| Basic Information | |
|---|---|
| Family ID | F095952 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 37 residues |
| Representative Sequence | LKQGVGRVRILPAAEAEALPQFYLTKLNCGTEVTCA |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 91.43 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (63.810 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil (8.571 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.952 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.238 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 9.38% β-sheet: 18.75% Coil/Unstructured: 71.88% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF00202 | Aminotran_3 | 55.24 |
| PF02729 | OTCace_N | 36.19 |
| PF00764 | Arginosuc_synth | 1.90 |
| PF07690 | MFS_1 | 0.95 |
| PF00291 | PALP | 0.95 |
| PF01960 | ArgJ | 0.95 |
| PF00158 | Sigma54_activat | 0.95 |
| PF14698 | ASL_C2 | 0.95 |
| PF00583 | Acetyltransf_1 | 0.95 |
| PF13508 | Acetyltransf_7 | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG0137 | Argininosuccinate synthase | Amino acid transport and metabolism [E] | 1.90 |
| COG1364 | Glutamate N-acetyltransferase (ornithine transacetylase) | Amino acid transport and metabolism [E] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.81 % |
| Unclassified | root | N/A | 36.19 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001867|JGI12627J18819_10498445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 501 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100463605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1144 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101654632 | Not Available | 538 | Open in IMG/M |
| 3300004091|Ga0062387_100422201 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 906 | Open in IMG/M |
| 3300004114|Ga0062593_101570505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 712 | Open in IMG/M |
| 3300005166|Ga0066674_10254861 | Not Available | 831 | Open in IMG/M |
| 3300005434|Ga0070709_11206393 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 608 | Open in IMG/M |
| 3300005542|Ga0070732_10558607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 694 | Open in IMG/M |
| 3300005561|Ga0066699_10633458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 767 | Open in IMG/M |
| 3300005566|Ga0066693_10442777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 531 | Open in IMG/M |
| 3300005598|Ga0066706_11031260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 632 | Open in IMG/M |
| 3300005610|Ga0070763_10003935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5593 | Open in IMG/M |
| 3300005841|Ga0068863_100210419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1873 | Open in IMG/M |
| 3300006032|Ga0066696_10477900 | Not Available | 818 | Open in IMG/M |
| 3300006046|Ga0066652_101878038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 538 | Open in IMG/M |
| 3300006086|Ga0075019_10785870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 606 | Open in IMG/M |
| 3300006173|Ga0070716_100456725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 146 | 932 | Open in IMG/M |
| 3300006573|Ga0074055_11623779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 765 | Open in IMG/M |
