not Available | 742 | Open in IMG/M |
| 3300021560|Ga0126371_13428535 | Not Available | 535 | Open in IMG/M |
| 3300022467|Ga0224712_10507429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → Jiangella muralis | 583 | Open in IMG/M |
| 3300025904|Ga0207647_10478282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 696 | Open in IMG/M |
| 3300025906|Ga0207699_10000913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 14125 | Open in IMG/M |
| 3300025906|Ga0207699_11463093 | Not Available | 505 | Open in IMG/M |
| 3300025912|Ga0207707_10085910 | All Organisms → cellular organisms → Bacteria | 2749 | Open in IMG/M |
| 3300025916|Ga0207663_10041292 | Not Available | 2811 | Open in IMG/M |
| 3300026078|Ga0207702_10394054 | All Organisms → cellular organisms → Bacteria | 1334 | Open in IMG/M |
| 3300026790|Ga0208710_107742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria | 513 | Open in IMG/M |
| 3300027577|Ga0209874_1012734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2456 | Open in IMG/M |
| 3300027577|Ga0209874_1021018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1852 | Open in IMG/M |
| 3300027873|Ga0209814_10352493 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300027874|Ga0209465_10181916 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300027961|Ga0209853_1068356 | Not Available | 948 | Open in IMG/M |
| 3300028705|Ga0307276_10083295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 755 | Open in IMG/M |
| 3300028771|Ga0307320_10264392 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300028791|Ga0307290_10307914 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300028796|Ga0307287_10043842 | All Organisms → cellular organisms → Bacteria | 1629 | Open in IMG/M |
| 3300028819|Ga0307296_10387012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 764 | Open in IMG/M |
| 3300028876|Ga0307286_10023140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2012 | Open in IMG/M |
| 3300028881|Ga0307277_10020338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2599 | Open in IMG/M |
| 3300028881|Ga0307277_10430689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Iamiaceae → Aquihabitans → unclassified Aquihabitans → Aquihabitans sp. G128 | 591 | Open in IMG/M |
| 3300028881|Ga0307277_10480825 | Not Available | 557 | Open in IMG/M |
| 3300030619|Ga0268386_10213247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1440 | Open in IMG/M |
| 3300031543|Ga0318516_10113715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1538 | Open in IMG/M |
| 3300031547|Ga0310887_10934805 | Not Available | 551 | Open in IMG/M |
| 3300031548|Ga0307408_100855405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 829 | Open in IMG/M |
| 3300031549|Ga0318571_10239595 | Not Available | 663 | Open in IMG/M |
| 3300031680|Ga0318574_10469767 | Not Available | 736 | Open in IMG/M |
| 3300031720|Ga0307469_11102346 | Not Available | 746 | Open in IMG/M |
| 3300031731|Ga0307405_10037108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2926 | Open in IMG/M |
| 3300031731|Ga0307405_12142596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium RBG_16_64_13 | 502 | Open in IMG/M |
| 3300031769|Ga0318526_10445703 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300031778|Ga0318498_10035278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2184 | Open in IMG/M |
