| Basic Information | |
|---|---|
| Family ID | F095941 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MSTDISFCPLCAGKLDAGDDEQFVCEDCESQFFIQVVEEGDEDDEDEEL |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 78.64 % |
| % of genes near scaffold ends (potentially truncated) | 45.71 % |
| % of genes from short scaffolds (< 2000 bps) | 87.62 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (68.571 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (13.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.905 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.524 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 3.90% β-sheet: 15.58% Coil/Unstructured: 80.52% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF03641 | Lysine_decarbox | 24.76 |
| PF01695 | IstB_IS21 | 10.48 |
| PF04545 | Sigma70_r4 | 8.57 |
| PF00166 | Cpn10 | 4.76 |
| PF00196 | GerE | 1.90 |
| PF04389 | Peptidase_M28 | 1.90 |
| PF00118 | Cpn60_TCP1 | 0.95 |
| PF13360 | PQQ_2 | 0.95 |
| PF01554 | MatE | 0.95 |
| PF00375 | SDF | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG1611 | Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family | Nucleotide transport and metabolism [F] | 24.76 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 10.48 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 4.76 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 68.57 % |
| Unclassified | root | N/A | 31.43 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000559|F14TC_102057975 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300000955|JGI1027J12803_100147158 | Not Available | 910 | Open in IMG/M |
| 3300004463|Ga0063356_105792015 | Not Available | 530 | Open in IMG/M |
| 3300005166|Ga0066674_10553695 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300005172|Ga0066683_10710128 | Not Available | 595 | Open in IMG/M |
| 3300005174|Ga0066680_10827973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300005175|Ga0066673_10899388 | Not Available | 504 | Open in IMG/M |
| 3300005331|Ga0070670_102213921 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300005332|Ga0066388_106735418 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300005332|Ga0066388_106961331 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300005343|Ga0070687_101163546 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300005444|Ga0070694_100646967 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 855 | Open in IMG/M |
| 3300005450|Ga0066682_10792561 | Not Available | 573 | Open in IMG/M |
| 3300005451|Ga0066681_10435804 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300005466|Ga0070685_10959341 | Not Available | 639 | Open in IMG/M |
| 3300005552|Ga0066701_10738608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| 3300005554|Ga0066661_10613472 | Not Available | 645 | Open in IMG/M |
| 3300005557|Ga0066704_10303262 | Not Available | 1079 | Open in IMG/M |
| 3300005561|Ga0066699_10946787 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300005566|Ga0066693_10460437 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300005586|Ga0066691_10859735 | Not Available | 534 | Open in IMG/M |
| 3300005719|Ga0068861_102646247 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300005764|Ga0066903_108384139 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