| 3300006794|Ga0066658_10847020 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 520 | Open in IMG/M |
| 3300009012|Ga0066710_100378690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2102 | Open in IMG/M |
| 3300009038|Ga0099829_11363350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 586 | Open in IMG/M |
| 3300009088|Ga0099830_11744696 | Not Available | 520 | Open in IMG/M |
| 3300009093|Ga0105240_12380860 | Not Available | 548 | Open in IMG/M |
| 3300009143|Ga0099792_10237404 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| 3300009525|Ga0116220_10046808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPHIGHO2_02_FULL_67_57 | 1798 | Open in IMG/M |
| 3300009525|Ga0116220_10409883 | Not Available | 607 | Open in IMG/M |
| 3300009545|Ga0105237_10959987 | Not Available | 862 | Open in IMG/M |
| 3300009640|Ga0116126_1172470 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 711 | Open in IMG/M |
| 3300009764|Ga0116134_1099451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 1054 | Open in IMG/M |
| 3300010048|Ga0126373_11769303 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300010321|Ga0134067_10218154 | Not Available | 707 | Open in IMG/M |
| 3300010358|Ga0126370_10345813 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
| 3300010358|Ga0126370_11909736 | Not Available | 578 | Open in IMG/M |
| 3300010371|Ga0134125_10421216 | Not Available | 1481 | Open in IMG/M |
| 3300010379|Ga0136449_101835465 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300010398|Ga0126383_10312823 | Not Available | 1574 | Open in IMG/M |
| 3300010401|Ga0134121_10695975 | Not Available | 963 | Open in IMG/M |
| 3300011110|Ga0138578_1173090 | Not Available | 544 | Open in IMG/M |
| 3300012209|Ga0137379_10187509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1981 | Open in IMG/M |
| 3300012212|Ga0150985_121222703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 846 | Open in IMG/M |
| 3300012362|Ga0137361_10641897 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300012923|Ga0137359_11151401 | Not Available | 662 | Open in IMG/M |
| 3300012925|Ga0137419_10413706 | Not Available | 1056 | Open in IMG/M |
| 3300012958|Ga0164299_10911279 | Not Available | 639 | Open in IMG/M |
| 3300012958|Ga0164299_11467447 | Not Available | 530 | Open in IMG/M |
| 3300013297|Ga0157378_12234574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 598 | Open in IMG/M |
| 3300014493|Ga0182016_10731047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 554 | Open in IMG/M |
| 3300014502|Ga0182021_13183093 | Not Available | 548 | Open in IMG/M |
| 3300016294|Ga0182041_10213544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1545 | Open in IMG/M |
| 3300017933|Ga0187801_10439197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300017943|Ga0187819_10446646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_55_7 | 740 | Open in IMG/M |
| 3300017972|Ga0187781_10121304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1823 | Open in IMG/M |
| 3300017993|Ga0187823_10316492 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300018046|Ga0187851_10369999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 823 | Open in IMG/M |
| 3300018086|Ga0187769_10530590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 889 | Open in IMG/M |
