NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F095952

Metagenome / Metatranscriptome Family F095952

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F095952
Family Type Metagenome / Metatranscriptome
Number of Sequences 105
Average Sequence Length 37 residues
Representative Sequence LKQGVGRVRILPAAEAEALPQFYLTKLNCGTEVTCA
Number of Associated Samples 101
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 91.43 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction Yes
3D model pTM-score0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (63.810 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil
(8.571 % of family members)
Environment Ontology (ENVO) Unclassified
(20.952 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(55.238 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 9.38%    β-sheet: 18.75%    Coil/Unstructured: 71.88%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.32
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF00202Aminotran_3 55.24
PF02729OTCace_N 36.19
PF00764Arginosuc_synth 1.90
PF07690MFS_1 0.95
PF00291PALP 0.95
PF01960ArgJ 0.95
PF00158Sigma54_activat 0.95
PF14698ASL_C2 0.95
PF00583Acetyltransf_1 0.95
PF13508Acetyltransf_7 0.95

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 105 Family Scaffolds
COG0137Argininosuccinate synthaseAmino acid transport and metabolism [E] 1.90
COG1364Glutamate N-acetyltransferase (ornithine transacetylase)Amino acid transport and metabolism [E] 0.95

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms63.81 %
UnclassifiedrootN/A36.19 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001867|JGI12627J18819_10498445All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis501Open in IMG/M
3300002245|JGIcombinedJ26739_100463605All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1144Open in IMG/M
3300002245|JGIcombinedJ26739_101654632Not Available538Open in IMG/M
3300004091|Ga0062387_100422201All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae906Open in IMG/M
3300004114|Ga0062593_101570505All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae712Open in IMG/M
3300005166|Ga0066674_10254861Not Available831Open in IMG/M
3300005434|Ga0070709_11206393All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae608Open in IMG/M
3300005542|Ga0070732_10558607All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter694Open in IMG/M
3300005561|Ga0066699_10633458All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae767Open in IMG/M
3300005566|Ga0066693_10442777All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae531Open in IMG/M
3300005598|Ga0066706_11031260All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae632Open in IMG/M
3300005610|Ga0070763_10003935All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5593Open in IMG/M
3300005841|Ga0068863_100210419All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1873Open in IMG/M
3300006032|Ga0066696_10477900Not Available818Open in IMG/M
3300006046|Ga0066652_101878038All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae538Open in IMG/M
3300006086|Ga0075019_10785870All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae606Open in IMG/M
3300006173|Ga0070716_100456725All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 146932Open in IMG/M
3300006573|Ga0074055_11623779All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae765Open in IMG/M
3300006794|Ga0066658_10847020All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae520Open in IMG/M
3300009012|Ga0066710_100378690All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2102Open in IMG/M
3300009038|Ga0099829_11363350All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7586Open in IMG/M
3300009088|Ga0099830_11744696Not Available520Open in IMG/M