| 3300005829|Ga0074479_10226675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5641 | Open in IMG/M |
| 3300005840|Ga0068870_10561146 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300006046|Ga0066652_102098901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300006173|Ga0070716_100641256 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300006358|Ga0068871_102039370 | Not Available | 546 | Open in IMG/M |
| 3300006854|Ga0075425_100443438 | All Organisms → cellular organisms → Bacteria | 1495 | Open in IMG/M |
| 3300006865|Ga0073934_10000734 | All Organisms → cellular organisms → Bacteria | 88889 | Open in IMG/M |
| 3300006881|Ga0068865_101632815 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300007265|Ga0099794_10581742 | Not Available | 592 | Open in IMG/M |
| 3300009012|Ga0066710_100285780 | All Organisms → cellular organisms → Bacteria | 2408 | Open in IMG/M |
| 3300009012|Ga0066710_100815717 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
| 3300009012|Ga0066710_101433978 | Not Available | 1069 | Open in IMG/M |
| 3300009012|Ga0066710_104095263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300009012|Ga0066710_104095264 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300009146|Ga0105091_10740934 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300009147|Ga0114129_13431694 | Not Available | 509 | Open in IMG/M |
| 3300009156|Ga0111538_10629560 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
| 3300009777|Ga0105164_10181149 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300010043|Ga0126380_10278878 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
| 3300010043|Ga0126380_11308557 | Not Available | 631 | Open in IMG/M |
| 3300010046|Ga0126384_10282606 | All Organisms → cellular organisms → Bacteria | 1356 | Open in IMG/M |
| 3300010133|Ga0127459_1056163 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2081 | Open in IMG/M |
| 3300010142|Ga0127483_1117622 | Not Available | 590 | Open in IMG/M |
| 3300010320|Ga0134109_10465494 | Not Available | 516 | Open in IMG/M |
| 3300010361|Ga0126378_11315739 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300010391|Ga0136847_10965552 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 704 | Open in IMG/M |
| 3300010400|Ga0134122_10978699 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300010400|Ga0134122_11836646 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300010401|Ga0134121_10836972 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300010401|Ga0134121_11287812 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
| 3300010403|Ga0134123_12433450 | Not Available | 589 | Open in IMG/M |
| 3300011120|Ga0150983_13852102 | All Organisms → cellular organisms → Bacteria | 3210 | Open in IMG/M |
| 3300011120|Ga0150983_13871790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
| 3300011120|Ga0150983_15170075 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300012206|Ga0137380_10008780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 9133 | Open in IMG/M |
| 3300012206|Ga0137380_11539812 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300012208|Ga0137376_10814366 | Not Available | 803 | Open in IMG/M |
| 3300012212|Ga0150985_101981647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300012212|Ga0150985_108896141 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300012212|Ga0150985_115950896 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5320 | Open in IMG/M |
