Basic Information | |
---|---|
Family ID | F095993 |
Family Type | Metagenome |
Number of Sequences | 105 |
Average Sequence Length | 43 residues |
Representative Sequence | AGHMADDGFAARLLTSAEPGAAGGRVILAEAARDALRAAGL |
Number of Associated Samples | 94 |
Number of Associated Scaffolds | 105 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 6.67 % |
% of genes near scaffold ends (potentially truncated) | 86.67 % |
% of genes from short scaffolds (< 2000 bps) | 84.76 % |
Associated GOLD sequencing projects | 91 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.40 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (96.190 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (19.048 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.762 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.619 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.83% β-sheet: 0.00% Coil/Unstructured: 52.17% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 105 Family Scaffolds |
---|---|---|
PF02771 | Acyl-CoA_dh_N | 71.43 |
PF02641 | DUF190 | 3.81 |
PF01636 | APH | 2.86 |
PF13242 | Hydrolase_like | 1.90 |
PF00027 | cNMP_binding | 0.95 |
PF07690 | MFS_1 | 0.95 |
PF10415 | FumaraseC_C | 0.95 |
PF02770 | Acyl-CoA_dh_M | 0.95 |
PF04972 | BON | 0.95 |
PF01740 | STAS | 0.95 |
PF00378 | ECH_1 | 0.95 |
PF00069 | Pkinase | 0.95 |
PF00331 | Glyco_hydro_10 | 0.95 |
PF06026 | Rib_5-P_isom_A | 0.95 |
COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
---|---|---|---|
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 72.38 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.81 |
COG1993 | PII-like signaling protein | Signal transduction mechanisms [T] | 3.81 |
COG0120 | Ribose 5-phosphate isomerase | Carbohydrate transport and metabolism [G] | 0.95 |
COG3693 | Endo-1,4-beta-xylanase, GH35 family | Carbohydrate transport and metabolism [G] | 0.95 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 96.19 % |
Unclassified | root | N/A | 3.81 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000567|JGI12270J11330_10002764 | All Organisms → cellular organisms → Bacteria | 12813 | Open in IMG/M |
3300004081|Ga0063454_101218658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 624 | Open in IMG/M |
3300005172|Ga0066683_10742900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 577 | Open in IMG/M |
3300005347|Ga0070668_101771332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 568 | Open in IMG/M |
3300005444|Ga0070694_101548278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 562 | Open in IMG/M |
3300005526|Ga0073909_10281987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 749 | Open in IMG/M |
3300005610|Ga0070763_10129517 | All Organisms → cellular organisms → Bacteria | 1300 | Open in IMG/M |
3300005764|Ga0066903_107317649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 571 | Open in IMG/M |
3300006032|Ga0066696_10138785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1505 | Open in IMG/M |
3300006032|Ga0066696_10575107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 734 | Open in IMG/M |
3300006052|Ga0075029_100879158 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300006162|Ga0075030_100553514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 913 | Open in IMG/M |
3300006172|Ga0075018_10374586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 719 | Open in IMG/M |
3300006358|Ga0068871_101521151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 632 | Open in IMG/M |
3300006800|Ga0066660_10801289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 767 | Open in IMG/M |