3300009093|Ga0105240_12380860Not Available548Open in IMG/M
3300009143|Ga0099792_10237404All Organisms → cellular organisms → Bacteria1055Open in IMG/M
3300009525|Ga0116220_10046808All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPHIGHO2_02_FULL_67_571798Open in IMG/M
3300009525|Ga0116220_10409883Not Available607Open in IMG/M
3300009545|Ga0105237_10959987Not Available862Open in IMG/M
3300009640|Ga0116126_1172470All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7711Open in IMG/M
3300009764|Ga0116134_1099451All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_71054Open in IMG/M
3300010048|Ga0126373_11769303All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300010321|Ga0134067_10218154Not Available707Open in IMG/M
3300010358|Ga0126370_10345813All Organisms → cellular organisms → Bacteria1200Open in IMG/M
3300010358|Ga0126370_11909736Not Available578Open in IMG/M
3300010371|Ga0134125_10421216Not Available1481Open in IMG/M
3300010379|Ga0136449_101835465All Organisms → cellular organisms → Bacteria905Open in IMG/M
3300010398|Ga0126383_10312823Not Available1574Open in IMG/M
3300010401|Ga0134121_10695975Not Available963Open in IMG/M
3300011110|Ga0138578_1173090Not Available544Open in IMG/M
3300012209|Ga0137379_10187509All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1981Open in IMG/M
3300012212|Ga0150985_121222703All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7846Open in IMG/M
3300012362|Ga0137361_10641897All Organisms → cellular organisms → Bacteria972Open in IMG/M
3300012923|Ga0137359_11151401Not Available662Open in IMG/M
3300012925|Ga0137419_10413706Not Available1056Open in IMG/M
3300012958|Ga0164299_10911279Not Available639Open in IMG/M
3300012958|Ga0164299_11467447Not Available530Open in IMG/M
3300013297|Ga0157378_12234574All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7598Open in IMG/M
3300014493|Ga0182016_10731047All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7554Open in IMG/M
3300014502|Ga0182021_13183093Not Available548Open in IMG/M
3300016294|Ga0182041_10213544All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1545Open in IMG/M
3300017933|Ga0187801_10439197All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium546Open in IMG/M
3300017943|Ga0187819_10446646All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_55_7740Open in IMG/M
3300017972|Ga0187781_10121304All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1823Open in IMG/M
3300017993|Ga0187823_10316492All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300018046|Ga0187851_10369999All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium823Open in IMG/M
3300018086|Ga0187769_10530590All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7889Open in IMG/M
3300020580|Ga0210403_10636139All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7859Open in IMG/M
3300021178|Ga0210408_11280145Not Available557Open in IMG/M
3300021344|Ga0193719_10023825All Organisms → cellular organisms → Bacteria2619Open in IMG/M
3300021407|Ga0210383_11210231Not Available634Open in IMG/M
3300021478|Ga0210402_11735879All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300021479|Ga0210410_10129924All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2238Open in IMG/M
3300023019|Ga0224560_100067All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5086Open in IMG/M
3300025442|Ga0208034_1032390Not Available1245Open in IMG/M
3300025906|Ga0207699_11179969All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7567Open in IMG/M
3300025914|Ga0207671_11265176All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium575Open in IMG/M
3300025927|Ga0207687_10045316All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3039Open in IMG/M
3300025928|Ga0207700_11482291Not Available602Open in IMG/M