| 3300012232|Ga0137435_1085835 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300012351|Ga0137386_10056082 | All Organisms → cellular organisms → Bacteria | 2729 | Open in IMG/M |
| 3300012469|Ga0150984_106782590 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300012469|Ga0150984_116606163 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300012469|Ga0150984_121334418 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300013297|Ga0157378_11224132 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 791 | Open in IMG/M |
| 3300014157|Ga0134078_10523987 | Not Available | 555 | Open in IMG/M |
| 3300014968|Ga0157379_10987075 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300015371|Ga0132258_11810986 | All Organisms → cellular organisms → Bacteria | 1538 | Open in IMG/M |
| 3300015371|Ga0132258_12443977 | All Organisms → cellular organisms → Bacteria | 1308 | Open in IMG/M |
| 3300015374|Ga0132255_103190753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 699 | Open in IMG/M |
| 3300016341|Ga0182035_11462153 | Not Available | 614 | Open in IMG/M |
| 3300016387|Ga0182040_10384877 | Not Available | 1097 | Open in IMG/M |
| 3300017966|Ga0187776_11354420 | Not Available | 540 | Open in IMG/M |
| 3300017970|Ga0187783_10137845 | All Organisms → cellular organisms → Bacteria | 1798 | Open in IMG/M |
| 3300018060|Ga0187765_10311122 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300018071|Ga0184618_10152074 | Not Available | 946 | Open in IMG/M |
| 3300018422|Ga0190265_13233094 | Not Available | 544 | Open in IMG/M |
| 3300018431|Ga0066655_10301840 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300019458|Ga0187892_10060979 | All Organisms → cellular organisms → Bacteria | 2492 | Open in IMG/M |
| 3300021080|Ga0210382_10548771 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300021178|Ga0210408_10678155 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300021476|Ga0187846_10389745 | Not Available | 573 | Open in IMG/M |
| 3300022563|Ga0212128_10780038 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300022756|Ga0222622_11429881 | Not Available | 509 | Open in IMG/M |
| 3300025174|Ga0209324_10689993 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300025310|Ga0209172_10000767 | All Organisms → cellular organisms → Bacteria | 81921 | Open in IMG/M |
| 3300025324|Ga0209640_11011937 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300025908|Ga0207643_10571816 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300025939|Ga0207665_10453724 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300026116|Ga0207674_11300335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
| 3300026538|Ga0209056_10026986 | All Organisms → cellular organisms → Bacteria | 5493 | Open in IMG/M |
| 3300027815|Ga0209726_10204057 | Not Available | 1039 | Open in IMG/M |
| 3300027874|Ga0209465_10414473 | Not Available | 674 | Open in IMG/M |
| 3300027895|Ga0209624_10748353 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
| 3300028802|Ga0307503_10854475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300031573|Ga0310915_10747811 | Not Available | 689 | Open in IMG/M |
| 3300031720|Ga0307469_12055203 | Not Available | 555 | Open in IMG/M |