| 3300031782|Ga0318552_10165870 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
| 3300031852|Ga0307410_10101456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2063 | Open in IMG/M |
| 3300031901|Ga0307406_12147827 | Not Available | 501 | Open in IMG/M |
| 3300031903|Ga0307407_11019682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 640 | Open in IMG/M |
| 3300031903|Ga0307407_11382940 | Not Available | 554 | Open in IMG/M |
| 3300031911|Ga0307412_11838230 | Not Available | 558 | Open in IMG/M |
| 3300031939|Ga0308174_11133972 | Not Available | 666 | Open in IMG/M |
| 3300031954|Ga0306926_10450589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus | 1585 | Open in IMG/M |
| 3300031995|Ga0307409_100367301 | Not Available | 1363 | Open in IMG/M |
| 3300032002|Ga0307416_100635348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1151 | Open in IMG/M |
| 3300032002|Ga0307416_102062974 | Not Available | 672 | Open in IMG/M |
| 3300032005|Ga0307411_11309111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Blastococcus → unclassified Blastococcus → Blastococcus sp. DSM 44272 | 660 | Open in IMG/M |
| 3300032009|Ga0318563_10092329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus | 1593 | Open in IMG/M |
| 3300032010|Ga0318569_10147039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Eggerthellales → Eggerthellaceae → Adlercreutzia → Adlercreutzia equolifaciens | 1083 | Open in IMG/M |
| 3300032054|Ga0318570_10484437 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300032126|Ga0307415_101569924 | Not Available | 631 | Open in IMG/M |
| 3300032174|Ga0307470_10867795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Iamiaceae → Aquihabitans → unclassified Aquihabitans → Aquihabitans sp. G128 | 706 | Open in IMG/M |
| 3300032805|Ga0335078_12152117 | Not Available | 590 | Open in IMG/M |
| 3300032892|Ga0335081_11414744 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.29% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 12.38% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.52% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.71% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 4.76% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.81% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 3.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.86% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.90% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.90% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.90% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 1.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.90% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.95% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.95% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.95% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.95% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.95% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.95% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.95% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.95% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010140 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012939 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026790 | Grasslands soil microbial communities from Gorham, Kansas, USA that are Nitrogen fertilized -NN607 (SPAdes) | Environmental | Open in IMG/M |