3300025939|Ga0207665_10517503Not Available924Open in IMG/M
3300026116|Ga0207674_12213484Not Available513Open in IMG/M
3300026142|Ga0207698_10276121Not Available1552Open in IMG/M
3300026275|Ga0209901_1049922Not Available928Open in IMG/M
3300026514|Ga0257168_1084774Not Available703Open in IMG/M
3300027158|Ga0208725_1040892All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7713Open in IMG/M
3300027521|Ga0209524_1120367Not Available548Open in IMG/M
3300027570|Ga0208043_1091087All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium834Open in IMG/M
3300027575|Ga0209525_1046047Not Available1066Open in IMG/M
3300027635|Ga0209625_1068813All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7792Open in IMG/M
3300027667|Ga0209009_1172268All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7550Open in IMG/M
3300027745|Ga0209908_10000407All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3910Open in IMG/M
3300027854|Ga0209517_10333092Not Available875Open in IMG/M
3300027867|Ga0209167_10107540All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1432Open in IMG/M
3300027884|Ga0209275_10020896All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2927Open in IMG/M
3300027905|Ga0209415_11013712All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300028047|Ga0209526_10752887All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7608Open in IMG/M
3300028788|Ga0302189_10153262All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7994Open in IMG/M
3300029989|Ga0311365_10235632All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1577Open in IMG/M
3300030049|Ga0302191_10339903Not Available549Open in IMG/M
3300030503|Ga0311370_12321281All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7522Open in IMG/M
3300031122|Ga0170822_11209621All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7732Open in IMG/M
3300031261|Ga0302140_10810112All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7667Open in IMG/M
3300031525|Ga0302326_11022560Not Available1158Open in IMG/M
3300031718|Ga0307474_11321366All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium569Open in IMG/M
3300031753|Ga0307477_10385299All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7961Open in IMG/M
3300031754|Ga0307475_11460456Not Available526Open in IMG/M
3300031792|Ga0318529_10146528All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_71084Open in IMG/M
3300031823|Ga0307478_10516402All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7996Open in IMG/M
3300031962|Ga0307479_10966581Not Available822Open in IMG/M
3300032001|Ga0306922_11982660Not Available568Open in IMG/M
3300032042|Ga0318545_10389400All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7503Open in IMG/M
3300032160|Ga0311301_12064747Not Available662Open in IMG/M
3300032805|Ga0335078_10116595All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3827Open in IMG/M
3300032892|Ga0335081_10524702Not Available1483Open in IMG/M
3300032955|Ga0335076_11271260All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7620Open in IMG/M
3300033513|Ga0316628_100850218Not Available1205Open in IMG/M
3300034282|Ga0370492_0450160All Organisms → cellular organisms → Bacteria522Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil8.57%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil7.