| Basic Information | |
|---|---|
| Family ID | F095959 |
| Family Type | Metagenome |
| Number of Sequences | 105 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MSTKSIPLSSYQIRLLAVLALINFVNFAARQVFVPLIPLLR |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 68.57 % |
| % of genes near scaffold ends (potentially truncated) | 99.05 % |
| % of genes from short scaffolds (< 2000 bps) | 93.33 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.048 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (37.143 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.143 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.714 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.93% β-sheet: 0.00% Coil/Unstructured: 55.07% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF01594 | AI-2E_transport | 63.81 |
| PF13654 | AAA_32 | 3.81 |
| PF07690 | MFS_1 | 1.90 |
| PF13519 | VWA_2 | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 63.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.05 % |
| Unclassified | root | N/A | 0.95 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004080|Ga0062385_10498828 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 750 | Open in IMG/M |
| 3300004479|Ga0062595_102637894 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300005181|Ga0066678_10712035 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300005454|Ga0066687_10229951 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1026 | Open in IMG/M |
| 3300005471|Ga0070698_102087512 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300005537|Ga0070730_10307323 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1037 | Open in IMG/M |
| 3300005561|Ga0066699_10510952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 859 | Open in IMG/M |
| 3300005576|Ga0066708_10124203 | All Organisms → cellular organisms → Bacteria | 1560 | Open in IMG/M |
| 3300006047|Ga0075024_100685503 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300006050|Ga0075028_101056117 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300006173|Ga0070716_100279461 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1151 | Open in IMG/M |
| 3300006755|Ga0079222_10219776 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1163 | Open in IMG/M |
| 3300006755|Ga0079222_12676736 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300006796|Ga0066665_10730534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 783 | Open in IMG/M |
| 3300007258|Ga0099793_10225666 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 901 | Open in IMG/M |
| 3300007258|Ga0099793_10279761 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 808 | Open in IMG/M |
| 3300007258|Ga0099793_10528411 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300007265|Ga0099794_10158772 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1150 | Open in IMG/M |
| 3300009038|Ga0099829_11668959 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300009088|Ga0099830_11304060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300009089|Ga0099828_10124738 | All Organisms → cellular organisms → Bacteria | 2254 | Open in IMG/M |
| 3300009137|Ga0066709_102288609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