| 3300020580|Ga0210403_10636139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 859 | Open in IMG/M |
| 3300021178|Ga0210408_11280145 | Not Available | 557 | Open in IMG/M |
| 3300021344|Ga0193719_10023825 | All Organisms → cellular organisms → Bacteria | 2619 | Open in IMG/M |
| 3300021407|Ga0210383_11210231 | Not Available | 634 | Open in IMG/M |
| 3300021478|Ga0210402_11735879 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300021479|Ga0210410_10129924 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2238 | Open in IMG/M |
| 3300023019|Ga0224560_100067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5086 | Open in IMG/M |
| 3300025442|Ga0208034_1032390 | Not Available | 1245 | Open in IMG/M |
| 3300025906|Ga0207699_11179969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 567 | Open in IMG/M |
| 3300025914|Ga0207671_11265176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300025927|Ga0207687_10045316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3039 | Open in IMG/M |
| 3300025928|Ga0207700_11482291 | Not Available | 602 | Open in IMG/M |
| 3300025939|Ga0207665_10517503 | Not Available | 924 | Open in IMG/M |
| 3300026116|Ga0207674_12213484 | Not Available | 513 | Open in IMG/M |
| 3300026142|Ga0207698_10276121 | Not Available | 1552 | Open in IMG/M |
| 3300026275|Ga0209901_1049922 | Not Available | 928 | Open in IMG/M |
| 3300026514|Ga0257168_1084774 | Not Available | 703 | Open in IMG/M |
| 3300027158|Ga0208725_1040892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 713 | Open in IMG/M |
| 3300027521|Ga0209524_1120367 | Not Available | 548 | Open in IMG/M |
| 3300027570|Ga0208043_1091087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 834 | Open in IMG/M |
| 3300027575|Ga0209525_1046047 | Not Available | 1066 | Open in IMG/M |
| 3300027635|Ga0209625_1068813 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 792 | Open in IMG/M |
| 3300027667|Ga0209009_1172268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 550 | Open in IMG/M |
| 3300027745|Ga0209908_10000407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3910 | Open in IMG/M |
| 3300027854|Ga0209517_10333092 | Not Available | 875 | Open in IMG/M |
| 3300027867|Ga0209167_10107540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1432 | Open in IMG/M |
| 3300027884|Ga0209275_10020896 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2927 | Open in IMG/M |
| 3300027905|Ga0209415_11013712 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300028047|Ga0209526_10752887 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 608 | Open in IMG/M |
| 3300028788|Ga0302189_10153262 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 994 | Open in IMG/M |
| 3300029989|Ga0311365_10235632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1577 | Open in IMG/M |
| 3300030049|Ga0302191_10339903 | Not Available | 549 | Open in IMG/M |
| 3300030503|Ga0311370_12321281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 522 | Open in IMG/M |
| 3300031122|Ga0170822_11209621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 732 | Open in IMG/M |
| 3300031261|Ga0302140_10810112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 667 | Open in IMG/M |