3300006904|Ga0075424_102344144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 560 | Open in IMG/M |
3300009101|Ga0105247_10262373 | All Organisms → cellular organisms → Bacteria | 1185 | Open in IMG/M |
3300009521|Ga0116222_1007111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5408 | Open in IMG/M |
3300009792|Ga0126374_10560644 | Not Available | 836 | Open in IMG/M |
3300010326|Ga0134065_10239843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 672 | Open in IMG/M |
3300010333|Ga0134080_10212981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 841 | Open in IMG/M |
3300010359|Ga0126376_10951529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 854 | Open in IMG/M |
3300010360|Ga0126372_12052760 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300010361|Ga0126378_10187699 | All Organisms → cellular organisms → Bacteria | 2137 | Open in IMG/M |
3300010375|Ga0105239_10268093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1920 | Open in IMG/M |
3300010376|Ga0126381_100091769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3853 | Open in IMG/M |
3300010376|Ga0126381_104898679 | Not Available | 514 | Open in IMG/M |
3300010398|Ga0126383_12289199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 626 | Open in IMG/M |
3300011269|Ga0137392_11294540 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300012089|Ga0153924_1139940 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300012200|Ga0137382_10055660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2485 | Open in IMG/M |
3300012200|Ga0137382_10291596 | All Organisms → cellular organisms → Bacteria | 1137 | Open in IMG/M |
3300012211|Ga0137377_10484348 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
3300012357|Ga0137384_11136416 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300012360|Ga0137375_10176350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2056 | Open in IMG/M |
3300012469|Ga0150984_114401201 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300012491|Ga0157329_1015694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 657 | Open in IMG/M |
3300012499|Ga0157350_1056674 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300012944|Ga0137410_10534321 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
3300012961|Ga0164302_10724063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 740 | Open in IMG/M |
3300012971|Ga0126369_10991949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. GbtcB6 | 927 | Open in IMG/M |
3300012971|Ga0126369_11398848 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
3300012984|Ga0164309_10836760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 744 | Open in IMG/M |
3300012986|Ga0164304_10813434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 722 | Open in IMG/M |
3300013105|Ga0157369_12292761 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300013297|Ga0157378_13132890 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300015374|Ga0132255_106045352 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300016270|Ga0182036_11108475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 656 | Open in IMG/M |
3300016371|Ga0182034_11464991 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300016387|Ga0182040_10435714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1036 | Open in IMG/M |
3300016422|Ga0182039_10788917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 842 | Open in IMG/M |
3300017933|Ga0187801_10214603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 765 | Open in IMG/M |