| 3300032261|Ga0306920_101450926 | Not Available | 982 | Open in IMG/M |
| 3300033433|Ga0326726_10392817 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.33% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.71% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.76% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.76% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.86% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.86% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.86% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.86% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 2.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.86% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.86% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 2.86% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.90% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.90% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.95% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.95% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.95% |
| Wastewater | Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater | 0.95% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.95% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.95% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.95% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.95% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.95% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.95% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.95% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.95% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.95% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.95% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.95% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.95% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009777 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010133 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010142 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012232 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2 | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025174 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 3 | Environmental | Open in IMG/M |
| 3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TC_1020579753 | 3300000559 | Soil | MSTEISFCPVCAGKLDANEDEQYVCEDCESQFFIQLLEEGDEDDDDEEYLPAHADRG |
| JGI1027J12803_1001471582 | 3300000955 | Soil | MPTEISFCPMCAGKLDAGDDEQFVCEECETEFFIQV |
| Ga0055471_102357382 | 3300003987 | Natural And Restored Wetlands | MKTEISFCPTCAGKLDVAEDDQFQCEDCETRFYIQIAEEGDDGEDDE |
| Ga0063356_1057920152 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKAEISFCPLCAGKLDAGEDEQFVCEDCESQFFIQLVEGDDEDEDEE* |
| Ga0066674_105536951 | 3300005166 | Soil | MKTDISFCPLCAGKLDAGEDEQFVCEDCETQFFIQIAEAGEDEEEDEEL* |
| Ga0066683_107101281 | 3300005172 | Soil | MKTEISFCPLCAGKLDAGDDEQFVCEDCETQFFIQVVEEGEDEDEDEEY* |
| Ga0066680_108279732 | 3300005174 | Soil | MSAEISFCPLCAGKLDAGDDEQFICEDCETQFFIQVVEEGDDEEEDEEF* |
| Ga0066673_108993882 | 3300005175 | Soil | MSTDISFCPLCAGKLDAGDDEQFVCEDCESQFFIQVVEEGDEDEDDEES* |
| Ga0070670_1022139212 | 3300005331 | Switchgrass Rhizosphere | MKTDISFCPLCAGKLDAGEDEQFVCEDCESQFFIQLVEEGDEDDEDEEL* |
| Ga0066388_1067354182 | 3300005332 | Tropical Forest Soil | MTTEISFCPMCAGKLDAGDDEQFVCEDCETEFFIQVLEEGDEDDEDEEL* |