| 3300031525|Ga0302326_11022560 | Not Available | 1158 | Open in IMG/M |
| 3300031718|Ga0307474_11321366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300031753|Ga0307477_10385299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 961 | Open in IMG/M |
| 3300031754|Ga0307475_11460456 | Not Available | 526 | Open in IMG/M |
| 3300031792|Ga0318529_10146528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 1084 | Open in IMG/M |
| 3300031823|Ga0307478_10516402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 996 | Open in IMG/M |
| 3300031962|Ga0307479_10966581 | Not Available | 822 | Open in IMG/M |
| 3300032001|Ga0306922_11982660 | Not Available | 568 | Open in IMG/M |
| 3300032042|Ga0318545_10389400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 503 | Open in IMG/M |
| 3300032160|Ga0311301_12064747 | Not Available | 662 | Open in IMG/M |
| 3300032805|Ga0335078_10116595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3827 | Open in IMG/M |
| 3300032892|Ga0335081_10524702 | Not Available | 1483 | Open in IMG/M |
| 3300032955|Ga0335076_11271260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 620 | Open in IMG/M |
| 3300033513|Ga0316628_100850218 | Not Available | 1205 | Open in IMG/M |
| 3300034282|Ga0370492_0450160 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.57% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.62% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.67% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.81% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.86% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.86% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.86% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.90% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.90% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.90% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.90% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.95% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.95% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.95% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.95% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.95% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.95% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.95% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.95% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.95% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.95% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011110 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 65 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300023019 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU1 | Environmental | Open in IMG/M |
| 3300025442 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026275 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058 (SPAdes) | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300027158 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030049 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_1 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12627J18819_104984452 | 3300001867 | Forest Soil | RALKEGVGRVRILPAAEAEALPQFYLMKLNCGTEVTCA* |