3300017959|Ga0187779_11042458 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300017970|Ga0187783_10043532 | All Organisms → cellular organisms → Bacteria | 3324 | Open in IMG/M |
3300017970|Ga0187783_11250556 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300018060|Ga0187765_10272015 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
3300018433|Ga0066667_11302399 | Not Available | 635 | Open in IMG/M |
3300019885|Ga0193747_1112787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 651 | Open in IMG/M |
3300019996|Ga0193693_1033787 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
3300021478|Ga0210402_11839093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 531 | Open in IMG/M |
3300021559|Ga0210409_11511795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 547 | Open in IMG/M |
3300024271|Ga0224564_1004561 | All Organisms → cellular organisms → Bacteria | 2143 | Open in IMG/M |
3300025928|Ga0207700_10079519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2553 | Open in IMG/M |
3300025940|Ga0207691_10129308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2232 | Open in IMG/M |
3300026121|Ga0207683_11767093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 568 | Open in IMG/M |
3300026330|Ga0209473_1113024 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
3300027066|Ga0208236_1000131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2123 | Open in IMG/M |
3300027497|Ga0208199_1005227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3340 | Open in IMG/M |
3300027604|Ga0208324_1014118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2550 | Open in IMG/M |
3300027787|Ga0209074_10040944 | All Organisms → cellular organisms → Bacteria | 1375 | Open in IMG/M |
3300027787|Ga0209074_10296300 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300027821|Ga0209811_10236587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 695 | Open in IMG/M |
3300027874|Ga0209465_10496385 | Not Available | 609 | Open in IMG/M |
3300027911|Ga0209698_10124207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2136 | Open in IMG/M |
3300028047|Ga0209526_10762074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 603 | Open in IMG/M |
3300031543|Ga0318516_10764124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 547 | Open in IMG/M |
3300031549|Ga0318571_10168225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 767 | Open in IMG/M |
3300031572|Ga0318515_10205040 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
3300031668|Ga0318542_10202787 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
3300031668|Ga0318542_10699992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 530 | Open in IMG/M |
3300031713|Ga0318496_10010343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4381 | Open in IMG/M |
3300031744|Ga0306918_11213935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 582 | Open in IMG/M |
3300031748|Ga0318492_10765973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 518 | Open in IMG/M |
3300031754|Ga0307475_10979248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 665 | Open in IMG/M |
3300031770|Ga0318521_10757410 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300031795|Ga0318557_10119764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1177 | Open in IMG/M |
3300031795|Ga0318557_10244526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 822 | Open in IMG/M |
3300031796|Ga0318576_10508747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 568 | Open in IMG/M |
3300031897|Ga0318520_10924221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 550 | Open in IMG/M |