| 3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TC_1002868491 | 3300000559 | Soil | MHHDTQPDPAMPTESFPTDPTGLPEAGRPELLELAPG |
| F14TB_1010026942 | 3300001431 | Soil | MHHDTGSDPAMPTESFPTDPTGLPEAGRPELLELAPG |
| Ga0066672_108638991 | 3300005167 | Soil | MQQPVQPSQPIPGELFPTDPAGLPEATRPQLRELADGDVVELR |
| Ga0008090_150489983 | 3300005363 | Tropical Rainforest Soil | MQHNAHSDSPMLAEFFPTDPSGLPEATRPELLELADGDDLHLR |
| Ga0070714_1018240001 | 3300005435 | Agricultural Soil | MDQHAQPGQPGTAESFPTDPAGLPEATHPELLELADGDDL |
| Ga0066654_106516202 | 3300005587 | Soil | MDQHAQPDPAASAESFPTDPAGLPEATRPALLELADGDD |
| Ga0066903_1005735451 | 3300005764 | Tropical Forest Soil | MQQPSQPDRPAPAEFFPTDPAGLPEATRPELVELADGDGV |
| Ga0066903_1069271131 | 3300005764 | Tropical Forest Soil | MQQHAQPAQPASAESFPTDPSGLPEAGPPALLELADGDEFHLRI |
| Ga0066903_1088537642 | 3300005764 | Tropical Forest Soil | MQQPSQPDRANPAEFFPTDPTGLPEATRPQLLELAD |
| Ga0081538_100214281 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MSMHHHGQPDPLMATQSFPTDPSGLAEAGRPQLLELASGDTLKL |
| Ga0082029_14091223 | 3300006169 | Termite Nest | MHHHTQSDPPMPAESFPTDPSGLPEAGRPQLLELAPGDTLELQ |
| Ga0070712_1006919781 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MDQHAQPGQPASAESFPTDPTGLPEATRPALLELADGDDL |
| Ga0075425_1023649733 | 3300006854 | Populus Rhizosphere | MDQHAQPGQPAPAESFPTDPTGLPEATRPALLELADGDDLHLQIG |
| Ga0099792_109076191 | 3300009143 | Vadose Zone Soil | MDQHTYPGQAAPAESFPTDPTGLPEATRPALLELA |
| Ga0114129_107441841 | 3300009147 | Populus Rhizosphere | MQRHTRSDSLATESFPTDPSGLPEAGRPPLLELAPGDTLDLKVGP |
| Ga0105237_111989341 | 3300009545 | Corn Rhizosphere | MQQPTHPDRPVSAESFPTDPTGLPQATPPELQELAD |
| Ga0126307_100473211 | 3300009789 | Serpentine Soil | MDHTQSDPLATESFPTDPSGLPEAGRPELLELADGDT |
| Ga0126307_110816841 | 3300009789 | Serpentine Soil | MHHHTPADPMAIESFPTDPSGLPEAGRPQLLELAHGDSLDLEVGPLNASWES* |
| Ga0105058_10898392 | 3300009837 | Groundwater Sand | MHHHTPPDPPMSAQSFPTDPSGLPEAGRPALLELA |
| Ga0126312_101828701 | 3300010041 | Serpentine Soil | MHHDMQPDPAMPTESFPTDPSGLPEAGRPVLLELAHGTP* |
| Ga0126312_103166111 | 3300010041 | Serpentine Soil | MDHTQSDPLATESFPTDPSGLPEAGRPELLELADGDTLE |
| Ga0126314_105541522 | 3300010042 | Serpentine Soil | MHHDMQPDPAMPTESFPTDPTGLPEATRPELLELAPGDTLDL |
| Ga0126380_108467241 | 3300010043 | Tropical Forest Soil | MQQHAHADSPMPAESFPTDPSGLPEATRPALVELADGDDLHLRITP |
| Ga0126373_104197763 | 3300010048 | Tropical Forest Soil | MHKHAEPGETAPTESFPTDPTGLPEATRPALLELAD |
| Ga0127456_11780692 | 3300010140 | Grasslands Soil | MDQHAQPDPAASAESFPTDPAGLPEATRPALLELADG |
| Ga0134111_104620641 | 3300010329 | Grasslands Soil | MHHDTQPDPAMPTESFPTDPTGLPEATRPELLELAPGDTLEL |
| Ga0126370_108634253 | 3300010358 | Tropical Forest Soil | MQQPTQPGRPLSTETFPTDPTGLPEATRPELLELADGG |
| Ga0126378_107051043 | 3300010361 | Tropical Forest Soil | MQQHAHPGRPAPTEFFPTDPTGLPEATRPELLELA |
| Ga0126379_131841322 | 3300010366 | Tropical Forest Soil | MIMQQPPQPDRPAPAEFFPTDPTGLPEATRPAVLELADGDAF |
| Ga0126381_1003145133 | 3300010376 | Tropical Forest Soil | MQQHAHPGRPAPTEFFPTDPTGLPEATRPELLELADGDDL |
| Ga0126383_117595722 | 3300010398 | Tropical Forest Soil | MQQHAQPGQQTSAESFPTDPSGLPEATRPALLELADGDAFDLRIG |
| Ga0138513_1000579531 | 3300011000 | Soil | MHHHTQPDPLSTESFPTDPSGLPEAGRPQLLELAP |
| Ga0137381_102489171 | 3300012207 | Vadose Zone Soil | MHQHAQPGQPTPAEVFPTDPSGLPEATRPALVELA |