| 3300009174|Ga0105241_11617356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300009177|Ga0105248_10705359 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1138 | Open in IMG/M |
| 3300009792|Ga0126374_10530045 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 855 | Open in IMG/M |
| 3300010159|Ga0099796_10188227 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 832 | Open in IMG/M |
| 3300010325|Ga0134064_10216920 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
| 3300010337|Ga0134062_10652502 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300010361|Ga0126378_10024055 | All Organisms → cellular organisms → Bacteria | 5331 | Open in IMG/M |
| 3300010361|Ga0126378_11880525 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
| 3300011269|Ga0137392_10577795 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 933 | Open in IMG/M |
| 3300011270|Ga0137391_10590006 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 932 | Open in IMG/M |
| 3300011270|Ga0137391_11379641 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300011271|Ga0137393_10191399 | All Organisms → cellular organisms → Bacteria | 1723 | Open in IMG/M |
| 3300011271|Ga0137393_10621108 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 927 | Open in IMG/M |
| 3300011271|Ga0137393_11475397 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300012096|Ga0137389_10437206 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1119 | Open in IMG/M |
| 3300012096|Ga0137389_11092649 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300012096|Ga0137389_11472970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300012169|Ga0153990_1110285 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300012189|Ga0137388_10094155 | All Organisms → cellular organisms → Bacteria | 2557 | Open in IMG/M |
| 3300012202|Ga0137363_10604564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 926 | Open in IMG/M |
| 3300012362|Ga0137361_10255736 | All Organisms → cellular organisms → Bacteria | 1596 | Open in IMG/M |
| 3300012363|Ga0137390_11581520 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300012582|Ga0137358_10137968 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1659 | Open in IMG/M |
| 3300012683|Ga0137398_11209677 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300012685|Ga0137397_10461630 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 946 | Open in IMG/M |
| 3300012685|Ga0137397_11300808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300012918|Ga0137396_10229825 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1367 | Open in IMG/M |
| 3300012923|Ga0137359_10561673 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1003 | Open in IMG/M |
| 3300012925|Ga0137419_10092558 | All Organisms → cellular organisms → Bacteria | 2073 | Open in IMG/M |
| 3300012925|Ga0137419_10776254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 782 | Open in IMG/M |
| 3300012925|Ga0137419_11073669 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
| 3300012927|Ga0137416_10400520 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1163 | Open in IMG/M |
| 3300012927|Ga0137416_10806105 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 830 | Open in IMG/M |
| 3300012964|Ga0153916_12633943 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300014154|Ga0134075_10181896 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 902 | Open in IMG/M |