3300031912|Ga0306921_10038633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5376 | Open in IMG/M |
3300031912|Ga0306921_10322748 | All Organisms → cellular organisms → Bacteria | 1807 | Open in IMG/M |
3300031954|Ga0306926_11813367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 692 | Open in IMG/M |
3300031959|Ga0318530_10058036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1473 | Open in IMG/M |
3300032001|Ga0306922_11226940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 762 | Open in IMG/M |
3300032052|Ga0318506_10427727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 587 | Open in IMG/M |
3300032055|Ga0318575_10343164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 757 | Open in IMG/M |
3300032090|Ga0318518_10619484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 552 | Open in IMG/M |
3300032090|Ga0318518_10726117 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300032180|Ga0307471_103232650 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300032893|Ga0335069_11188602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 836 | Open in IMG/M |
3300032896|Ga0335075_10468866 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
3300033134|Ga0335073_10854904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 966 | Open in IMG/M |
3300033158|Ga0335077_10635010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus | 1109 | Open in IMG/M |
3300033158|Ga0335077_10703517 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
3300034268|Ga0372943_1202793 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.05% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.57% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.57% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.71% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.76% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.76% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.81% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.81% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.81% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.90% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.90% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.90% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.90% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.90% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.90% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.90% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.95% |
Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.95% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.95% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.95% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.95% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.95% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.95% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.95% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.95% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.95% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.95% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.95% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.95% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.95% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.95% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.95% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.95% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.95% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012089 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ008 MetaG | Host-Associated | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Host-Associated | Open in IMG/M |