| Ga0137369_103459091 | 3300012355 | Vadose Zone Soil | MQHHARPDRPTPAESFPTDPTGLPEAGRPALLELAHGDT |
| Ga0137371_104713851 | 3300012356 | Vadose Zone Soil | MIMQQPPQPDRPAQAEFFPTDPTGLPEATRPQLLELADGD |
| Ga0137371_110358962 | 3300012356 | Vadose Zone Soil | MHQPPHPDRPTTAESFPTDPSGLPEAARPALLELADG |
| Ga0137375_108454481 | 3300012360 | Vadose Zone Soil | MQHHTRPDQPTPAESFPTDPTGLPEAGRPALLELA |
| Ga0162650_1000122341 | 3300012939 | Soil | MNHHPQPDPLATESFPTDPSGLPEAGRPQLLELAPGDTLELHVGPV |
| Ga0164298_111390051 | 3300012955 | Soil | MQQPTHPDRPVSAESFPTDPTGLPEATPPELQELTDGDTF |
| Ga0182039_122067472 | 3300016422 | Soil | MQHNAHSDSPTSAGAFPTDPTGLPEATRPALRELADGDDLD |
| Ga0187776_112504481 | 3300017966 | Tropical Peatland | MDQHAQPGQPAPAESFPTDPSGLPEATRPAVLELGDGDAFDLR |
| Ga0187780_102383103 | 3300017973 | Tropical Peatland | MQQHAPAGQPAPAEFFPTDPTGLPEATRPELIELASGDQVHLRI |
| Ga0190269_120468162 | 3300018465 | Soil | MQHGRPDLPTPVESFPTDPSGLPEAGRPEVLELAHGD |
| Ga0190268_103043962 | 3300018466 | Soil | MQHTPPDLPTPLESFPTDPSGLPEAGRPRMLELADG |
| Ga0190274_136881271 | 3300018476 | Soil | MHHTQPDPLATDSFPTDPSGLPEAGRPQLLELGPGDTLDLQVG |
| Ga0210381_101186973 | 3300021078 | Groundwater Sediment | MHHHTQPDPLATESFPTDLTGLPEATRPQQLELAPG |
| Ga0210405_109265441 | 3300021171 | Soil | MDQHTYPGQAAPAESFPTDPSGLPEATRPELLAVADGGDLHL |
| Ga0213881_102736811 | 3300021374 | Exposed Rock | MHQHAQPGPAAPAGSFPTDPAGLPEAARPAVLELADGDVLD |
| Ga0126371_104919021 | 3300021560 | Tropical Forest Soil | MQQPAQPGPQASAESFPTDPSGLPEATRPALLELADGDPFDL |
| Ga0126371_115192983 | 3300021560 | Tropical Forest Soil | MAKTTDQYTYPGQTAPAEFFPTDPSGLPEATRPALAELAD |
| Ga0126371_117619262 | 3300021560 | Tropical Forest Soil | MQHNAHSDSPMLAESFPTDPSGLPEATRPEVLALADGDDLHLR |
| Ga0126371_134285351 | 3300021560 | Tropical Forest Soil | MHQHAQPGQPAPGESFPTDPSGLPEATRPELLELA |
| Ga0224712_105074291 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | MDQHAQPGQPASAESFPTDPTGLPEATRPALLELADGDDIHLQ |
| Ga0207647_104782822 | 3300025904 | Corn Rhizosphere | VEHTRADSPMSAESFPTDPTGLPEARRTALVELADGAEL |
| Ga0207699_100009131 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MDQHAQPGQPAPAESFPTDPTGLPEATRPALLELADGDDLHLQI |
| Ga0207699_114630931 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MDQHAQPGQPAPAESFPTDPSGLPEATRPALLELADG |
| Ga0207707_100859101 | 3300025912 | Corn Rhizosphere | MHQHAQPGQPASAESFPTDPSGLPAATRPELLELA |
| Ga0207663_100412921 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MDQHAQPGQPAPAESFPTDPTGLPEATRPALLELADGD |
| Ga0207702_103940543 | 3300026078 | Corn Rhizosphere | MQQPTHPDRPVSAESFPTDPTGLPQATPPELQELA |
| Ga0208710_1077422 | 3300026790 | Soil | MQHHTQPDPLGTESFPTDPSGLPEAGRPELLELAPGD |
| Ga0209874_10127344 | 3300027577 | Groundwater Sand | MQHHTRPDLPTPVESFPTDPSGLPEAGRPALLELANGDTLDLQVG |
| Ga0209874_10210183 | 3300027577 | Groundwater Sand | MYHHTQPDPLATESFPTDPSGLPEAGRPALLELANGDTLDLQVG |
| Ga0209814_103524932 | 3300027873 | Populus Rhizosphere | MHHHTQPDPLATESFPTDPSGLPGAGRSQLLELAPGDTLELRVG |
| Ga0209465_101819161 | 3300027874 | Tropical Forest Soil | MQQHAHPGRPAPTEFFPTDPTGLPEATRPELLELADGD |
| Ga0209853_10683562 | 3300027961 | Groundwater Sand | MYHHTQPDPLATESFPTDPSGLPEAGRPALLELANGDTLDLQ |
| Ga0307276_100832951 | 3300028705 | Soil | VDHHSAHGSPGLAESFPTDPTGLPEATGPALVELA |
| Ga0307320_102643921 | 3300028771 | Soil | MDHTRPDPTATESFPTDPSGLPEAGRPELLELADGETLELR |
| Ga0307290_103079142 | 3300028791 | Soil | MKHHTRPDPASPESFPTDPSGLPEAGRPQLLELADGDTLE |