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.62%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.67%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.76%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.81%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.81%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.86%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.86%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog2.86%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.86%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.90%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.90%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.90%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.90%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.90%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.90%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.95%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.95%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.95%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.95%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.95%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.95%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.95%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost0.95%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.95%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.95%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.95%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.95%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.95%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006573Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009640Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40EnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011110Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 65 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017993Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300023019Soil microbial communities from Bohemian Forest, Czech Republic ? CSU1EnvironmentalOpen in IMG/M
3300025442Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026275Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058 (SPAdes)EnvironmentalOpen in IMG/M
3300026514Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-BEnvironmentalOpen in IMG/M
3300027158Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF011 (SPAdes)EnvironmentalOpen in IMG/M
3300027521Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027570Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027575Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027635Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027667Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027745Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2MEnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2EnvironmentalOpen in IMG/M
3300029989III_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030049Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_1EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300031122Oak Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031261Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300034282Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12627J18819_1049844523300001867Forest SoilRALKEGVGRVRILPAAEAEALPQFYLMKLNCGTEVTCA*
JGIcombinedJ26739_10046360513300002245Forest SoilGLALKQGVGRVRILPATEVEMLPQFYLTKLSCGTEVTYS*
JGIcombinedJ26739_10165463213300002245Forest SoilLKSGVGRVRILPAAQVEMLPLFYFTKLECGTEVLRA*
Ga0062387_10042220123300004091Bog Forest SoilTQALHKGVGRVRILPAAQVEILPQFYFTKMACGTEVIGA*
Ga0062593_10157050523300004114SoilLEACKQALKKGVGRVRIMPAAQEEVLPQFYFTKMECGTEVLGA*
Ga0066674_1025486113300005166SoilACGQALKKGVSRVRILPAAHAEELPLFYFTKLHYGTEVTAV*
Ga0070709_1120639323300005434Corn, Switchgrass And Miscanthus RhizosphereRQALKQGVGRVRILPAAEAEALPQFYLTKLNCGTEVTCA*
Ga0070732_1055860723300005542Surface SoilKQGVGRVRILPAAEAEALPQFYLTKLNCGTEVTCA*
Ga0066699_1063345813300005561SoilHALHHGVGRVRILPAEQVHMLSQFYFSKLDCGTEVLVA*
Ga0066693_1044277723300005566SoilLRGGVNRVRILPANDIDALPDFYFTRVEAGTEVFA*
Ga0066706_1103126023300005598SoilACGHALKRGVGRVRIVPAARAEILPQFYFAKLGCGTEVIVA*
Ga0070763_1000393583300005610SoilKHGVGRVRILPAAEAEALPQFYLTKLNCGTEVTCA*