3300012499 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.yng.030610 | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
3300019996 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a2 | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
3300027066 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF005 (SPAdes) | Environmental | Open in IMG/M |
3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12270J11330_1000276410 | 3300000567 | Peatlands Soil | MTSYGDHGFAARLLTSAEPGAAGGRVILAEAARDALRAAGL* |
Ga0063454_1012186581 | 3300004081 | Soil | ACINVGVRARYLAGHMGDDGFAAALATPAGSRAPGLAGERLVLAEAARDALREGTI* |
Ga0066683_107429002 | 3300005172 | Soil | LAGHMADDGFAAQLLTSAENPEPGSAGARIVLAEAARDALRDGSL* |
Ga0070668_1017713322 | 3300005347 | Switchgrass Rhizosphere | DDGFAVRLATSAGSREPGTAGGRLVLAEAARDALREGSL* |
Ga0070694_1015482782 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | ACIGVGVRARYLAGYMADDGFAARLLTSAENPEPGSAGARIVLAEAARDALRAGRL* |
Ga0073909_102819872 | 3300005526 | Surface Soil | RARYLAGHMGEDGFAARLATSAESGDLGAAGGRVVLAEAARDALREGSL* |
Ga0070763_101295171 | 3300005610 | Soil | RYLAGHMADDGFAAGLLTSAEPGAAGGRVVLAEAARDALRAAGL* |
Ga0066903_1073176491 | 3300005764 | Tropical Forest Soil | VRARYLAGHMADDGFAARLLTPAEPGEAGGRVVLAEAARDALREGGL* |
Ga0066696_101387853 | 3300006032 | Soil | MGDDGFAARFGTSAGSGEPGSAGSRVVLAEAARDALRGVGL* |
Ga0066696_105751071 | 3300006032 | Soil | LAGHMGDDGFAARLATPGESREPGTAGGRVVLAEAARDALREGSL* |
Ga0075029_1008791581 | 3300006052 | Watersheds | GHMADDGFAARLLTSAEPGAAGSRVILAEAARDALRAAGL* |
Ga0075030_1005535141 | 3300006162 | Watersheds | RARYLAGHMADDGYAATLLTAAEAGEAGGRVVLAEAARDALLEGGL* |
Ga0075018_103745862 | 3300006172 | Watersheds | RYLAGHMADDGFAARLLTSAEPGAAGDRVILAEAARDALRAAGL* |
Ga0068871_1015211512 | 3300006358 | Miscanthus Rhizosphere | VGVRARYLAGHMGDDGFAARLATSAGSREPGTAGGRVVLAEAARDALREGGL* |
Ga0066660_108012892 | 3300006800 | Soil | MADDGFAARLLTSAENPDPGAAGGRVILAEAARDALREGSL* |
Ga0075424_1023441441 | 3300006904 | Populus Rhizosphere | CIGVGVRARYLAGHMGDDGFAARLATSAGSREPGTAGGRLVLAEAARDALREGSL* |
Ga0105247_102623731 | 3300009101 | Switchgrass Rhizosphere | ARLATSAGSREPGTAGGRLVLAEAARDALREGSL* |
Ga0116222_10071115 | 3300009521 | Peatlands Soil | MTSHGDHGFAARLLTSAEPGAAGGRVILAEAARDALRAAGL* |
Ga0126374_105606442 | 3300009792 | Tropical Forest Soil | GHMADDGYARLLVSTEPGAAGEQTVLAEAARDALRGGGATER* |
Ga0134065_102398431 | 3300010326 | Grasslands Soil | DGFTARLLTSAESGEPGAAGARVVLAEAARDALRAGSL* |
Ga0134080_102129812 | 3300010333 | Grasslands Soil | VGVRARYLAGHMADDGFAARLLTSAESREPGAAGERVVLAEAARDALRAGSL* |
Ga0126376_109515291 | 3300010359 | Tropical Forest Soil | ADDGFAARLLTSAENPDPGSAASRVILAEAARDALREGGL* |
Ga0126372_120527602 | 3300010360 | Tropical Forest Soil | GVGVRARYLAGHMADDGFAARLLTSAESGEPGAAWARIVLAEAARDALREGSL* |
Ga0126378_101876992 | 3300010361 | Tropical Forest Soil | VGVRARYLAGHMADDGFAARLLTPAEPGEAGGRVVLAEAARDALREGGL* |
Ga0105239_102680931 | 3300010375 | Corn Rhizosphere | RARYLAGHMGDDGFAARLATSAGSREPGTAGGRLVLAEAARDALREGSL* |
Ga0126381_1000917691 | 3300010376 | Tropical Forest Soil | RYLAGHMADDGYAATLLPGAVVNRTVLAEAARDALRDGGV* |
Ga0126381_1048986791 | 3300010376 | Tropical Forest Soil | MADDGYARLLASAEPGAARDLNVLAEAARDALRDGGV* |
Ga0126383_122891991 | 3300010398 | Tropical Forest Soil | GDDGFAARLGTPADSGEAGSFGSRFVLAEAARDALREGSL* |
Ga0137392_112945402 | 3300011269 | Vadose Zone Soil | VRARYLAGHMADDGFAARLLTSAENPEPGSAGARIVLAEAARDALRAAGR* |