| 3300015264|Ga0137403_11123475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300016270|Ga0182036_10729192 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 803 | Open in IMG/M |
| 3300017822|Ga0187802_10145232 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 905 | Open in IMG/M |
| 3300018431|Ga0066655_10595737 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 744 | Open in IMG/M |
| 3300020021|Ga0193726_1029255 | All Organisms → cellular organisms → Bacteria | 2743 | Open in IMG/M |
| 3300020170|Ga0179594_10095774 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1062 | Open in IMG/M |
| 3300020579|Ga0210407_10805014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
| 3300020581|Ga0210399_10209227 | All Organisms → cellular organisms → Bacteria | 1623 | Open in IMG/M |
| 3300020581|Ga0210399_10398785 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1147 | Open in IMG/M |
| 3300020582|Ga0210395_10292484 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1225 | Open in IMG/M |
| 3300021086|Ga0179596_10119813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1220 | Open in IMG/M |
| 3300021180|Ga0210396_11424160 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300021403|Ga0210397_10727028 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 764 | Open in IMG/M |
| 3300021404|Ga0210389_10214210 | All Organisms → cellular organisms → Bacteria | 1503 | Open in IMG/M |
| 3300021479|Ga0210410_10511574 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1072 | Open in IMG/M |
| 3300021479|Ga0210410_11080144 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300024179|Ga0247695_1013521 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1146 | Open in IMG/M |
| 3300024283|Ga0247670_1031470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 951 | Open in IMG/M |
| 3300024283|Ga0247670_1071648 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300024288|Ga0179589_10434684 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300025915|Ga0207693_11235975 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300025929|Ga0207664_11248228 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
| 3300025935|Ga0207709_10661636 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 832 | Open in IMG/M |
| 3300025936|Ga0207670_10692833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 843 | Open in IMG/M |
| 3300026035|Ga0207703_10009006 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7859 | Open in IMG/M |
| 3300026305|Ga0209688_1094275 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300026355|Ga0257149_1005660 | All Organisms → cellular organisms → Bacteria | 1521 | Open in IMG/M |
| 3300026446|Ga0257178_1057221 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300026532|Ga0209160_1280847 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300026542|Ga0209805_1289806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300027605|Ga0209329_1125221 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300027633|Ga0208988_1055306 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1008 | Open in IMG/M |
| 3300027643|Ga0209076_1175900 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300027767|Ga0209655_10270711 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300027853|Ga0209274_10247129 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 912 | Open in IMG/M |