| JGIcombinedJ26739_1004636051 | 3300002245 | Forest Soil | GLALKQGVGRVRILPATEVEMLPQFYLTKLSCGTEVTYS* |
| JGIcombinedJ26739_1016546321 | 3300002245 | Forest Soil | LKSGVGRVRILPAAQVEMLPLFYFTKLECGTEVLRA* |
| Ga0062387_1004222012 | 3300004091 | Bog Forest Soil | TQALHKGVGRVRILPAAQVEILPQFYFTKMACGTEVIGA* |
| Ga0062593_1015705052 | 3300004114 | Soil | LEACKQALKKGVGRVRIMPAAQEEVLPQFYFTKMECGTEVLGA* |
| Ga0066674_102548611 | 3300005166 | Soil | ACGQALKKGVSRVRILPAAHAEELPLFYFTKLHYGTEVTAV* |
| Ga0070709_112063932 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | RQALKQGVGRVRILPAAEAEALPQFYLTKLNCGTEVTCA* |
| Ga0070732_105586072 | 3300005542 | Surface Soil | KQGVGRVRILPAAEAEALPQFYLTKLNCGTEVTCA* |
| Ga0066699_106334581 | 3300005561 | Soil | HALHHGVGRVRILPAEQVHMLSQFYFSKLDCGTEVLVA* |
| Ga0066693_104427772 | 3300005566 | Soil | LRGGVNRVRILPANDIDALPDFYFTRVEAGTEVFA* |
| Ga0066706_110312602 | 3300005598 | Soil | ACGHALKRGVGRVRIVPAARAEILPQFYFAKLGCGTEVIVA* |
| Ga0070763_100039358 | 3300005610 | Soil | KHGVGRVRILPAAEAEALPQFYLTKLNCGTEVTCA* |
| Ga0068863_1002104191 | 3300005841 | Switchgrass Rhizosphere | NGVDRVRILPAAQAEMLHDFYLTRVDCGTEVMVA* |
| Ga0066696_104779001 | 3300006032 | Soil | ALRRGVGRVRILPAAQAEILSQFYFQKLEFGTEVIGA* |
| Ga0066652_1018780381 | 3300006046 | Soil | KHGVNRVRILPAAQAEILPLFYFAKLECGTEVLRA* |
| Ga0075019_107858701 | 3300006086 | Watersheds | QALRQGVGRVRILPAAEAEALPQFYLTKLNCGTEVTCA* |
| Ga0070716_1004567252 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | QALRKGVGRVRILPAAQADTLPQFYLTKLDGGTEVTVT* |
| Ga0074055_116237792 | 3300006573 | Soil | ALLHGVDRVRILPAAEVEALPEFYFTKIDSGTELLVA* |
| Ga0066658_108470202 | 3300006794 | Soil | RSKGVGRVRILPAAEADVLPQFYFAKLLAGTEVRVA* |
| Ga0066710_1003786901 | 3300009012 | Grasslands Soil | ALKKGVGRVRILPAAQAEILPQFYFTKLECGTEVTA |
| Ga0099829_113633502 | 3300009038 | Vadose Zone Soil | QALKQGVGRVRILPAAEAEALPQFYLTKLNCGTEVTCA* |
| Ga0099830_117446961 | 3300009088 | Vadose Zone Soil | KLEACGHALKRGVGRVRILPAAQAEILPQFYFAKL* |
| Ga0105240_123808601 | 3300009093 | Corn Rhizosphere | KRGVGRVRILPAAQAQLLPQFYFEKLEFGTEVIGA* |
| Ga0099792_102374042 | 3300009143 | Vadose Zone Soil | QEALRRGVPRVRILPAAQVESLPQLYVSKIDHGTEVLVA* |
| Ga0116220_100468081 | 3300009525 | Peatlands Soil | KSGVGRVRILPAAQVEMLPLFYFTKLECGTEVLRA* |
| Ga0116220_104098832 | 3300009525 | Peatlands Soil | CQHALRSGVGRVSILPAAHSEMLPELCFSRIDLGTEVMLA* |
| Ga0105237_109599871 | 3300009545 | Corn Rhizosphere | KGVRRVRILPAAQAEILPQFYFQKLEYGTEVIGA* |
| Ga0116126_11724701 | 3300009640 | Peatland | CGLALKQGVGRVRILPANEVEVLPQFYLTKLSCGTEVTHS* |
| Ga0116134_10994511 | 3300009764 | Peatland | KQGVGRVRILPAAEVEMLPQFYLTKLSCGTEVTYS* |
| Ga0126373_117693031 | 3300010048 | Tropical Forest Soil | KGVGRVRILPAAQAEVLPQFYFEKIEFGTEVIAR* |
| Ga0134067_102181542 | 3300010321 | Grasslands Soil | KRGVGRVRILPAAQAEILPQFYFQKLEFGTEVIGA* |
| Ga0126370_103458131 | 3300010358 | Tropical Forest Soil | KQALRKGVGRVRILPASEADELPAFYFSKLEHGTEVCVA* |
| Ga0126370_119097362 | 3300010358 | Tropical Forest Soil | LLRGVNRVRILPANEVEALPQFYFTRIESGTEVLVA* |
| Ga0134125_104212163 | 3300010371 | Terrestrial Soil | LLRGVNRVRILPAAEVEALPEFYFAKIESGTEVLVA* |
| Ga0136449_1018354652 | 3300010379 | Peatlands Soil | DALRSGVGRVRILPAAEAEVLPGFYHSRIESGTEVMA* |