Ga0153924_11399401 | 3300012089 | Attine Ant Fungus Gardens | VRARYLAGHMADDGYAATLLSSAQAGEAGGRVVLAEAARDALCEGGL* |
Ga0137382_100556602 | 3300012200 | Vadose Zone Soil | MADDGFAARLLTSADSREPGAAGGRVVLAEAARDALREDSL* |
Ga0137382_102915962 | 3300012200 | Vadose Zone Soil | MADDGFARLLTSAEPGAAGGRVILAEAARDALRAAGL* |
Ga0137377_104843482 | 3300012211 | Vadose Zone Soil | YLAGHMADDGFAAQLLASAENPEPGSAGARIVLAEAARDTLREGSL* |
Ga0137384_111364162 | 3300012357 | Vadose Zone Soil | RARYLAGHMGDDGFAATFQPSAENPDPGSPGSRAVLAEAARDALRAGSL* |
Ga0137375_101763503 | 3300012360 | Vadose Zone Soil | MADDGFAARVLTSSREPGAAGGRVVLAEAARDALREGSL* |
Ga0150984_1144012011 | 3300012469 | Avena Fatua Rhizosphere | YLAGHMGDDGFAAALATPAGSRAPGLAGERLVLAEAARDALREGTI* |
Ga0157329_10156941 | 3300012491 | Arabidopsis Rhizosphere | DGFAVRLATSAGSREPGTAGGRLVLAEAARDALREGSL* |
Ga0157350_10566741 | 3300012499 | Unplanted Soil | MGDDGFAVRLATSAGSREPGTAGGRLVLAEAARDALREGSL* |
Ga0137410_105343211 | 3300012944 | Vadose Zone Soil | RYLAGHMADDGFAARLLTSAENPEPGSAGARIVLAEAARDALREGSL* |
Ga0164302_107240631 | 3300012961 | Soil | MGEDGFAARLATSAESGDLGAAGGRVVLAEAARDALREGSL* |
Ga0126369_109919492 | 3300012971 | Tropical Forest Soil | ARYLAGHMADDGYARLLASAEPGAARDLNVLAEAARDALRDGGV* |
Ga0126369_113988483 | 3300012971 | Tropical Forest Soil | MADDGFAARLLTSAEPGSAASRAILAEAARDALRKGGL* |
Ga0164309_108367601 | 3300012984 | Soil | DDGFAARLLTSAENPEPGLAGARIVLAEAARDALRDGSL* |
Ga0164304_108134342 | 3300012986 | Soil | AAQLLTSAENPEPGLAGARIVLAEAARDALRDGSL* |
Ga0157369_122927611 | 3300013105 | Corn Rhizosphere | GVRARYLAGHMGDDGFAARLATSAGSREPGTAGGRLVLAEAARDALREGSL* |
Ga0157378_131328902 | 3300013297 | Miscanthus Rhizosphere | RARYLAGHMADDGFAARLLTSAENPEPGSAGARIVLAEAARDALREGGL* |
Ga0132255_1060453522 | 3300015374 | Arabidopsis Rhizosphere | CIGVGVRARYLAGHMADDGFAARLLTSGENPDPGSAGSRAILAEAARDALCDCGL* |
Ga0182036_111084752 | 3300016270 | Soil | GHMADDGFAARLLTSAEPGSAASRAILAEAARDALRESGL |
Ga0182034_114649912 | 3300016371 | Soil | ADDGFAARLLTSAGPGEAGGRVVLAEAARDSLREGGL |
Ga0182040_104357141 | 3300016387 | Soil | HMADDGYAATLLPGAVANRTVLAEAARDALRDGGV |
Ga0182039_107889171 | 3300016422 | Soil | RARYLAGHMADDGFAARLLTSAGPGEAGGRVVLAEAARDSLREGGL |
Ga0187801_102146031 | 3300017933 | Freshwater Sediment | MADDGFAARLLTSAEPGAAGDRVVLAEAARDALRAAGL |
Ga0187779_110424582 | 3300017959 | Tropical Peatland | VRARYLAGHMADDGFAARLLTSAEPGAAGSRVVLAEAARDALRAAGL |
Ga0187783_100435321 | 3300017970 | Tropical Peatland | GHMADDGHAATVLTSARPGEAGGRVVLAEAARQALREGSR |
Ga0187783_112505562 | 3300017970 | Tropical Peatland | ADDGFAAGLLTSAEPGAGGSRVLLAEAARDALRAGL |
Ga0187765_102720152 | 3300018060 | Tropical Peatland | ARYLAGHMADDGFAARLLVAAEPGEAGGRVVLAEAARDALREGGL |
Ga0066667_113023991 | 3300018433 | Grasslands Soil | MGDDGLAASFGTSAQSGEPGSAGSRAVLAEAARDALRADSL |
Ga0193747_11127871 | 3300019885 | Soil | RYLAGHMGDDGFAARLATPAGSGDPGAAGGRVVLAEAARDALSAGSL |
Ga0193693_10337872 | 3300019996 | Soil | RYLAGHMADDGFTASLLTSAESREPGAAGGRVVLAEAARDALREGSL |
Ga0210402_118390931 | 3300021478 | Soil | MADDGFTGRLLTSAEPGSAGSRAILAEASRDALRQGVGFLR |
Ga0210409_115117952 | 3300021559 | Soil | ARYLAGHMADDGFAATLLTSAEPGAAGSRVILAEAARDALRAAGR |
Ga0224564_10045613 | 3300024271 | Soil | AGHMADDGFAARLLTSAEPGAAGGRVILAEAARDALRAAGL |
Ga0207700_100795194 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | GVRARYLAGHMGDDGFAASFLTSAGNPEPGSAGSRAVLAEAARDALRDAGL |
Ga0207691_101293083 | 3300025940 | Miscanthus Rhizosphere | VRARYLAGHMADDGFTARLLTSAESGEPGAAGGRVVLAEAARDALREGSL |
Ga0207683_117670932 | 3300026121 | Miscanthus Rhizosphere | ADDGFAARLLTSAENPEPGSAGARIVLAEAARDALRAGSL |
Ga0209473_11130242 | 3300026330 | Soil | AGNMADDGFAARLLTSAENPDPGAAGGRVILAEAARDALRAAGL |