| Ga0066388_1069613312 | 3300005332 | Tropical Forest Soil | MTTEISFCPMCAGKLDAGDDEQFVCEDCETEFFIQVLEEGDEDEDEDEG* |
| Ga0070687_1011635462 | 3300005343 | Switchgrass Rhizosphere | MSTEVSFCPLCAGKLDSEKDDRFVCDDCETRFFIQVVDEEDDE |
| Ga0070694_1006469672 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTEISFCPMCAGKLDAGEDEQFVCEDCETSFFIQIAEEGDEDDEDEE* |
| Ga0066682_107925612 | 3300005450 | Soil | MKTDISFCPMCAGKLDAGEDEQFVCEDCESSFFIQVVEAGEDDDEEEEL* |
| Ga0066681_104358042 | 3300005451 | Soil | MSTEISFCPLCAGKLDSGEDEQFVCEDCETSFFIQIVEDGDEDEEEEE* |
| Ga0070685_109593412 | 3300005466 | Switchgrass Rhizosphere | MSTEISFCPLCAGKLDASEDEQFVCEDCEGQFFIQVLEEGDEEDED |
| Ga0066701_107386082 | 3300005552 | Soil | MSAEISFCPLCAGKLDAGDDEQFICEDCETQFFIQVVEEGDDEEEDEEI* |
| Ga0066661_106134721 | 3300005554 | Soil | MCAGKLDAGDDEQFVCEDCETSFFIQVVEEGDEDEE |
| Ga0066704_103032621 | 3300005557 | Soil | MSTEISFCPVCAGKLDAGDDEQFVCEDCETSFFIQVVEEGEGDE |
| Ga0066699_109467872 | 3300005561 | Soil | MKTDISFCPLCAGKLDAGEDEQFVCEDCESSFFIQLVEAGEEDDEDEEA* |
| Ga0066693_104604372 | 3300005566 | Soil | MKTDISFCPLCAGKLDAGEDEQFVCEDCESSFFIQLVEAGEEDDEEEEA* |
| Ga0066691_108597352 | 3300005586 | Soil | MSTEISFCPVCAGKLDAGDDEQFVCEDCETSFFIQVVEEG |
| Ga0068861_1026462472 | 3300005719 | Switchgrass Rhizosphere | MKTEISFCPLCAGKLDAGDDEQFVCEDCESQFFIQIVEEGDEDEDEDE* |
| Ga0066903_1083841391 | 3300005764 | Tropical Forest Soil | MTTEISFCPMCAGKLDAGDDEQFVCEDCETEFFIQVLEEGDEDEEE |
| Ga0074479_102266755 | 3300005829 | Sediment (Intertidal) | MKTEISFCPLCAGKLDTGDDEQYTCEDCEGKFFIQVVNEGEEDEDDDEE* |
| Ga0068870_105611463 | 3300005840 | Miscanthus Rhizosphere | MSVEISFCPLCAGKLDSGNNDKFVCDDCETRFLIQVVDED |
| Ga0066652_1020989012 | 3300006046 | Soil | PMCAGKLDSGEDEQFVCEDCETSFFIQVAEEGDEDDDEEE* |
| Ga0070716_1006412561 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTEISFCPLCAGKLDASEDEQFLCEDCETSFFIQVVEEGEDDEEEE |
| Ga0068871_1020393702 | 3300006358 | Miscanthus Rhizosphere | MGAEISFCPLCAGKLDAGDDEQYVCEDCESQFFIQVVE |
| Ga0075425_1004434383 | 3300006854 | Populus Rhizosphere | MSTEISFCPLCAGKLDSGEDEQFVCEDCETSFFIQVVEEGD |
| Ga0073934_1000073440 | 3300006865 | Hot Spring Sediment | MSTDISFCPSCAGKLDAGDDDQFTCQDCEAEFLIQIVEEGADLDDEEDDEY* |
| Ga0068865_1016328152 | 3300006881 | Miscanthus Rhizosphere | MSTEISFCPACAGKLDAGEDEQYVCEDCESQFFIQLLEEGDEDEDDEE* |
| Ga0099794_105817422 | 3300007265 | Vadose Zone Soil | MSTEISFCPLCAGKLDSGEDEQFVCEDCETSFFIQVVEDGDEDEEDEE* |
| Ga0066710_1002857803 | 3300009012 | Grasslands Soil | MSTDISFCPLCAGKLAAGEDEQFVCEDCETEFFIQVVEEGDEDDE |
| Ga0066710_1008157173 | 3300009012 | Grasslands Soil | MSAEISFCPLCAGKLDAGDDEQFICEDCETQFFIQVVEEGDDEE |
| Ga0066710_1014339782 | 3300009012 | Grasslands Soil | MGSEISFCPRCAGKLDSGEDEQFVCEDCETQFFIQVVEEGDEDDED |
| Ga0066710_1040952631 | 3300009012 | Grasslands Soil | ISFCPLCAGKLDAGDDEQFICEDCETQFFIQVVEEGDDEEEDEEI |
| Ga0066710_1040952641 | 3300009012 | Grasslands Soil | ISFCPLCAGKLDAGDDEQFICEDCETQFFIQVVEEGDDEEEDEEF |
| Ga0105091_107409341 | 3300009146 | Freshwater Sediment | MKTDITFCPMCAGKLDAGEDEQFVCEECEAQFFIQVVDDGDDDEEEEAEP* |
| Ga0114129_134316942 | 3300009147 | Populus Rhizosphere | MSAEISFCPVCAGKLDASEDEQFVCEDCEGQFFIQVLEEGDE |
| Ga0111538_106295601 | 3300009156 | Populus Rhizosphere | MTTEISFCPMCAGKLDAGDDEQFVCEECETEFFIQVME |