| Ga0126383_103128233 | 3300010398 | Tropical Forest Soil | LMRGVNRVRILPAEQVEALPEFYTMRIESGTEVLVA* |
| Ga0134121_106959751 | 3300010401 | Terrestrial Soil | KGVGRVRILPAAQADALPQFYLTRLDGGTEVIVA* |
| Ga0138578_11730901 | 3300011110 | Peatlands Soil | SGVGRVRILPAAHSEMLPELCFSRIDLGTEVMLA* |
| Ga0137379_101875093 | 3300012209 | Vadose Zone Soil | LKQGVGRVRILPAAEAEALPQFYLTKLNCGTEVTCA* |
| Ga0150985_1212227032 | 3300012212 | Avena Fatua Rhizosphere | AWKQGVGRVRILPAAEADALPQFYLTKLTCGTEVTCV* |
| Ga0137361_106418972 | 3300012362 | Vadose Zone Soil | LKCGVGRVRILPAAQVEMLPLFYFAKLECGTEVLRA* |
| Ga0137359_111514011 | 3300012923 | Vadose Zone Soil | MEACTEALKRGVGRVSILPAAQVEMLTLFYFTKLECGTEVLRA* |
| Ga0137419_104137062 | 3300012925 | Vadose Zone Soil | QALKSGVGRVRILPASQVEMLPVVYFTKLECGTEVLRA* |
| Ga0164299_109112791 | 3300012958 | Soil | KRGVGRVRILPAAQAEALPQFYFQKLDYGTEVIGA* |
| Ga0164299_114674472 | 3300012958 | Soil | LLHGVNRVRILPAAEVEALPEFYFAKIESGTEVLVA* |
| Ga0157378_122345742 | 3300013297 | Miscanthus Rhizosphere | QALKQGVGRVRILPAAEAESLPQFYLTKLNCGTEVTCA* |
| Ga0182016_107310471 | 3300014493 | Bog | ALKQGVGRVRIFPANEAEILPQFYLTKLSCGTEVTYS* |
| Ga0182021_131830931 | 3300014502 | Fen | RGVGRVRILPAVQADVLPQFYFTKLECGTEVIVA* |
| Ga0182041_102135443 | 3300016294 | Soil | ALKEGVGRVRILPAAEAEALPQFYLMKLNCGTEVTCA |
| Ga0187801_104391971 | 3300017933 | Freshwater Sediment | KRGVGRVRILPASQADKLPLFYFTKIECGTEVLRA |
| Ga0187819_104466461 | 3300017943 | Freshwater Sediment | IQALKRGVGRVRILPAAQVEVLPLFYFTRIECGTEVLRA |
| Ga0187781_101213043 | 3300017972 | Tropical Peatland | TEALHKGVKRVRILPAAQAEALPQIHLTRLECGTEVIRA |
| Ga0187823_103164921 | 3300017993 | Freshwater Sediment | GQALKRGVGRVRILPAAQAEVLGEFYFSKLECGTEVIGP |
| Ga0187851_103699993 | 3300018046 | Peatland | DALRSGVGRVRILPAAEAEVLPGFYHSRIEAGTEVMAQ |
| Ga0187769_105305902 | 3300018086 | Tropical Peatland | PKLQAAKRALQQGVGRVRIFPSSNADALPQFYLTKIECGTEVISR |
| Ga0210403_106361392 | 3300020580 | Soil | QALKQGVGRVRILPDTEAEVLPQFYMTKLSCGTEVTYS |
| Ga0210408_112801452 | 3300021178 | Soil | KLEACSQALHKGVGRVRILPAAQAGSLSEFYFSRNPWGTEVTSA |
| Ga0193719_100238251 | 3300021344 | Soil | KHGVTRVRILPAAQADILPLFYFAKLECGTEVLRT |
| Ga0210383_112102312 | 3300021407 | Soil | ALNKGVGRVRILPAAQAEVLSQFYFTKLPCGTEVTCA |
| Ga0210402_117358792 | 3300021478 | Soil | EACTQALHKGVGRVRILPAAQAEGLSDFYFTSLPWGTEVTA |
| Ga0210410_101299243 | 3300021479 | Soil | ALRKGVGRVRIFPATQAEILPQFYFAKLDCGTEVIGV |
| Ga0224560_1000671 | 3300023019 | Soil | KQGVGRVRILPAIEAEVLPQFYLTKLSCGTEVTYS |
| Ga0208034_10323901 | 3300025442 | Peatland | TQALKCGVGRVRILPAAQVEFLPLFYFAKLECGTEVLRA |
| Ga0207699_111799692 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | RQALKQGVGRVRILPAAEAEALPQFYLTKLNCGTEVTCA |
| Ga0207671_112651762 | 3300025914 | Corn Rhizosphere | ALKKGVARVRILPAAQAEILAQFYFTKLECGTEVIGA |
| Ga0207687_100453161 | 3300025927 | Miscanthus Rhizosphere | QALKKGVGRVRIMPAAQAEVLPQFYFTKMECGTEVLGA |
| Ga0207700_114822911 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LLHGVNRVRILPAAEVEALPEFYFAKIESGTEVLVA |
| Ga0207665_105175032 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LKRGVGRVRILPASQAETLPQFYLTKLYGGTEVTVA |
| Ga0207674_122134842 | 3300026116 | Corn Rhizosphere | KRGVGRVRILPAAQAQVLPQFYFQKLEYGTEVIGA |