| 3300027869|Ga0209579_10683566 | Not Available | 556 | Open in IMG/M |
| 3300027910|Ga0209583_10322849 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300028536|Ga0137415_10311808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1377 | Open in IMG/M |
| 3300028536|Ga0137415_10521958 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 996 | Open in IMG/M |
| 3300031576|Ga0247727_10116155 | All Organisms → cellular organisms → Bacteria | 2726 | Open in IMG/M |
| 3300031779|Ga0318566_10358691 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
| 3300031820|Ga0307473_10103436 | All Organisms → cellular organisms → Bacteria | 1522 | Open in IMG/M |
| 3300031823|Ga0307478_10965556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
| 3300031823|Ga0307478_11821859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300031962|Ga0307479_10867709 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 876 | Open in IMG/M |
| 3300031981|Ga0318531_10240204 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
| 3300032091|Ga0318577_10418532 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300032895|Ga0335074_10726577 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 948 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 37.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.62% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.81% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.86% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.86% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.90% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.90% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.90% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.90% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.90% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.95% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.95% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.95% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.95% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.95% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012169 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC074 MetaG | Host-Associated | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300024179 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36 | Environmental | Open in IMG/M |
| 3300024283 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
| 3300026355 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-A | Environmental | Open in IMG/M |
| 3300026446 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-B | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062385_104988282 | 3300004080 | Bog Forest Soil | MTTEKPYSLTAYQVRLLVVLVLINFVNFAARQVFVPLIPLLRLHLGVTDA |
| Ga0062595_1026378941 | 3300004479 | Soil | MSSSPNTLSAYQYRLLAVLALINFVNFAARQVFLPLIPLLRGP |
| Ga0066678_107120352 | 3300005181 | Soil | MNSNSTSLTAYQVRLLAVLALINFVNFADRQVIVPLVPLLRDQLGV |
| Ga0066687_102299512 | 3300005454 | Soil | VSSKSSPLSSYQLRLLAVLVLVNFVNFAARFVLVPLIPMLRASLGVTDG |
| Ga0070698_1020875122 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VSSKSIPLSSYQLRLLAVLVLVNFVNFAARWVFIPLIPML |