Ga0208236_10001313 | 3300027066 | Forest Soil | MADDGFAARLLTSAEPGAAGSRVVLAEAARDALRAAGL |
Ga0208199_10052274 | 3300027497 | Peatlands Soil | MTSYGDHGFAARLLTSAEPGAAGGRVILAEAARDALRAAGL |
Ga0208324_10141181 | 3300027604 | Peatlands Soil | MTSHGDHGFAARLLTSAEPGAAGGRVILAEAARDALRAAGL |
Ga0209074_100409442 | 3300027787 | Agricultural Soil | YLAGHMGDDGFAARLATPAGSGEPGTAGARVALAEAARDALREGSL |
Ga0209074_102963002 | 3300027787 | Agricultural Soil | GVRARYLAGHMGDDGFAARLGTPADSGEPGSFGSRFVLAEAARDALRAGSL |
Ga0209811_102365871 | 3300027821 | Surface Soil | VRARYLAGHMGEDGFAARLATSAESGDLGAAGGRVVLAEAARDALHEGSL |
Ga0209465_104963852 | 3300027874 | Tropical Forest Soil | LAGHMADDGYATLLTSAEPGAAGDPTVLAEAARDALRDGGV |
Ga0209698_101242073 | 3300027911 | Watersheds | YLAGHMADDGFAARVLTSAEPGAAGGRVVLAEAARDALRAAGL |
Ga0209526_107620741 | 3300028047 | Forest Soil | MADDGFAARLLTSPENPEPGSGFSAGARIVLAEAARDALREGSL |
Ga0318516_107641242 | 3300031543 | Soil | VGVRSRYLAGHMADDGYARLMTSAAPGTAWDRTVLAEAARDALRDGGV |
Ga0318571_101682251 | 3300031549 | Soil | DDGFAARLLTSAGPGEAGGRVVLAEAARDALREGGV |
Ga0318515_102050402 | 3300031572 | Soil | ARYLAGHMGDDGFAARFLTSAEPGSAGSRVVLAEAARDALRGVGL |
Ga0318542_102027872 | 3300031668 | Soil | ADDGFAARLLTSAEPGSAASRAILAEAARDALREGGL |
Ga0318542_106999921 | 3300031668 | Soil | VGVRSRYLAGHMADDGYARLMTSAEPGTAWDRTVLAEAARDALRDGGV |
Ga0318496_100103434 | 3300031713 | Soil | HMADDGFAARLLTSAEPGSAASRAILAEAARDALREGGL |
Ga0306918_112139352 | 3300031744 | Soil | VRSRYLAGHMADDGFARLLTSAEPGPAGDRTVLVEAARDALRDGGV |
Ga0318492_107659732 | 3300031748 | Soil | AMCPARLMTSAAPGTAWDRTVLAEAARDALRDGGV |
Ga0307475_109792482 | 3300031754 | Hardwood Forest Soil | CIGVGVRARYLAGYMADDGFAAGLLTSAEPGAAGSRVVLAEAARDALRAAGL |
Ga0318521_107574101 | 3300031770 | Soil | VRARYLAGHMADDGFAARLLTSAGPGEAGGRVVLAEAARDALREGDL |
Ga0318557_101197641 | 3300031795 | Soil | YLAGHMADDGYARLMTSAEPGTAWDRTVLAEAARDALRDGGV |
Ga0318557_102445261 | 3300031795 | Soil | VRSRYLAGHMADDGYAATLLPGAVANRTVLAEAARDALRDGGV |
Ga0318576_105087472 | 3300031796 | Soil | ADDGYARLMTSAEPGTAWDRTVLAEAARDALRDGGV |
Ga0318520_109242211 | 3300031897 | Soil | AGHMADDGYARLLASAEPGAAGDRTVLAEAARDALRDGGV |
Ga0306921_100386336 | 3300031912 | Soil | RYLAGHMADDGYAATLLPGAVVNRTVLAEAARDALRDGGV |
Ga0306921_103227481 | 3300031912 | Soil | ARYLAGHMADDGFTARLLTSAEPGAAGSRVVLAEAARDALRAAGL |
Ga0306926_118133672 | 3300031954 | Soil | YLAGHMADDGFAARLLTSAGPGEAGGRVVLAEAARDALREGGV |
Ga0318530_100580363 | 3300031959 | Soil | GVGVRARYLAGHMADDGYAATLLPGAVANRTVLAEAARDALRDGGV |
Ga0306922_112269402 | 3300032001 | Soil | DGFAARLLISAEPGEPGGRVVLAEAARDALRESGL |
Ga0318506_104277271 | 3300032052 | Soil | ARYLAGHMADDGFAARLLTSAEPGSAASRAILAEAARDALREGGL |
Ga0318575_103431642 | 3300032055 | Soil | GHMADDGYARLLASAEPGAAGDRTVLAEAARDALRDGGG |
Ga0318518_106194842 | 3300032090 | Soil | GFAATLLTSAENPDPGSAGSRAILAEAARDALRQGGP |
Ga0318518_107261172 | 3300032090 | Soil | VRARYLAGHMADDGFAARLLTSAGPGEAGGRVVLAEAARDSLREGGL |
Ga0307471_1032326501 | 3300032180 | Hardwood Forest Soil | RYLAGHMADDGFTARLLTSAESGEPGAAGGRVVLAEAARDALGAGSL |
Ga0335069_111886021 | 3300032893 | Soil | MGDDGYAARFLTSDAPGSAGSRAVLAEAARDALRGGGL |
Ga0335075_104688661 | 3300032896 | Soil | AARLAATAGPGEPGSFAGRLVLAEAARDALRDGSL |
Ga0335073_108549041 | 3300033134 | Soil | MAEDGYAARLLTPGEPGEASGRVVLAEAARDALLDPSQ |
Ga0335077_106350104 | 3300033158 | Soil | MSVADDGFAARFLTSAEPGSAGSRVVLAEAARDALRDSGL |
Ga0335077_107035171 | 3300033158 | Soil | DDGFAARFLASAGSGEPGSAGSRVVLAEAARDALRDGGL |
Ga0372943_1202793_364_489 | 3300034268 | Soil | MGDDGFAATFQPSAENPGPGTPWSRAVLAEAARDALRAGSL |
⦗Top⦘ |