| Ga0105164_101811492 | 3300009777 | Wastewater | MSAEISFCPLCAGKLDSGEDEQFVCQDCESSFFIQIVEEGDEDEDEDE* |
| Ga0126380_102788781 | 3300010043 | Tropical Forest Soil | MSTEISFCPVCAGKLDANEDEQYVCEDCESQFFIQ |
| Ga0126380_113085571 | 3300010043 | Tropical Forest Soil | MTTEISFCPMCAGKLDAGDDEQFVCEDCETEFFIQV |
| Ga0126384_102826063 | 3300010046 | Tropical Forest Soil | MSTEISFCPVCAGKLDAGDDEQFVCEDCETSFFIQVVEEGEGDEEEEE |
| Ga0127459_10561631 | 3300010133 | Grasslands Soil | MSTEISFCPVCAGKLDAGDDEQFVCEDCETSFFIQVVEE |
| Ga0127483_11176222 | 3300010142 | Grasslands Soil | MKTEISFCPLCAGKLDAGEDEQFNCEDCETQFFIQVVEEGEDDEGEES* |
| Ga0134109_104654942 | 3300010320 | Grasslands Soil | MSAEISFCPLCAGKLDAGDDEQFICEDCETQFFIQVVGEADDEEEDEEF* |
| Ga0126378_113157391 | 3300010361 | Tropical Forest Soil | MSTEISFCPVCAGKLDAGDDEQFVCEDCETSFFIQ |
| Ga0136847_109655521 | 3300010391 | Freshwater Sediment | MSAEISFCPLCAGKLDSGEDEQFVCEDCEATFFIQVVDAGDEDEDEEDN* |
| Ga0134122_109786992 | 3300010400 | Terrestrial Soil | MKTEISFCPMCAGKLDAGDDEQFVCEDCETSFFIQVAEEGDEDDEDEE* |
| Ga0134122_118366462 | 3300010400 | Terrestrial Soil | MKTDISFCPLCAGKLDAGEDEQFVCEDCESQFFIQLVEEGDEDDEDDEL* |
| Ga0134121_108369722 | 3300010401 | Terrestrial Soil | MATEISFCPVCAGKLDAGDDEQFVCEDCESAFFIQIVEEGDEDDE |
| Ga0134121_112878122 | 3300010401 | Terrestrial Soil | MKTDISFCPLCAGKLDAGEDEQFVCEDCETHFFIQVAEAGEEDEEDEEL* |
| Ga0134123_124334502 | 3300010403 | Terrestrial Soil | MKTDISFCPMCAGKLESGDEDQFVCEDCESQFLIEVLEEGDADADEDEE* |
| Ga0150983_138521022 | 3300011120 | Forest Soil | MCAGKLDAGDDEQFVCEDCETSFFIQVVEEGDEDDEEDEY* |
| Ga0150983_138717902 | 3300011120 | Forest Soil | LCAGKLDAGEDEQFVCEDCESSFFIQIVEEGEDDDDDEEA* |
| Ga0150983_151700751 | 3300011120 | Forest Soil | MKTDISFCPLCAGKLDAGEDEQFVCEDCESSFFIQIVEEGEDDDEDEDA* |
| Ga0137380_100087801 | 3300012206 | Vadose Zone Soil | MSAEISFCPLCAGKLDAGDDEQFICEDCETQFFIQVVEE |
| Ga0137380_115398121 | 3300012206 | Vadose Zone Soil | KMSAEISFCPLCAGKLDAGDDEQFICEDCETQFFIQVVEEGDDEEEDEEF* |
| Ga0137376_108143662 | 3300012208 | Vadose Zone Soil | MKTDISFCPSCAGKLDAGEEEQFVCEDCETHFFIQIVEEGEDDDDDEE* |
| Ga0150985_1019816472 | 3300012212 | Avena Fatua Rhizosphere | MSTEISFCPLCAGKLDAGDDEQYVCEYCESQFFIQVVEEGDEDEEDEE* |
| Ga0150985_1088961412 | 3300012212 | Avena Fatua Rhizosphere | MSAEISFCPLCAGKLDSGEDEQFICEDCESSFFIQVVADGDEDEEDEEE* |
| Ga0150985_1159508967 | 3300012212 | Avena Fatua Rhizosphere | MKTDISFCPMCAGKLESGDEDQFVCEECESQFLIEVLEAGDADEDEDEE* |
| Ga0137435_10858352 | 3300012232 | Soil | MSTEISFCPVCAGKLDASEDEQYVCEDCEGQFFIQVLQEGDEDEDDEES* |
| Ga0137386_100560822 | 3300012351 | Vadose Zone Soil | MSTDISFCPLCAGKLDAGDDEQFVCEDCESQFFIQVVEEGDEDDEDEEL* |
| Ga0150984_1067825901 | 3300012469 | Avena Fatua Rhizosphere | MSAEISFCPLCAGKLDSGEDEQFICEDCESSFFIQVVADGDEDEEDDEE* |
| Ga0150984_1166061631 | 3300012469 | Avena Fatua Rhizosphere | MKTDISFCPLCAGKLDAGEDEQFVCEDCESSFFIQLVEAGEDDDEDEE* |
| Ga0150984_1213344181 | 3300012469 | Avena Fatua Rhizosphere | MKTDISFCPMCAGKLEAGDEDQFVCEECESQFLIEVLEAGDADEDEDEE* |
| Ga0157378_112241321 | 3300013297 | Miscanthus Rhizosphere | MKTDISFCPLCAGKLDAGEDEQFVCEDCESQFFIQLVEGDEDEEDEEV* |
| Ga0134078_105239871 | 3300014157 | Grasslands Soil | MSAEISFCPLCAGKLDAGDDEQFICEDCETQFFIQVV |
| Ga0157379_109870753 | 3300014968 | Switchgrass Rhizosphere | MSVEISFCPLCAGKLDSGNNDKFVCDDCETRFLIQVVDEDDEDDE |