| Ga0070730_103073232 | 3300005537 | Surface Soil | MASNSTPLTSYQFRLLAVLALINFVNFAARQVFVPLIPMLRNLLGVSD |
| Ga0066699_105109521 | 3300005561 | Soil | MSTKSIPLTSYQIRLLAVLALINFVNFAARQVFVPLIPVL |
| Ga0066708_101242031 | 3300005576 | Soil | MSSSPIPLSRYQYRLLAVLALVNFVNFADRNVFALLLPMIRLHLALTDSQLGLLQFWL |
| Ga0075024_1006855031 | 3300006047 | Watersheds | MSTKSIPLTSYQIRLLAVLALINFVNFAARQVFVPLIPLLREHFHATDAQ |
| Ga0075028_1010561172 | 3300006050 | Watersheds | MASKTIPLTSYQFRLLAVLALINFVNFADRQVVVPLLPLLRQQMG |
| Ga0070716_1002794612 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSNPTPLTKYQFRLLAVLALINFVNFAARQVMPSLVPILRAQFNISDGQ |
| Ga0079222_102197762 | 3300006755 | Agricultural Soil | MSTKSIPLTGYQIRLLAVLALINFVNFAARQVFVPLIPVLRDHLHVTDA |
| Ga0079222_126767361 | 3300006755 | Agricultural Soil | MSSNPTPLTKYQFRLLAVLALINFVNFAARQVMPSLVPILRAQ |
| Ga0066665_107305342 | 3300006796 | Soil | MSTKSIPLTSYQIRLLAVLALINFVNFAARQVFVPLIPV |
| Ga0099793_102256662 | 3300007258 | Vadose Zone Soil | SQFSMPTKSIPLTSYQIRLLAVLALINFVNFAAR* |
| Ga0099793_102797611 | 3300007258 | Vadose Zone Soil | MSTKSIPLTSYQIRLLAVLALINFVNFAARQVFVPLIP |
| Ga0099793_105284111 | 3300007258 | Vadose Zone Soil | MSTKSIPLSPYQIRLLAVLALINFVNFAARQVFVPLIP |
| Ga0099794_101587721 | 3300007265 | Vadose Zone Soil | MSTKPIPLTSYQIRLLAVLALINFVNFAARQVFVPLIPLLRDHLHVTDAE |
| Ga0099829_116689591 | 3300009038 | Vadose Zone Soil | VSSKSIPLSSYQIRLLAVLVLVNFVNFAARWVFIPLIPMLR |
| Ga0099830_113040601 | 3300009088 | Vadose Zone Soil | VPSKSIPLSSYQIRLLAVLVLVNFVNFAARWVFIP |
| Ga0099828_101247381 | 3300009089 | Vadose Zone Soil | VSSKSIPLSSYQVRLLAVLVLVNFVNFAARWVFIPLIPML |
| Ga0066709_1022886092 | 3300009137 | Grasslands Soil | MSPNPTSLSKYQFRLLAVLALINFVNFAARQVFIPLIPMLRALLG |
| Ga0105241_116173561 | 3300009174 | Corn Rhizosphere | MSSSPNTLSAYQYRLLAVLALINFVNFAARQVFVP |
| Ga0105248_107053591 | 3300009177 | Switchgrass Rhizosphere | MSSSPNTLSAYQYRLLAVLALINFVNFAARQVFVPLIPLLRGPLG |
| Ga0126374_105300451 | 3300009792 | Tropical Forest Soil | MSMKSISLTSYQVRLLAVLALVNFVNFAARQVFVPLIPLLRHHLGATDAE |
| Ga0099796_101882271 | 3300010159 | Vadose Zone Soil | MSSSSIPLSRYQYRLLAVLALVNFVNFADRQVFVPLLPLI |
| Ga0134064_102169202 | 3300010325 | Grasslands Soil | MSPNPTSLSKYQFRLLAVLALINFVNFAARQVFIPLIPMLRALLGVSDS |
| Ga0134062_106525022 | 3300010337 | Grasslands Soil | MSPNPTSLSKYQFRLLAVLALINFVNFAARQVFIPLIPMLRALLGVS |
| Ga0126378_100240551 | 3300010361 | Tropical Forest Soil | MSTKPIPLNAKQIRLLAVLALVNFVNFAARQVIAPLIPL |
| Ga0126378_118805252 | 3300010361 | Tropical Forest Soil | MSTKPIPLSAQQIRLLAVLALINFVNFAARQAVVPLIPLLRDHLHASD |
| Ga0137392_105777951 | 3300011269 | Vadose Zone Soil | MSTKSIPLSSYQVRLLAVLALINFVNFGARQVFVPLIPLLRGHL |
| Ga0137391_105900062 | 3300011270 | Vadose Zone Soil | VSSKTIPLSSYQIRLLAVLVLVNFVNFAARWVFIPLIPMLRTHLGVTDA |
| Ga0137391_113796411 | 3300011270 | Vadose Zone Soil | VSSKSIPLSPYQIRLLAVLVLVNFVNFAARWVFIPLIPML |
| Ga0137393_101913991 | 3300011271 | Vadose Zone Soil | MAQESPSLTAYQLRVLAVLALINFVNFAERGVVPPLVPLLRGEFGA |
| Ga0137393_106211082 | 3300011271 | Vadose Zone Soil | MTSIPLTSCHIRILAVLALINFVNFAARQAVIPLIPLLR |
| Ga0137393_114753971 | 3300011271 | Vadose Zone Soil | MSTKPTPLTSPLTSYQVRLLAVLALINFVNFADRQV |
| Ga0137389_104372062 | 3300012096 | Vadose Zone Soil | MSTKPTPLTSPLTSYQVRLLAVLALINFVNFADRQVIVPLVPLLR |
| Ga0137389_110926491 | 3300012096 | Vadose Zone Soil | MSTKSITLTSYQIRLLAVLALINFVNFAARQVFVPLIPLL |