| Ga0207698_102761211 | 3300026142 | Corn Rhizosphere | KRGVGRVRILPAAQAQVLPQFYFQKLELGTEVIGA |
| Ga0209901_10499221 | 3300026275 | Permafrost Soil | ALMHGVNRVRILPAAEVEALPGFYVTKIESGTEVLVA |
| Ga0257168_10847742 | 3300026514 | Soil | RKGVGRVRILPAVQADTLPQFYLTRLDGGTEVIVA |
| Ga0208725_10408921 | 3300027158 | Forest Soil | LKQGVGRVRILPANEAEILPQFYLTKLSCGTEVTYS |
| Ga0209524_11203671 | 3300027521 | Forest Soil | ALRKGVGRVRILPAVQADTLPQFYLTKLDGGTEVICA |
| Ga0208043_10910871 | 3300027570 | Peatlands Soil | QHALRSGVGRVRILPAAHSEMLPELCFSRIDLGTEVMLA |
| Ga0209525_10460472 | 3300027575 | Forest Soil | ALKSGVGRVRILPASQVEMLPLFYFTKLECGTEVLRA |
| Ga0209625_10688131 | 3300027635 | Forest Soil | KRALKQGVGRVRILPAAEAEALPQFYLTKLPCGTEVTCA |
| Ga0209009_11722682 | 3300027667 | Forest Soil | KQALKQGVGRVRILPAAEAEALPQFYLTKLNCGTEVTCA |
| Ga0209908_100004071 | 3300027745 | Thawing Permafrost | LKQGVGRVRIFPANEAEVLPQFYLTKLSCGTEVTYS |
| Ga0209517_103330922 | 3300027854 | Peatlands Soil | LRSGVGRVRILPAAHSEMLPELCFSRIDLGTEVMLA |
| Ga0209167_101075403 | 3300027867 | Surface Soil | ALRQGVKRVRILPTAEVERLPQFYLTKLSCGTEVTHS |
| Ga0209275_100208964 | 3300027884 | Soil | ALKSGVGRVRILPAAQVEMLPLFYFARLECGTEVLRA |
| Ga0209415_110137121 | 3300027905 | Peatlands Soil | ALKQGVGRVRILPATEVEALPQFYLTKLSCGTEVTHS |
| Ga0209526_107528871 | 3300028047 | Forest Soil | GLALKQGVGRVRILPATEVEMLPQFYLTKLSCGTEVTYS |
| Ga0302189_101532621 | 3300028788 | Bog | KLQACGQALKQGVGRVRIFPANEAEILPQFYLTKLSCGTEVTYS |
| Ga0311365_102356321 | 3300029989 | Fen | QALKRGVGRVRILPSAQAEVLPLFYFERIDCGTEVLRA |
| Ga0302191_103399032 | 3300030049 | Bog | TQALKSGVGRVRILPASQVEVLPLFYFTKIECGTEVLRA |
| Ga0311370_123212812 | 3300030503 | Palsa | CELALKQGVRRVRILPTAEVERLPQFYLTKLSCGTEVTYS |
| Ga0170822_112096212 | 3300031122 | Forest Soil | LKQGVGRVRILPATEAEVLPQFYLTKLSCGTEVTCS |
| Ga0302140_108101122 | 3300031261 | Bog | LHACGQALKQGVGRVRIFPANEAEILPQFYLTKLSCGTEVTYS |
| Ga0302326_110225602 | 3300031525 | Palsa | ALRKGVGRVRILPAAQAEILPQFYFTKLECGTEVIGA |
| Ga0307474_113213661 | 3300031718 | Hardwood Forest Soil | KSGVGRVRILPAAQVEMLPLFYFTKLDCGTEVLRA |
| Ga0307477_103852991 | 3300031753 | Hardwood Forest Soil | LSKGVGRVRILPAAEADVLPQFYFAKLQMGTEVRAS |
| Ga0307475_114604561 | 3300031754 | Hardwood Forest Soil | ALHRGVGRVRILPAAQVEILPQFYFTKLDCGTEVIGA |
| Ga0318529_101465281 | 3300031792 | Soil | SKGVGRVKILPASEADVLPQFYFAKLALGTEVRVA |
| Ga0307478_105164021 | 3300031823 | Hardwood Forest Soil | ALKQGVGRVRILPATEVETLPQFYLTKLTCGTEVTCA |
| Ga0307479_109665811 | 3300031962 | Hardwood Forest Soil | QALLQGVNRVRILPAAEVEILPQFYFSKIESGTEVSVA |
| Ga0306922_119826602 | 3300032001 | Soil | NALLRGVNRVRILPAAEVDALPEFYSTRIESGTEVLVA |
| Ga0318545_103894001 | 3300032042 | Soil | LKEGVGRVRILPAAEAEALPQFYLMKLNCGTEVTCA |
| Ga0311301_120647471 | 3300032160 | Peatlands Soil | LRSGVGRVRILPAAEAEVLPGFYHSRIESGTEVMA |
| Ga0335078_101165951 | 3300032805 | Soil | ALKRGVSRVRILPAAHAEILPQFFFTKLECGTEVITA |
| Ga0335081_105247021 | 3300032892 | Soil | ACAQALKKGVGRVKIMPAEQAQVLPQFYFTKLECGTEVLGA |
| Ga0335076_112712601 | 3300032955 | Soil | QALKQGVGRVRILPAAEAEALPQFYLTKLNCGTEVTCA |
| Ga0316628_1008502181 | 3300033513 | Soil | LLHGVNRVRILPAVEVEALPEFYFTKIESGTEVLVA |
| Ga0370492_0450160_405_521 | 3300034282 | Untreated Peat Soil | KALKQGVGRVRILPAAEVEALPQFYRTKLPCGTEVTCA |
| ⦗Top⦘ |