| Ga0307287_100438423 | 3300028796 | Soil | MQHHTRPDPTSPESFPTDPSGLPEAGRPQLLELAD |
| Ga0307302_101286901 | 3300028814 | Soil | MQHHARPDSSEPDSFPTDPSGLPEATRPQVVELADGDVL |
| Ga0307296_103870121 | 3300028819 | Soil | MQQRPQPDAVTPSESFPTDPTGLPEATRPEVLELAP |
| Ga0307286_100231401 | 3300028876 | Soil | MQHHTRPDPTSPEPFPTDPSGLPEAGRPQLLELAPGDT |
| Ga0307277_100203381 | 3300028881 | Soil | MDRHAQPGQPAPAESFPTDPTGLPEATRPALLELAD |
| Ga0307277_104306892 | 3300028881 | Soil | MQHGRPDLPTPVESFPTDPSGLPEAGRPEVLELGH |
| Ga0307277_104808251 | 3300028881 | Soil | MQHHTQRDPLATESFPTDPSGLPEAGRPQLLELAPGDTLDLGVGPVA |
| Ga0268386_102132471 | 3300030619 | Soil | MQHVAQHDVPTPSTTFPTDPSGLPEATRPALLELAEDDVFD |
| Ga0318516_101137153 | 3300031543 | Soil | MHQHAQPGETTPAESFPTDPSGLPEATRPALRELADGDDLD |
| Ga0310887_109348051 | 3300031547 | Soil | MQQPTYPDRPVSAESFPTDPTGLPEATPPELQELADGDTF |
| Ga0307408_1008554052 | 3300031548 | Rhizosphere | MHHHTPADPMAIESFPTDPSGLPEAGRPQLLELAHGETLDLEV |
| Ga0318571_102395951 | 3300031549 | Soil | MQHNAHSDSPTSAGAFPTDPTGLPEATCPALLELA |
| Ga0318574_104697672 | 3300031680 | Soil | MHQHAQPGETTPAESFPTDPSGLPEATRPALRELADG |
| Ga0307469_111023461 | 3300031720 | Hardwood Forest Soil | MQQPTHPDQPVSAESFPTDPTGLPEATPPELQKLADGDTFD |
| Ga0307405_100371081 | 3300031731 | Rhizosphere | MHHDMQPDPAMPTESFPTDPSGLPEAGRPVLLELAHGTP |
| Ga0307405_121425961 | 3300031731 | Rhizosphere | MHHHTAHESPGPAESFPTDPTGLPEATRPAVVELAVDDQLD |
| Ga0318526_104457032 | 3300031769 | Soil | MQQHAHPGRPTPAEFFPTDPTGLPEATPTELLELA |
| Ga0318498_100352783 | 3300031778 | Soil | MQQHADPGRPAPAEFFPTDPTGLPKATRPELLELAN |
| Ga0318552_101658701 | 3300031782 | Soil | MQQHADPGRPAPAEFFPTDPTGLPEATRPELLELANG |
| Ga0307410_101014561 | 3300031852 | Rhizosphere | MQHHIDHDQPDRFPTDPSGLPEAGRPVLLELAHGDTLKLDIGPVASGWVTAWCG |
| Ga0307406_121478271 | 3300031901 | Rhizosphere | MHHHTQPDPLATESFPTDPSGLPEAGRPQLLELAPGD |
| Ga0307407_110196821 | 3300031903 | Rhizosphere | VHHQTAHSSPGPAESFPTDPTGLPEATRPTLVELADGDQL |
| Ga0307407_113829402 | 3300031903 | Rhizosphere | MHHHTRPDPAMPTESFPTDPVGLPEAGRPEVLSWPR |
| Ga0307412_118382301 | 3300031911 | Rhizosphere | MHHDTQPDPAMPTESFPSDPTGLPEATRPELLELAPGDT |
| Ga0308174_111339722 | 3300031939 | Soil | MDQHAQPDPAALAESFPTDPAGLPEATRPALLELA |
| Ga0306926_104505891 | 3300031954 | Soil | MQQHARPDSPMSAEFFPTDPTGLPEATRPELLDLADG |
| Ga0307409_1003673013 | 3300031995 | Rhizosphere | MHHDMQPDPAMPTESFPTDPSGLPEAGRPVLLELAHGDTLKLDIGPV |
| Ga0307416_1006353483 | 3300032002 | Rhizosphere | MHHHTQRDPAMAAESFPTDPAGLPEAGRPQLLVLASGDTL |
| Ga0307416_1020629741 | 3300032002 | Rhizosphere | MQYDTQPDPAMATESFPTDPSGLPEAGRPELLELAPGGTLELQVGPVAK |
| Ga0307411_113091111 | 3300032005 | Rhizosphere | MHHHTPADPMAIESFPTDPSGLPEAGRPQLLELAHGDTLDLEVGPLA |
| Ga0318563_100923293 | 3300032009 | Soil | MQQHADPGRPAPAEFFPTDPTGLPEATRPELLELANGDDLRLR |
| Ga0318569_101470392 | 3300032010 | Soil | MHQHAQPGETTPAESFPTDPSGLPEATRPALRELADGDDLDLRL |
| Ga0318570_104844372 | 3300032054 | Soil | MQQHARPDSPMSAEFFPTDPTGLPEATRPELLDLADGGEMHLRV |
| Ga0307415_1015699241 | 3300032126 | Rhizosphere | MHHHIQPDPLATESFPSDPTGLPEATRPELLELAPG |
| Ga0307470_108677952 | 3300032174 | Hardwood Forest Soil | MQHGRPDLPTPVESFPTDPSGLPEAGRPEVLELGHGDTLPLRVG |
| Ga0335078_121521171 | 3300032805 | Soil | MDQHTYPGQAAPSGSFPTDPAGLPEATRPALLELADGDELHL |
| Ga0335081_114147441 | 3300032892 | Soil | MHTQAQPGQPASAEFFPTDPSGLPEATRPALLELADGDEFHLRI |
| ⦗Top⦘ |