| Ga0137389_114729701 | 3300012096 | Vadose Zone Soil | VSSKSIPLSSYQIRLLAVLVLVNFVNFAARWVFIPLIPMLRTHLGVTDAQ |
| Ga0153990_11102851 | 3300012169 | Attine Ant Fungus Gardens | VSSNSTPLTPYQIRLLAVLVLVNFVNFAARWVFIPLIPMLRKD |
| Ga0137388_100941553 | 3300012189 | Vadose Zone Soil | MSTKSIPLTSYQIRLLAVLALINFVNFAARQVFVPLI |
| Ga0137363_106045641 | 3300012202 | Vadose Zone Soil | MSSNPTSLTRYQFRLLAVLALINFVNFAARQVFIPL |
| Ga0137361_102557363 | 3300012362 | Vadose Zone Soil | LSSKSIPLSSYQVRLLAVLVLVNFVNFAARWVFIPLIPMLRA |
| Ga0137390_115815201 | 3300012363 | Vadose Zone Soil | MSTKSIPLTGYQIRLLAVLALLNFVNFAARQVFVPL |
| Ga0137358_101379682 | 3300012582 | Vadose Zone Soil | MSSSPIPLSRYQYRLLAVLALVNFVNFADRQVFVPLLPLIRAHLGL* |
| Ga0137398_112096771 | 3300012683 | Vadose Zone Soil | VSSKSSPLSSYQLRLLAVLVLVNFVNFAARFVLVPLIPMLRAS |
| Ga0137397_104616302 | 3300012685 | Vadose Zone Soil | MSSSPIPLSRYQYRLLAVLALVNFVNFADRQVFVPLLPLIRA |
| Ga0137397_113008081 | 3300012685 | Vadose Zone Soil | VSSKSSPLSSYQLRLLAVLVLVNFVNFAARFVLVPLIPML |
| Ga0137396_102298251 | 3300012918 | Vadose Zone Soil | MSTRSIPLTSYQIRLLAVLALINFVNFAARQVFVPLI |
| Ga0137359_105616731 | 3300012923 | Vadose Zone Soil | MSTKSIPLNSYQIRLLAVLALINFVNFAARQAVVPLIPLLRDY |
| Ga0137419_100925581 | 3300012925 | Vadose Zone Soil | MSSSPIPLSRYQYRLLAVLALVNFVNFADRQVFVPLLPLIR |
| Ga0137419_107762541 | 3300012925 | Vadose Zone Soil | LSSKSIPLSSYQVRLLAVLVLVNFVNFAARWVFIPLIPMLRAH |
| Ga0137419_110736691 | 3300012925 | Vadose Zone Soil | MSTKSIPLNSYQIRLLAVLALINFVNFAARQVFVPLIPLL |
| Ga0137416_104005202 | 3300012927 | Vadose Zone Soil | LSSKSIPLSSYQVRLLAVLVLVNFVNFAARWVFIPLIPML |
| Ga0137416_108061052 | 3300012927 | Vadose Zone Soil | MKSIPLTSCQIRILAVLALINFVNFAARQAVIPLIPLLRD |
| Ga0153916_126339431 | 3300012964 | Freshwater Wetlands | MKSSSTSLTAYQVRILVVLSLINFVNFADRQVIVPLLPILRE |
| Ga0134075_101818962 | 3300014154 | Grasslands Soil | MSTKPTPLTSPLTSYQVRLLAVLALINFVNFADRQVIVPLVPLLRA |
| Ga0137403_111234752 | 3300015264 | Vadose Zone Soil | MSSSPTPLSGYQYRLLAVLALINFVNFAARQVFVPLIPL |
| Ga0182036_107291922 | 3300016270 | Soil | MPSNSTPLTRYQFRLLAVLALINFVNFAARQVFVPLIPMLRTLL |
| Ga0187802_101452322 | 3300017822 | Freshwater Sediment | MASNSIPLSSYQIRLIAVLALINFVNFADRQVVVPLLPILRQQMNLTYAQL |
| Ga0066655_105957371 | 3300018431 | Grasslands Soil | MSTKSIPLTSYQIRLLAVLALINFVNFAARQVFVPL |
| Ga0193726_10292551 | 3300020021 | Soil | MSSSPIPLSRYQYRLLAVLALINFVNFADRQIFVPLLPLLRAHL |
| Ga0179594_100957741 | 3300020170 | Vadose Zone Soil | MSTKSIPLSSYQIRLLAVLALINFVNFAARQVFVP |
| Ga0210407_108050142 | 3300020579 | Soil | MASNPTPLSSYQIRLLAVLALINFVNFADRQVVVPLLPLLRQQMGL |
| Ga0210399_102092273 | 3300020581 | Soil | MSTKSIPLSSYQIRLLAVLALINFVNFAARQVFVPL |
| Ga0210399_103987851 | 3300020581 | Soil | MASNPTPLSSYQIRLLAVLALINFVNFADRQVVVPLLPLLRQQMGLT |
| Ga0210395_102924841 | 3300020582 | Soil | MSSKTTPLTAQQIRLLAVLALINFVNFAARQVFIPLIPLL |
| Ga0179596_101198131 | 3300021086 | Vadose Zone Soil | MSTKSIPLTSYQIRLLAVLALINFVNFAARQVFVPLIPLLRD |
| Ga0210396_114241602 | 3300021180 | Soil | MSTKSIPLSSYQIRLLAVLALINFVNFAARQAVIPLIP |
| Ga0210397_107270282 | 3300021403 | Soil | MSTKSIPLSAYQIRLLAVLALINFVNFAARQVFIPLIPLLRDHLHVT |
| Ga0210389_102142103 | 3300021404 | Soil | MASNSIPLSSYQIRLLAVLALINFVNFADRQVVVPLLPLLRQQMGLTDA |