Ga0068863_10021041913300005841Switchgrass RhizosphereNGVDRVRILPAAQAEMLHDFYLTRVDCGTEVMVA*
Ga0066696_1047790013300006032SoilALRRGVGRVRILPAAQAEILSQFYFQKLEFGTEVIGA*
Ga0066652_10187803813300006046SoilKHGVNRVRILPAAQAEILPLFYFAKLECGTEVLRA*
Ga0075019_1078587013300006086WatershedsQALRQGVGRVRILPAAEAEALPQFYLTKLNCGTEVTCA*
Ga0070716_10045672523300006173Corn, Switchgrass And Miscanthus RhizosphereQALRKGVGRVRILPAAQADTLPQFYLTKLDGGTEVTVT*
Ga0074055_1162377923300006573SoilALLHGVDRVRILPAAEVEALPEFYFTKIDSGTELLVA*
Ga0066658_1084702023300006794SoilRSKGVGRVRILPAAEADVLPQFYFAKLLAGTEVRVA*
Ga0066710_10037869013300009012Grasslands SoilALKKGVGRVRILPAAQAEILPQFYFTKLECGTEVTA
Ga0099829_1136335023300009038Vadose Zone SoilQALKQGVGRVRILPAAEAEALPQFYLTKLNCGTEVTCA*
Ga0099830_1174469613300009088Vadose Zone SoilKLEACGHALKRGVGRVRILPAAQAEILPQFYFAKL*
Ga0105240_1238086013300009093Corn RhizosphereKRGVGRVRILPAAQAQLLPQFYFEKLEFGTEVIGA*
Ga0099792_1023740423300009143Vadose Zone SoilQEALRRGVPRVRILPAAQVESLPQLYVSKIDHGTEVLVA*
Ga0116220_1004680813300009525Peatlands SoilKSGVGRVRILPAAQVEMLPLFYFTKLECGTEVLRA*
Ga0116220_1040988323300009525Peatlands SoilCQHALRSGVGRVSILPAAHSEMLPELCFSRIDLGTEVMLA*
Ga0105237_1095998713300009545Corn RhizosphereKGVRRVRILPAAQAEILPQFYFQKLEYGTEVIGA*
Ga0116126_117247013300009640PeatlandCGLALKQGVGRVRILPANEVEVLPQFYLTKLSCGTEVTHS*
Ga0116134_109945113300009764PeatlandKQGVGRVRILPAAEVEMLPQFYLTKLSCGTEVTYS*
Ga0126373_1176930313300010048Tropical Forest SoilKGVGRVRILPAAQAEVLPQFYFEKIEFGTEVIAR*
Ga0134067_1021815423300010321Grasslands SoilKRGVGRVRILPAAQAEILPQFYFQKLEFGTEVIGA*
Ga0126370_1034581313300010358Tropical Forest SoilKQALRKGVGRVRILPASEADELPAFYFSKLEHGTEVCVA*
Ga0126370_1190973623300010358Tropical Forest SoilLLRGVNRVRILPANEVEALPQFYFTRIESGTEVLVA*
Ga0134125_1042121633300010371Terrestrial SoilLLRGVNRVRILPAAEVEALPEFYFAKIESGTEVLVA*
Ga0136449_10183546523300010379Peatlands SoilDALRSGVGRVRILPAAEAEVLPGFYHSRIESGTEVMA*
Ga0126383_1031282333300010398Tropical Forest SoilLMRGVNRVRILPAEQVEALPEFYTMRIESGTEVLVA*
Ga0134121_1069597513300010401Terrestrial SoilKGVGRVRILPAAQADALPQFYLTRLDGGTEVIVA*
Ga0138578_117309013300011110Peatlands SoilSGVGRVRILPAAHSEMLPELCFSRIDLGTEVMLA*
Ga0137379_1018750933300012209Vadose Zone SoilLKQGVGRVRILPAAEAEALPQFYLTKLNCGTEVTCA*
Ga0150985_12122270323300012212Avena Fatua RhizosphereAWKQGVGRVRILPAAEADALPQFYLTKLTCGTEVTCV*
Ga0137361_1064189723300012362Vadose Zone SoilLKCGVGRVRILPAAQVEMLPLFYFAKLECGTEVLRA*
Ga0137359_1115140113300012923Vadose Zone SoilMEACTEALKRGVGRVSILPAAQVEMLTLFYFTKLECGTEVLRA*
Ga0137419_1041370623300012925Vadose Zone SoilQALKSGVGRVRILPASQVEMLPVVYFTKLECGTEVLRA*
Ga0164299_1091127913300012958SoilKRGVGRVRILPAAQAEALPQFYFQKLDYGTEVIGA*
Ga0164299_1146744723300012958SoilLLHGVNRVRILPAAEVEALPEFYFAKIESGTEVLVA*
Ga0157378_1223457423300013297Miscanthus RhizosphereQALKQGVGRVRILPAAEAESLPQFYLTKLNCGTEVTCA*
Ga0182016_1073104713300014493BogALKQGVGRVRIFPANEAEILPQFYLTKLSCGTEVTYS*
Ga0182021_1318309313300014502FenRGVGRVRILPAVQADVLPQFYFTKLECGTEVIVA*
Ga0182041_1021354433300016294SoilALKEGVGRVRILPAAEAEALPQFYLMKLNCGTEVTCA
Ga0187801_1043919713300017933Freshwater SedimentKRGVGRVRILPASQADKLPLFYFTKIECGTEVLRA
Ga0187819_1044664613300017943Freshwater SedimentIQALKRGVGRVRILPAAQVEVLPLFYFTRIECGTEVLRA
Ga0187781_1012130433300017972Tropical PeatlandTEALHKGVKRVRILPAAQAEALPQIHLTRLECGTEVIRA
Ga0187823_1031649213300017993Freshwater SedimentGQALKRGVGRVRILPAAQAEVLGEFYFSKLECGTEVIGP
Ga0187851_1036999933300018046PeatlandDALRSGVGRVRILPAAEAEVLPGFYHSRIEAGTEVMAQ
Ga0187769_1053059023300018086Tropical PeatlandPKLQAAKRALQQGVGRVRIFPSSNADALPQFYLTKIECGTEVISR
Ga0210403_1063613923300020580SoilQALKQGVGRVRILPDTEAEVLPQFYMTKLSCGTEVTYS
Ga0210408_1128014523300021178SoilKLEACSQALHKGVGRVRILPAAQAGSLSEFYFSRNPWGTEVTSA
Ga0193719_1002382513300021344SoilKHGVTRVRILPAAQADILPLFYFAKLECGTEVLRT