| Ga0132258_118109861 | 3300015371 | Arabidopsis Rhizosphere | MSAEISFCPVCAGKLEAGDEDQFVCEECESQFLIEVLEEGDSDEE |
| Ga0132258_124439772 | 3300015371 | Arabidopsis Rhizosphere | MSTEISFCPLCAGKLDSGDDEQYICEDCESQFFIQVVEEGDEDEDDEE* |
| Ga0132255_1031907532 | 3300015374 | Arabidopsis Rhizosphere | MSTEISFCPLCAGKLDSESDERFQCEDCETQFLIQVVDS |
| Ga0182035_114621532 | 3300016341 | Soil | MSAEISFCPLCAGKLDSGDDEQYICEDCESQFFIQVVEEGDEDEED |
| Ga0182040_103848773 | 3300016387 | Soil | MSAEISFCPLCAGKLDAGDDEQYVCEDCESQFFIQVVEEGDED |
| Ga0187776_113544202 | 3300017966 | Tropical Peatland | MSAEISFCPLCAGKLDAGDDEQYVCEDCESEFFIQVVEEGDEDEEDE |
| Ga0187783_101378453 | 3300017970 | Tropical Peatland | MSTEISFCPLCAGKLDAGDDEQFICEDCETGFFIQVVEEGEGEDEDEEY |
| Ga0187765_103111222 | 3300018060 | Tropical Peatland | MSTEISFCPLCAGKLDSGDDEQYVCEDCESQFFIQVVEEGDEDEDEDE |
| Ga0184618_101520742 | 3300018071 | Groundwater Sediment | MSTDISFCPLCDGRLAAGEDEQFVCGDCETEFFSQVVEE |
| Ga0190265_132330942 | 3300018422 | Soil | MSTDISFCPLCAGKLDAGEDEQFVCEDCESSFFIQVVDEGDEDEDDEE |
| Ga0066655_103018402 | 3300018431 | Grasslands Soil | MKTEISFCPLCAGKLDAGDDEQFVCEDCETQFFIQVVEEGEDEDEDEEY |
| Ga0187892_100609795 | 3300019458 | Bio-Ooze | MSAEISFCPMCAGKLDAGDDEQFTCEECETQFFIQVVAEGDDDEDEDEEF |
| Ga0210382_105487712 | 3300021080 | Groundwater Sediment | TEISFCPMCAGKLDAAENEQFVCEDCETSFFIQIAEGDEDDEDEEL |
| Ga0210408_106781552 | 3300021178 | Soil | MKTDISFCPLCAGKLDAGEDEQFVCEDCESSFFIQIVEEGEDDDEDEEA |
| Ga0187846_103897452 | 3300021476 | Biofilm | MSTEISFCPVCAGKLDAGDDEQFVCEDCETSFFIQVVEEGDEDEEEEDY |
| Ga0212128_107800382 | 3300022563 | Thermal Springs | MRAEISFCPLCAGKLDSGEDEQFVCEDCESSFFIQVVEEGDEADEDEDE |
| Ga0222622_114298812 | 3300022756 | Groundwater Sediment | MSAEISFCPLCAGKLDSGEDEQFVCEDCESSFFIQVVDAGDE |
| Ga0209324_106899932 | 3300025174 | Soil | MSAEISFCPLCAGKLDSGEDEQFVCEDCEATFFIQVVDAGDEGEDEEDN |
| Ga0209172_1000076728 | 3300025310 | Hot Spring Sediment | MSTDISFCPSCAGKLDAGDDDQFTCQDCEAEFLIQIVEEGADLDDEEDDEY |
| Ga0209640_110119373 | 3300025324 | Soil | MKTEISFCPLCAGKLEAGDEEQFTCEDCESKFFIQLVQ |
| Ga0207643_105718163 | 3300025908 | Miscanthus Rhizosphere | MSVEISFCPLCAGKLDSGNNDKFVCDDCETRFLIQVVDEDDD |
| Ga0207665_104537242 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTEISFCPLCAGKLDSGDDEQYVCEDCESQFFIQVVEEGDEDEDDEE |
| Ga0207674_113003351 | 3300026116 | Corn Rhizosphere | ACAGKLDAGEDEQYVCEDCESQFFIQLLEEGDEDEDDEE |
| Ga0209056_100269862 | 3300026538 | Soil | MSAEISFCPLCAGKLDAGDDEQFICEDCETQFFIQVVEEGDDEEEDEEF |
| Ga0209726_102040571 | 3300027815 | Groundwater | MSVEISFCPICAGKLDGGEEEQYVCEDCEAQFFIQVVAEGEDDDEDEES |
| Ga0209465_104144732 | 3300027874 | Tropical Forest Soil | MSAEISFCPLCAGKLDSGDDEQYICEDCESQFFIQIVEE |
| Ga0209486_105046772 | 3300027886 | Agricultural Soil | MKTEISFCPTCAGKLDVAEDDQFQCEDCETKFYIQIAEEGEEEEED |
| Ga0209624_107483532 | 3300027895 | Forest Soil | MKTDISFCPLCAGKLDAGEDEQFVCEDCESSFFIQIVEAGEDDDEEDEA |
| Ga0307503_108544752 | 3300028802 | Soil | MSVEISFCPLCAGKLDSGNNDKFVCDDCETRFLIQVVEEDDD |
| Ga0310915_107478111 | 3300031573 | Soil | MSAEISFCPLCAGKLDAGDDEQYVCEDCESQFFIQVVEEGDEDEEDE |
| Ga0307469_120552031 | 3300031720 | Hardwood Forest Soil | GKLDAGEDEQFVCEDCESSFFIQIVEEGEDDDDEEDA |
| Ga0306920_1014509261 | 3300032261 | Soil | MSAEISFCPLCAGKLDSGEDEQYVCEDCESAFFIQVVDEGDEDEEE |
| Ga0326726_103928172 | 3300033433 | Peat Soil | MKAEISFCPLCAGKLDAGEDEQFVCEDCESQFFIQLVEGEDDEDEE |
| ⦗Top⦘ |