| Ga0210410_105115741 | 3300021479 | Soil | MPKTSISLTSYQVRLLAVLALINFVNFADRQIILPLLP |
| Ga0210410_110801442 | 3300021479 | Soil | MSTKSIPLNSYQIRLLAVLALINFVNFAARQVFVPLIP |
| Ga0247695_10135211 | 3300024179 | Soil | MSSNPTPLTKYQFRLLAVLALINFVNFAARQVMPSLV |
| Ga0247670_10314701 | 3300024283 | Soil | MASNPTPLSSYQLRLLAVLALINFVNFADRQVVVPL |
| Ga0247670_10716482 | 3300024283 | Soil | MSSSPNALSSYQYRLLAVLALINFVNFAARQVFVPLIPLLRAPL |
| Ga0179589_104346842 | 3300024288 | Vadose Zone Soil | MSTKSIPLTSYQIRLLAVLALINFVNFAARQVFVPLIPLLRDH |
| Ga0207693_112359751 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSNPTPLTKYQFRLLAVLALINFVNFAARQVMPSLVPILRAQFNI |
| Ga0207664_112482281 | 3300025929 | Agricultural Soil | MSSSPIPLSRYQYRLLAVLALINFVNFAARQVMPSLVPILRAQFNISDGQ |
| Ga0207709_106616362 | 3300025935 | Miscanthus Rhizosphere | MSSSPNTLSAYQYRLLAVLALINFVNFAARQVFLPL |
| Ga0207670_106928332 | 3300025936 | Switchgrass Rhizosphere | MSSSPNTLSAYQYRLLAVLALINFVNFAARQVFVPLIPLLRGP |
| Ga0207703_100090068 | 3300026035 | Switchgrass Rhizosphere | MSSSPNTLSAYQYRLLAVLALINFVNFAARQVFVPLIPLLRGPLGATD |
| Ga0209688_10942752 | 3300026305 | Soil | MSTKPTPLNAQQMRLLAVLALINFVNFAARQAVVPLIPLLRDHLH |
| Ga0257149_10056601 | 3300026355 | Soil | MSSSPIPLSRYQYRLLAVLALVNFVNFADRQVFVPLLPLI |
| Ga0257178_10572211 | 3300026446 | Soil | VSSKSIPLSSYQLRLLAVLVLVNFVNFAARWIFIPLIPMLRGHLGV |
| Ga0209160_12808471 | 3300026532 | Soil | MSTKSIPLTSYQIRLLAVLALINFVNFAARQVFVPLIPLLRDHLHVTDAE |
| Ga0209805_12898062 | 3300026542 | Soil | MSTKSIPLTSYQIRLLAVLALINFVNFAARQAVVPLIPLLRDYFHPTD |
| Ga0209329_11252211 | 3300027605 | Forest Soil | VPSKSIQLSSYQLRLLAVLVLVNFVNFAARWVFIPLIPMLRNDLGIT |
| Ga0208988_10553062 | 3300027633 | Forest Soil | MSTKSIPLTSYQIRLLAVLALINFVNFAARQAVIPL |
| Ga0209076_11759002 | 3300027643 | Vadose Zone Soil | VQSKSIPLNSYQLRLLAVLVLVNFVNFAARFVLVPLIPMLCA |
| Ga0209655_102707112 | 3300027767 | Bog Forest Soil | MASNPTPLSSYQIRLLAVLALINFVNFADRQVVVPLLPLLRQQMNLS |
| Ga0209274_102471291 | 3300027853 | Soil | MASNPTPLSSYQIRLLAVLALINFVNFADRQVVVPLLPLL |
| Ga0209579_106835661 | 3300027869 | Surface Soil | MASNPTPLSSYQIRLLAVLALINFVNFADRTVVVPLLPLLRLQMNLT |
| Ga0209583_103228491 | 3300027910 | Watersheds | MEPQSIRLTPYQFRLLAVLALVNFVNFADRQVVVPLLPL |
| Ga0137415_103118082 | 3300028536 | Vadose Zone Soil | MSMKSIPLTSCQIRILAVLALINFVNFAARQAVIPLIPLLRD |
| Ga0137415_105219581 | 3300028536 | Vadose Zone Soil | MSTKSIPLSSYQIRLLAVLALINFVNFAARQVFVPLIPLLR |
| Ga0247727_101161553 | 3300031576 | Biofilm | MEATQSSGISLDRYQFRLLAILAVINFVNFADRLVVPPLV |
| Ga0318566_103586911 | 3300031779 | Soil | MSSSPNALSAYQYRLLAVLALINFVNFAARQVFVPLIPLLRAPLGA |
| Ga0307473_101034361 | 3300031820 | Hardwood Forest Soil | MSSSSNTLSAYQYRLLAVLALINFVNFAARQVFVPLIPLLRGPLGATD |
| Ga0307478_109655561 | 3300031823 | Hardwood Forest Soil | MSAKANPLTVYQIRLLVVLVLINFVNFAARQIFVPLIPLLRVHLNVS |
| Ga0307478_118218592 | 3300031823 | Hardwood Forest Soil | MSSSPNSLSSYQYRLLAVLALINFVNFAARQVFVPL |
| Ga0307479_108677092 | 3300031962 | Hardwood Forest Soil | MASKPIPLTSYQFRLLAVLALVNFVNFADRQVVVPLLPLLRHEMGVTDA |
| Ga0318531_102402042 | 3300031981 | Soil | MSSSPNALSAYQYRLLAVLALINFVNFAARQVFVPLIPLLRAPLGATDD |
| Ga0318577_104185322 | 3300032091 | Soil | MSSSPNALSAYQYRLLAVLALINFVNFAARQVFVPLIPLLRAPLG |
| Ga0335074_107265772 | 3300032895 | Soil | MASNPTPLSAYQLRLLAVLALINFVNFADRQVVVPLLPLLRQQMNVTDAQL |
| ⦗Top⦘ |