Ga0210383_1121023123300021407SoilALNKGVGRVRILPAAQAEVLSQFYFTKLPCGTEVTCA
Ga0210402_1173587923300021478SoilEACTQALHKGVGRVRILPAAQAEGLSDFYFTSLPWGTEVTA
Ga0210410_1012992433300021479SoilALRKGVGRVRIFPATQAEILPQFYFAKLDCGTEVIGV
Ga0224560_10006713300023019SoilKQGVGRVRILPAIEAEVLPQFYLTKLSCGTEVTYS
Ga0208034_103239013300025442PeatlandTQALKCGVGRVRILPAAQVEFLPLFYFAKLECGTEVLRA
Ga0207699_1117996923300025906Corn, Switchgrass And Miscanthus RhizosphereRQALKQGVGRVRILPAAEAEALPQFYLTKLNCGTEVTCA
Ga0207671_1126517623300025914Corn RhizosphereALKKGVARVRILPAAQAEILAQFYFTKLECGTEVIGA
Ga0207687_1004531613300025927Miscanthus RhizosphereQALKKGVGRVRIMPAAQAEVLPQFYFTKMECGTEVLGA
Ga0207700_1148229113300025928Corn, Switchgrass And Miscanthus RhizosphereLLHGVNRVRILPAAEVEALPEFYFAKIESGTEVLVA
Ga0207665_1051750323300025939Corn, Switchgrass And Miscanthus RhizosphereLKRGVGRVRILPASQAETLPQFYLTKLYGGTEVTVA
Ga0207674_1221348423300026116Corn RhizosphereKRGVGRVRILPAAQAQVLPQFYFQKLEYGTEVIGA
Ga0207698_1027612113300026142Corn RhizosphereKRGVGRVRILPAAQAQVLPQFYFQKLELGTEVIGA
Ga0209901_104992213300026275Permafrost SoilALMHGVNRVRILPAAEVEALPGFYVTKIESGTEVLVA
Ga0257168_108477423300026514SoilRKGVGRVRILPAVQADTLPQFYLTRLDGGTEVIVA
Ga0208725_104089213300027158Forest SoilLKQGVGRVRILPANEAEILPQFYLTKLSCGTEVTYS
Ga0209524_112036713300027521Forest SoilALRKGVGRVRILPAVQADTLPQFYLTKLDGGTEVICA
Ga0208043_109108713300027570Peatlands SoilQHALRSGVGRVRILPAAHSEMLPELCFSRIDLGTEVMLA
Ga0209525_104604723300027575Forest SoilALKSGVGRVRILPASQVEMLPLFYFTKLECGTEVLRA
Ga0209625_106881313300027635Forest SoilKRALKQGVGRVRILPAAEAEALPQFYLTKLPCGTEVTCA
Ga0209009_117226823300027667Forest SoilKQALKQGVGRVRILPAAEAEALPQFYLTKLNCGTEVTCA
Ga0209908_1000040713300027745Thawing PermafrostLKQGVGRVRIFPANEAEVLPQFYLTKLSCGTEVTYS
Ga0209517_1033309223300027854Peatlands SoilLRSGVGRVRILPAAHSEMLPELCFSRIDLGTEVMLA
Ga0209167_1010754033300027867Surface SoilALRQGVKRVRILPTAEVERLPQFYLTKLSCGTEVTHS
Ga0209275_1002089643300027884SoilALKSGVGRVRILPAAQVEMLPLFYFARLECGTEVLRA
Ga0209415_1101371213300027905Peatlands SoilALKQGVGRVRILPATEVEALPQFYLTKLSCGTEVTHS
Ga0209526_1075288713300028047Forest SoilGLALKQGVGRVRILPATEVEMLPQFYLTKLSCGTEVTYS
Ga0302189_1015326213300028788BogKLQACGQALKQGVGRVRIFPANEAEILPQFYLTKLSCGTEVTYS
Ga0311365_1023563213300029989FenQALKRGVGRVRILPSAQAEVLPLFYFERIDCGTEVLRA
Ga0302191_1033990323300030049BogTQALKSGVGRVRILPASQVEVLPLFYFTKIECGTEVLRA
Ga0311370_1232128123300030503PalsaCELALKQGVRRVRILPTAEVERLPQFYLTKLSCGTEVTYS
Ga0170822_1120962123300031122Forest SoilLKQGVGRVRILPATEAEVLPQFYLTKLSCGTEVTCS
Ga0302140_1081011223300031261BogLHACGQALKQGVGRVRIFPANEAEILPQFYLTKLSCGTEVTYS
Ga0302326_1102256023300031525PalsaALRKGVGRVRILPAAQAEILPQFYFTKLECGTEVIGA
Ga0307474_1132136613300031718Hardwood Forest SoilKSGVGRVRILPAAQVEMLPLFYFTKLDCGTEVLRA
Ga0307477_1038529913300031753Hardwood Forest SoilLSKGVGRVRILPAAEADVLPQFYFAKLQMGTEVRAS
Ga0307475_1146045613300031754Hardwood Forest SoilALHRGVGRVRILPAAQVEILPQFYFTKLDCGTEVIGA
Ga0318529_1014652813300031792SoilSKGVGRVKILPASEADVLPQFYFAKLALGTEVRVA
Ga0307478_1051640213300031823Hardwood Forest SoilALKQGVGRVRILPATEVETLPQFYLTKLTCGTEVTCA
Ga0307479_1096658113300031962Hardwood Forest SoilQALLQGVNRVRILPAAEVEILPQFYFSKIESGTEVSVA
Ga0306922_1198266023300032001SoilNALLRGVNRVRILPAAEVDALPEFYSTRIESGTEVLVA
Ga0318545_1038940013300032042SoilLKEGVGRVRILPAAEAEALPQFYLMKLNCGTEVTCA
Ga0311301_1206474713300032160Peatlands SoilLRSGVGRVRILPAAEAEVLPGFYHSRIESGTEVMA
Ga0335078_1011659513300032805SoilALKRGVSRVRILPAAHAEILPQFFFTKLECGTEVITA
Ga0335081_1052470213300032892SoilACAQALKKGVGRVKIMPAEQAQVLPQFYFTKLECGTEVLGA
Ga0335076_1127126013300032955SoilQALKQGVGRVRILPAAEAEALPQFYLTKLNCGTEVTCA
Ga0316628_10085021813300033513SoilLLHGVNRVRILPAVEVEALPEFYFTKIESGTEVLVA
Ga0370492_0450160_405_5213300034282Untreated Peat SoilKALKQGVGRVRILPAAEVEALPQFYRTKLPCGTEVTCA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.